The script, written by Jamie Mathieson, follows three social outcasts -- two geeks and a cynic -- as they attempt to navigate a time-travel conundrum in the middle of a British pub. Faris plays a girl from the future who sets the adventure in motion.
Subgenre: | post apocalypsetime travel comedy |
Themes: | time travel |
Locations: | campfire |
Characters: |
Story: | assassinmassacrefired from the jobscene during end creditspubblood spatterreference to adolf hitlernosebleedscene after end creditsalternate realityhiding in a closettime machinejukeboxhand over mouthpremonition β¦parallel universeclose up of eyezippo lighterdevastationleft for deadreference to george lucascorkscrewtime portalpotato chipstarting a fire3d glassesreference to paris hiltonchaos theoryreference to kevin costnerchild cryingquantumdinosaur costumeman urinatingdimensional portalgiant anttemporal paradoxtime travel agencysitting on a swingfuturistic weapon (See All) |
Based on the classic sci-fi novel by H.G. Wells, scientist and inventor, Alexander Hartdegen, is determined to prove that time travel is possible. His determination is turned to desperation by a personal tragedy that now drives him to want to change the past. Testing his theories with a time machine β¦ of his own invention, Hartdegen is hurtled 800,000 years into the future, where he discovers that mankind has divided into the hunter - and the hunted. (Read More)
Subgenre: | independent filmsuspensesteampunkalternate historyforeign language |
Themes: | time travelmurderdeathmemoryrobberylonelinesseducationcannibalismartificial intelligenceevolution |
Mood: | nightmare |
Locations: | new york citycavelaboratory |
Characters: | teacherprofessor |
Period: | 2000snear future1890s2030s |
Story: | based on novelbloodfighttitle spoken by characterexplosionknifechasepistolfireshot in the chestremakepunched in the facefalling from heightheld at gunpointscientist β¦strangulationaccidentdream sequencechild in perilritualshot in the leglibraryproduct placementstorytellingknocked outkicked in the faceskeletonshot in the shoulderpursuitsevered armshot in the armmoonexperimentundergroundmutanthunterloss of loved oneskullmind controltorchcannibaltitle appears in writingfrustrationhologramhousekeepertelepathytime machinelost lovegreenhousepocket watchheld captivehit with a shovelcaverncarriagejoggerflower shoplifted by the throatdistant futurealtering historydying repeatedlyshared dreamfuture time travelrapid agingcataclysmprimitivetime travel romanceyear 1899time travellerhole in the groundbatsreference to tom sawyerhuman harvestingmale time travellerliving undergrounddeteriorationgrandfather paradox (See All) |
Mr. Peabody is a business titan, inventor, scientist, gourmand, two-time Olympic medalist and genius...who also happens to be a dog. Using his most ingenious invention, the WABAC machine, Mr. Peabody and his adopted boy Sherman hurtle back in time to experience world-changing events first-hand and i β¦nteract with some of the greatest characters of all time. But when Sherman breaks the rules of time travel, our two heroes find themselves in a race to repair history and save the future, while Mr. Peabody may face his biggest challenge yet - being a parent. (Read More)
Subgenre: | historical eventcgi animation |
Themes: | time travelmarriageadoptionfrench revolution |
Locations: | schoolairplane |
Characters: | father son relationship |
Period: | 18th century |
Story: | character name in titledogdancingfirepaintingdecapitationtalking animalcakepastinventor3 dimensionalegypthypnosisboyfriendsocial worker β¦tasertime machineboy with glassesbased on cartoontyrantbased on television seriestalking dogancient egyptguillotinemultiple time framesblack holepharaohgluttonyplaying musictrojan horsetroytrojan warspace time continuumloss of powerancient troy (See All) |
The most acclaimed Star Trek adventure of all time with an important message. It is the 23rd century, and a mysterious alien probe is threatening Earth by evaporating the oceans and destroying the atmosphere. In their frantic attempt to save mankind, Admiral Kirk and his crew must time travel back t β¦o 1986 San Francisco where they find a world of punk, pizza and exact-change buses that are as alien to them as anything they have ever encountered in the far-off reaches of the galaxy. William Shatner and Leonard Nimoy return as Kirk and Spock, along with the entire Star Trek crew. (Read More)
Subgenre: | cult filmpunkspace opera |
Themes: | time travel |
Locations: | hospitalhelicopterbusouter spacesan francisco california |
Period: | 1980sfuture23rd century |
Story: | number in titlesequelcomputerfalling from heightbeercolon in titlenonlinear timelineunderwater scenelatex glovesbased on tv seriesfactorywritten and directed by cast memberdirected by starsix word titleobscene finger gesture β¦pizzapickup truckeyeglassesjoggingroman numeral in titlespacecraftfourth partblockbusterend of the worldenvironmentalaquariumteleportationinvisibilitywhalestar trekambassadorhead injurysaving the worldroman numbered sequelaircraft carrieradmiralgolden gate bridgegarbage cannuclear weaponspunk musicsagaantique shopbased on cult tv seriesheadbandhuman in outer spaceplanet earthculture shockray gunoperating roomplasticklingonback in timedialysiswarp speedphaservulcanmarine biologistprobehumpback whaleenterprise the starshiptime travelleraluminumtransamerica pyramidalien starshipmedical scannerpregnant animalstarfleet captainbootstrap paradoxcloaked shipfederation starshipmale doctorstarfleet admiralhandheld communicatorspacecraft officerhuman vulcan manvulcan womanconstitution class starshipklingon bird of preyklingon starshipvulcan manmale physicianplexiglastalking to a computercloaked starshipu.s.s. enterpriseu.s.s. enterprise ncc 1701 a (See All) |
In this case, a group of archaeologists and combat experts led by Paul Walker and Frances O'Connor use a "3-D fax machine" (so much for technobabble!) to time-travel back to France in 1357, in hopes of retrieving Walker's father and returning safely to the present. No such luck! Fending for themselv β¦es against marauding hordes of medieval French warriors at war with the invading British, these semi-intrepid travelers find their body count rising, and the deadline for their return home is rapidly approaching. (Read More)
Subgenre: | cult filmfish out of waterswashbucklersword and fantasy |
Themes: | time travelmurderdeathlovefriendshiprevengesurrealismdrinkingescapeherodeception |
Locations: | hospitalmotorcycleairplanevillagefrancecastlerooftoptunnelcave in |
Characters: | father son relationshippolicefrienddoctorteacherstudentpolicemantough guywarriorteacher student relationshipprofessor |
Story: | based on novelbloodviolenceone word titlekissfightexplosiontelephone callfirecell phonehorserescuecomputerdrinkbattle β¦swordfalling from heightshowdownbeerhand to hand combatcombatsword fightambushaxestabbingstabbed to deathstabbed in the chestdisarming someonefictional warduelstabbed in the backlocker roomstatueopening action scenehorse ridingsubtitled scenearsonbattlefieldeyeglassesgrenadebow and arrowspearbeer drinkinghelmetmad scientistknighttorchcannonshieldmobile phonemedieval timescapturesiegekingdomsword duelarrowruinsmonasterytime machineshot with an arrowmarinearcheryarcheologyartifactreluctant herotour guidehistorianairfieldman on fireinfantrycavalryburning buildingscientific researchshot with a bow and arrowscottish accentmacearchaeologistwormholeflaming arrowsteel helmetbody armorcatapultswordplayaltering historyarcheological digprototypesecret experimentcarvingmagelucky charmelectro shock1300ssecret lablost fatherhundred years warancient swordtrebuchetexperiment on oneselffemale archaeologistmedieval francesilver city new mexico (See All) |
PREDESTINATION chronicles the life of a Temporal Agent sent on an intricate series of time-travel journeys designed to ensure the continuation of his law enforcement career for all eternity. Now, on his final assignment, the Agent must pursue the one criminal that has eluded him throughout time.
Subgenre: | independent filmaustralian science fiction |
Themes: | time travelmurderdeathrevengesurrealismkidnappingpregnancydrunkennessdeceptiontravelterrorismtransgenderfirst love |
Mood: | rainneo noir |
Locations: | hospitalnew york citybarwheelchair |
Characters: | doctornursebabyaustralianpregnantyounger version of character |
Period: | 1980s1990s1970s1960s1940sfuture20th centurynear futureyear 1945year 1985year 1963year 1992year 1975year 1981year 1970 β¦year 1964 (See All) |
Story: | bloodone word titleflashbackmale rear nuditybare chested malecigarette smokingtitle spoken by characterexplosionsurprise endingpistolvoice over narrationshootoutbeatingshot to deathblood splatter β¦fistfightshot in the chesturinationslow motion scenepunched in the facewritten by directorbrawlheld at gunpointbombcollegerevolvercriminalgay slurorphanterroristnonlinear timelineno opening creditsnews reportbartendertrainingcharacter repeating someone else's dialogueperson on fireattackbased on short storymissionstorytellingrace against timesuitcasetough girlcollege studentshot in the shoulderscarsecret agenttypewritergrenadelooking at oneself in a mirrortape recorderhatagentspiderorphanageseriespool tableplot twistlostundercover agentdisfigurementlonerexistentialismgovernment agentnewspaper clippingmedia coverageclose up of eyesplastic surgeryplaying pooltime machinejukeboxlaundromatmedalburnt facesex changeurinatingnuclear bombsex on a deskbomberreference to abraham lincolnin medias resburn victimcleveland ohioclose up of eyetime looptreadmillglobeandrogynysecret organizationgender identityhermaphroditedevastationgender benderreference to ernest hemingwaywine cellartelling a joketime travelernurseryactress playing male rolewoman fighting a womangender reassignmenttime paradoxintersexabandoned apartmentsecret government organizationbandaged faceproverbmultiple actors for one charactertestingaustralian time travelhysterectomymeeting future selfstenographershort order cookcaesarean sectionsex change operationsurgical scarmale time travelleropening creditsantique storebootstrap paradoxreference to ian flemingpurpose in lifetemporal agentlighting a cigarette for someonetime travel agencyabraham lincoln quotation (See All) |
He's found his mojo, baby, and now Austin Powers is back again in this shagadelic comedy-adventure! The "sshhh!" hits the fan when Dr. Evil and Mini-Me escape from prison. Joining forces with the superfreaky Goldmember, they kidnap Austin's father, master spy Nigel Powers, in a dastardly time-travel β¦ scheme to take over the world. Before you can say "Shake Your Booty," Austin cruises to 1975 and teams up with sexy Foxxy Cleopatra to stop Dr. Evil and Goldmember from their mischievous mayhem. (Read More)
Subgenre: | cult filmspy spoof |
Themes: | time travelprisonfilmmakingadoptionprison escape |
Mood: | spoofbreaking the fourth walljames bond spoof |
Locations: | carhelicoptermotorcyclenightclubjapanoceansubmarine |
Characters: | father son relationshipyounger version of characterself referentialhomosexual kisssex with twins |
Period: | 1970s1960syear 1975 |
Story: | character name in titlesequelflashbackgunfightcell phoneurinationcatspytoiletexploding carthird partkeyactor playing multiple rolesproduct placement β¦evil manconvertiblesplit screenfilm within a filmautomobilecharacter says i love yousecret agentobscene finger gesturetwinqueengolddiscorapmovie theaterblockbustercomposerflatulencesharkknightlaseraction heroinedwarftokyo japanobesityhit in the crotchmedical examinationsibling rivalryabsent fatherexploding headparachutespyingboarding schoolcorporationpublic humiliationcloneexploding helicoptergatling gunspoof titlesatellitedesert eaglegraduationlarge penisbloopers during creditscameo appearancejapanese schoolgirlbelgiumhollywood signasteroididentical twinsroller skatingdietprison breakcrotch grabpart computer animationfather son estrangementman wearing glassesjailbreakmoledeath of parentsbroken bottlevillain arrestedshark attackbaldnessgadget cardiscothequedefectorfat suitfilm premiereenglish subtitles in originalbad smelleffeminacylong lost fatherfemale bare feetbleeped dialoguedance numberhair lossinnuendosumo wrestlerlispdisco musicgolden gundefectionreference to leonardo dicapriolong lost brotherscubalong lost sonto do listreference to julia robertssecret headquartersknighthoodreference to godzillaunion jackurine samplereference to george clooneymini cooperphysical examinationfembotletter openeramphibious vehicletractor beammoonwalk dancingbullet catchingsexual ambiguitydutchmancharacter can see subtitlestudio 54platform shoessexual overtonesprotagonist and antagonist played by same actorretro style secret agentsexy agentskin conditionsphynx catminibarscottish stereotypedutch accent (See All) |
Joe is classified as a "looper", a job in which his employers use time travel to send men from the future to be killed into the past, where Joe can properly dispose of their bodies. However, to tie up loose ends and erase the evidence of his ever being a looper, Joe knows that one day his future sel β¦f will be sent back for him to kill. When this day comes, Joe's future self is prepared and escapes, and the two men struggle separately in the past trying to evade capture and attempting to fulfill their own personal agendas. (Read More)
Subgenre: | tragedydystopiacyberpunk |
Themes: | time travelmurderdeathrevengesuicidebetrayaltorturegangstersupernatural powermafiaredemptionexecutiondeath of wifehomelessnessdrug addiction β¦self sacrifice (See All) |
Mood: | goreneo noir |
Locations: | motorcyclenightclubfarmstrip club |
Characters: | husband wife relationshipmother son relationshipboytough guyhitmansingle motherfrenchamerican abroadself mutilationyounger version of character |
Period: | future |
Story: | bloodviolenceone word titleflashbacksex scenecigarette smokingtitle spoken by characterexplosionpartychasesurprise endingpistolvoice over narrationshootoutshot to death β¦blood splattermachine guncar accidentshot in the chestface slapshotgunslow motion scenewritten by directorthongvomitingrifleheld at gunpointbombprostitutionrevolvercriminalstrippershot in the backf wordassassinbound and gaggedaxedeath of friendmontagedinermapanti heroone man armychild in perilshot in the legshot in the foreheadon the rundrug addictorganized crimecharacter repeating someone else's dialoguefugitivetentdeath of childtough girlexploding bodyobscene finger gesturedismembermentsubtitled scenesingle parentstrong female characterpickup truckcrime bossgoldfalling down stairssyringegrenadebarnhidingsevered handcovered in bloodsocial commentarymoralityretirementcamera shot of feetsevered fingerdual wieldshot in the facejunkiedeath of protagonistmurder of a childwedding ringbody landing on a carlens flaresevered legdead woman with eyes opentelekinesisteleportationshot through a windowsunsetlevitationethicsbag over headhiding in a closetdisposing of a dead bodyfarmhouseurban decayinterracial marriageinterracial kisscornfieldpocket watchcrashing through a windowcontract killerkansasdead wifehit with a hammertrapdoorwoman slaps a manimplied sexsevered foottime loopfinger gunbilingualismtear on cheekzippo lightertitle spoken by narratorstarts with narrationcityscapetantrumshowgirlchild murdererdrug withdrawalsilvernight cityscapewood choppingshanghai chinagold barsecret tunnel2040sunderground tunneltime paradoxshooting a womanhit with a doordirt roadlawlessnesssevered nosemob executiontime travellerfalling on a carfloor safemeeting future selftrip and fallmisfirewhite man asian woman relationship2070smale time travellerdouble bitted axemother murderedclimbing a fire escapesilver bar (See All) |
Engineers Aaron, Abe, Robert and Phillip are working on an invention, the prototype being built in Aaron's garage. This project is beyond their day jobs. The project truly does belong to Aaron and Abe, as they use all their free time working on it, primarily trying to overcome the many engineering r β¦elated problems they've encountered. It is during one of his tests with the invention running that Abe discovers that a protein inside the main unit has multiplied much more rapidly than it could in nature. Rather than the invention being a protein super incubator, Abe, using himself as a guinea pig, and a very meticulous one at that, discovers that the invention can be used as a time machine. In his self experiment, Abe was especially careful not to interfere with his own self in that time warp. Abe passes along this discovery to Aaron, who he expects will tell his wife Kara in what is the sanctity of their marriage, but he doesn't want to tell either Robert or Phillip. Much to Abe's surprise, Aaron does not want to tell Kara, it being a sole intellectual property of just the two of them, in the process moving the base of operation to a locked storage unit. Aaron's plan for the two of them is to use the invention to win big in the stock market by knowing through the time travel what has happened in the market. With two thoughts on the matter now instead of just one, Aaron and Abe may hit some logistical and philosophical roadblocks in how to move forward. (Read More)
Subgenre: | independent filmcult filmexperimental film |
Themes: | time travelsurrealismparanoiaguiltgreedclaustrophobia |
Locations: | swimming pool |
Characters: | ex boyfriend ex girlfriend relationshipengineer |
Story: | bloodflashbackpartysurprise endingvoice over narrationcell phoneshotgunlow budget filmscienceflashlightbasketballfootballnonlinear timelinehotel roombinoculars β¦written and directed by cast memberdirected by stargaragesyringetape recordercomainventorheadphonesrefrigeratorclonefountaintime machinediscoveryinventiondruggedphysicsexperiment gone wrongdistrustclose up of eyetime loopscrabbleidentity crisisstock marketmicrowave ovenmultiple time framesdoubleprotective maleengineeringrepeated eventbasketball courtgraduate studentparadoxcar alarmbacteriaoxygen tanktechnicianvoice recordingstorage unitear bleedingdrugged foodnitrous oxidechanging the futureget rich quick schemestorage facilityunintended consequencescar batteryfungusstock tradingcircuit boardcausalitybrainstormingearphonesolderingeverything is not what it seemssleeping on floor (See All) |
At the age of 21, Tim Lake (Domhnall Gleeson) discovers he can travel in time... The night after another unsatisfactory New Year party, Tim's father (Bill Nighy) tells his son that the men in his family have always had the ability to travel through time. Tim can't change history, but he can change w β¦hat happens and has happened in his own life-so he decides to make his world a better place...by getting a girlfriend. Sadly, that turns out not to be as easy as you might think. Moving from the Cornwall coast to London to train as a lawyer, Tim finally meets the beautiful but insecure Mary (Rachel McAdams). They fall in love, then an unfortunate time-travel incident means he's never met her at all. So they meet for the first time again-and again-but finally, after a lot of cunning time-traveling, he wins her heart. Tim then uses his power to create the perfect romantic proposal, to save his wedding from the worst best-man speeches, to save his best friend from professional disaster and to get his pregnant wife to the hospital in time for the birth of their daughter, despite a nasty traffic jam outside Abbey Road. But as his unusual life progresses, Tim finds out that his unique gift can't save him from the sorrows and ups and downs that affect all families, everywhere. There are great limits to what time travel can achieve, and it can be dangerous too. (Read More)
Subgenre: | coming of ageblack comedytime travel comedy |
Themes: | time travelfriendshipmarriagechristmaspregnancydrunkennessweddingfuneralsupernatural powercancerhope |
Mood: | bittersweet |
Locations: | hospitalbeachrestaurantlondon englandengland |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipactorpriestlawyeralcoholicuncle nephew relationshipamerican abroad β¦uncle niece relationshippregnant wifeamerican in the uk (See All) |
Period: | 2000s2010s |
Story: | flashbackkissdancingphotographpartysurprise endingvoice over narrationcell phonecar accidentslow motion scenewritten by directorbikinisecretbirthdaycar crash β¦britishf wordsubjective cameragay slurmontagesubwaytrialno opening creditscoffinbirthday partymarriage proposalcharacter repeating someone else's dialoguecharacter's point of view camera shotcourtgiftpremarital sexredheadterminal illnessloss of virginityreference to adolf hitlerheavy raineccentricnew year's evetennisart galleryviolinbarefootnicknamelove at first sighttime lapse photographyalzheimer's diseaseraised middle fingerlingerie slipmoral dilemmaunclesubway stationyoung version of characterplaywrightstage playgreenhousewoman in bra and pantiesbeach housemanuscriptcountdowntime loopexpectant motheralternate timelineexpectant fatherreference to charles dickenstable tennisamerican womanlondon undergroundlesbian slurmaternity wardpregnant bridetime travel romancetrapped in a time loopbutterfly effectreaderalternate futurereference to kate mossaltering the future (See All) |
In the future, the mutants and the humans that help them are slaughtered by powerful robots named Sentinels. Professor Xavier, Wolverine, Magneto, Storm, Kitty Pryde and her friends meet at a monastery in China and Xavier explains that the invincible Sentinels were created using the DNA of Mystique β¦that was captured in 1973 when she tried to assassinate their creator Dr. Bolivar Trask. Xavier tells that their only chance is return to 1973 using Pryde's ability to join Charles Xavier and Erik Lehnsherr to convince Mystique to give up of her intention. . However, only Wolverine can withstand the damages of the time travel. Will he succeed in stopping Mystique and the Sentinel Program and save the mutants and their human friends from annihilation? (Read More)
Subgenre: | martial artssuspensesuperheropost apocalypsedystopiavideocyberpunk |
Themes: | time travelmurderdeathrevengesurrealismprisondeceptionmilitarysupernatural powerredemptionhopeartificial intelligencefuture war |
Locations: | new york citytrainhotelsnowairplaneparis francenightclubairportelevatorkitchenwheelchairchinastormlaboratory |
Characters: | tattoosoldiertough guyaction herosecurity guardprofessorself healingcanadian abroad |
Period: | near futureyear 1973 |
Story: | bloodviolencesequelflashbackmale rear nuditybare chested malegunfightexplosionknifechasesurprise endingpistolvoice over narrationcorpse β¦blood splatterfistfightmachine gunrescueslow motion scenepunched in the facebattlebrawlbare buttfalling from heightheld at gunpointhand to hand combatbombrobothallucinationrevolvercombatscientistsubjective cameradecapitationsurvivalfoot chasebased on comic bookstrangulationmassacremountaindisguisemansionimpalementstabbed to deathmixed martial artsstabbed in the chestsubwayexploding carfalse accusationsevered headno opening creditsanti heroassassinationfictional wardouble crossunderwater scenefemme fatalenews reportshot in the legdrowningtransformationattempted murderdrug addictstabbed in the backperson on firecharacter's point of view camera shotmissionproduct placementrace against timekicked in the facetough girllightningu.s. presidentskeletonspeechamerican flaginjectionpresidentexploding bodyneck breakingsevered armgeneralnewspaper headlinesubtitled scenewashington d.c.strong female characterchessexperimenticecaptainsabotageburned aliveflyingspearhypodermic needlehelmetmutanttemplekicked in the stomachvillainessblockbustervietnam warimpersonationskullmind controlaction heroinewhite housecolonelsocial commentaryinventorimpostor3 dimensionalplanesenatorscene after end creditsmarvel comicsjumping through a windowsuperheroinehologramstadiumfifth partburned to deathtelekinesisgatling gunprequelteleportationlaser gunsurprise after end creditsmedia coveragetelepathybullet timemoscow russiagiant robotlevitationsecret servicemonasteryshot in the neckeiffel tower parissuper strengthportalmajorcomic reliefyoung version of characterbunkerbased on graphic novelchandeliersuperhero teamwoman kills a mancapemicroscopeprison breakshot in the throatmetal detectorcureshape shifterclawimmortalshapeshiftingjailbreakwrongful imprisonmentprivate jetmind readingclose up of eyearmy baseexploding airplanepentagonassassination plotscience runs amokslow motion action scenedeoxyribonucleic acidkiller robotmegacorporationvietnamesesecret doorsecret service agentsuper speeddiscothequex menhidden doordark futurewoman hits a manshipping containerwashington monumenttransforming robotaltering historyhand gunrichard nixontime freezeinside the mindlava lamprobot as menaceweather manipulationshape shiftingtime paradoxsummitreference to pink floydblue skinfuturistic aircraftprequel and sequelclaw fightpeace treatyjet aircraftmeeting future selfexperimentationwolverine the characterretconsentinelsaigon vietnamasian with coloured hairplastic gunstorm the charactercyclops the charactermutant womanyear 2023 (See All) |
Palaeontologist Rick Marshall takes Will and Holly into a new world of danger, dinosaurs and big bug-eyed lizard people while trying to find their way back home and, too, save the universe and in doing so saving his reputation. With the dinosaur with brains, brawn and personality and the adventure o β¦f scientific advancement and exotic beasts in a far away land, it all adds up to time traveling fun and frolics. (Read More)
Themes: | time travelfriendshipdeceptionrivalrydevil |
Locations: | swimming poolairplanedesertmotelcavejungle |
Period: | 2000s |
Story: | bloodbare chested maletitle spoken by charactersingingchaseface slapremakerunningriverscientistvideo camerabridgearmyprisonerno opening credits β¦breast fondlinglimousinebased on tv seriesskeletonscene during end creditspursuitexploding bodywaterfallsevered armfireworksprincerecord playerburned aliveearthquakeeaten alivepunched in the stomachinsectkicked in the crotchswampastronautvolcanohologramtitle at the endtrailermannequinlighterportalworld dominationlizardmegalomaniacraftcameo appearanceurinecrystalhollywood signpipetour guidecrabtyrannosaurus rexbeltgropingflying saucergolden gate bridgealternate dimensionimplied nuditytitle appears in songtoilet humorclothes rippingbanjogiant insecttime warpcatapulthit with a rocktheme songbattering rammotivationalternate worldboat ridetouching breastspterodactylliquid nitrogenracist remarkpaleontologistclosing credits sequencesinkholevelociraptorforest rangerdinosaur eggice cream manprimatetunicfreezing to deathblood suckingminiaturerock throwingswallowed wholeovereatingdinosaur attackwalnuteating insectgiant crabroadside attractionviking shipice cream vanmissing linkallosaurushuman versus dinosaurpole vaultinsect bitetachyondead skinshow tune (See All) |
After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.
Subgenre: | fish out of water |
Themes: | time travelfriendshipsurrealismmagiccouragefirst lovemissing child |
Mood: | breaking the fourth wall |
Locations: | beachforestmotorcyclecemeterysmall townjungleabandoned factorybicycle chase |
Characters: | family relationshipsfather son relationshipmother son relationshipmother daughter relationshipbrother sister relationshippolice officerbullypsychiatrist |
Period: | 1990s1960s19th century20th centurychristmas party1860syear 1969 |
Story: | one word titletitle spoken by charactersurprise endingcar accidentshotgunarrestrifleheld at gunpointhandcuffsrevolverriverorphanaxemansionbridge β¦apologyno opening creditschild in perilhit by a carunderwater sceneconfessionlibraryprologuefactoryactor playing multiple rolesconvertiblesubtitled scenemonkeyfireplaceheavy rainlifting someone into the airelephanthunteroverallsblockbustercgianimal attackearthquakepresumed deadrampagefloodstealing a carconstruction sitechaostime lapse photographylionatticrefrigeratormutationbullet timebatimpersonating a police officerhiding in a closetcrocodiletween girlshoefriends who live togetherboard gamefather son reunionmotorcycle coprecluseimprovised weaponbased on children's bookanimal killingloss of parentsrainforestlootinggiant spiderhuman becoming an animalrhinocerossanta claus suitauto theftmosquitogiant insectchestzebraexterminatorvortexnew hampshirequicksandstampedegun storetailconveyor beltaltering historypelicaninvestment bankertrailer narrated by hal douglasmonsoonsporting goods storepoison ivybig game hunterinsect attackcarnivorous plantyear 1869dybbuk boxcar through wallanimal driving a cartrailer narrated by nick tate (See All) |
Russ Duritz ('Bruce Willis' (qv)) is a wealthy L.A. image consultant, but as he nears 40, he's cynical, dogless, chickless, estranged from his father ('Daniel von Bargen' (qv)), and he has no memories of his childhood. One night he surprises an intruder ('Spencer Breslin' (qv)), who turns out to be β¦a kid, almost 8 years old. There's something oddly familiar about the chubby lad, whose name is Rusty. The boy's identity sparks a journey into Russ's past that the two of them take - to find the key moment that has defined who Russ is. Two long-suffering women look on with disbelief: Russ's secretary, Janet('Lily Tomlin' (qv)), and his assistant, the lovely Amy, to whom Rusty takes a shine. What, and who, is at the end of this journey? (Read More)
Subgenre: | melodrama |
Themes: | time travelweddingredemptionchildhood |
Locations: | los angeles californiaairport |
Characters: | father son relationshipbullylittle boyself improvement |
Period: | 1960s2000s |
Story: | dogfightfistfighturinationdinerboxingmarriage proposaltrainingpilotscartherapistvideotapewilhelm screamwedding receptioncartoon on tv β¦bully comeuppancebachelorhollywood signboxing matchporschefather son estrangementbiplanecomeuppanceboxing glovesbirthmarkmodel airplanesparringindifferencecrisis of consciencealtering historycynicoverweight childhot dog vendorschoolyard fightlife lessonanchorwomanthree legged dogtwitchinner childboxing lessonimage consultantolder version of selfyounger version of self (See All) |
As a group of friends discover plans for a time machine, they build it and use it to fix their problems and for personal gain. But as their future falls apart with disasters, and they come to realize the irreversible ripple effects caused by their time travels, they must decide to fix this once and β¦for all. (Read More)
Subgenre: | found footageteen movie |
Themes: | time travellovefriendshiprevengesurrealismbetrayalfeardeceptionrobberyparanoiaredemptionnear death experience |
Mood: | high school |
Locations: | hospitalforesthelicopterwoodslaboratory |
Characters: | policemother son relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbullysingle motherpolice chase |
Period: | 2000s2010syear 2004year 2014 |
Story: | dogtwo word titlebare chested maletitle spoken by characterpartysurprise endingfirecell phonerescuecamerakissingletterrunningsubjective camerafoot chase β¦concertbasketballmontagewidowno opening creditsbirthday partynews reportkeyproduct placementrace against timegymdisappearancehigh school studentcheerleaderlaptoppremarital sexfireworkslove interestnewspaper headlinesingle parentpizzateen angstbreaking and enteringwristwatchyoutubeinterracial friendshippower outageconvenience storeatticstadiumnewspaper clippingteleportationreference to barack obamalevitationhigh school teacherreference to facebooklotterytime machinebully comeuppanceplane crashno title at beginningatlanta georgiatop secrethome videocamcordervideo footagereference to twitterreference to star warstime loopalternate timelinebatteryvortexstopwatchgooglewoodstockelectromagnetic pulsesecret laboratoryaltering historywater slidewoman wearing a toweltime paradoxsecret compartmentchanging the futurecar showroomhydrogenaudio begins before videobutterfly effectbolt cutterchanging the pastbucket listbackstage passreference to ryan seacrestchanging historyreference to doctor whoengineering diagram (See All) |
During an unfortunate series of events a friend of Kung Fury is assassinated by the most dangerous kung fu master criminal of all time; Adolf Hitler, a.k.a Kung Fuhrer. Kung Fury decides to travel back in time, to Nazi Germany, in order to kill Hitler and end the Nazi empire once and for all.
Subgenre: | martial artshorror spoofsci fi spoof |
Themes: | time travelnorse mythologynazi exploitation |
Mood: | parody |
Locations: | helicopterpolice stationpolice carcityusanazi germany |
Characters: | policesoldiernazi soldier |
Period: | 1980s1940syear 1985 |
Story: | bare chested maleexplosiontelephone callcell phonearcade gamecomputerswordrobotkung fudecapitationaxemassacreman with glassesone man armywritten and directed by cast member β¦tankexploding bodysevered armeuropedismembermentuzicoptalking animalfloridaskateboardlaserpart animationgas maskanimated sequenceresurrectionmiami floridapolice officer shotsports cargatling guntorso cut in halfkatanahackerhomagekung fu mastersuper strengthtime machinehitlerpolice chiefvikingcheering crowdbuddy copcomputer hackerscandinaviavhseaglesubmachine guntyrannosaurus rexfirst person narrationhuman experimentshot in the crotchchosen onesome scenes animatedboom boxwormholefemale bodybuilderheadbandstruck by lightningpunched in the crotchtime travelertriceratopsdeitybackwards time travelwoman with a gunhead cut in halfnazi flagquitting jobminiguncut in halfparking meterreference to pubic hairvelociraptordelorean dmc 12glitchghetto blasterwearing sunglasses at nightraptorintentionally badpodiumto be continued endingwoman warriorscenic beautyvideo game parodyhitler spooffake adnaziploitationlamborghini countachhorned helmetcommercial parodykung fu spoofsplitsviking helmethandheld minigunrenegade coprobotic animal900spower glovered lamborghinitanker truck explosion (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
Subgenre: | martial artssword and sorceryswashbucklersword and fantasy |
Themes: | time travelmurdermarriagebetrayalescapeherodeath of father |
Locations: | snowdesert |
Characters: | soldiertough guywarrioraction hero |
Story: | violenceflashbackkisstitle spoken by characterexplosionchasehorsebattleswordshowdownhand to hand combatcombatkung fugood versus evilfoot chase β¦orphanassassinsword fightambushaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armyfictional warkingprincesson the runone against manyfugitivebrotherprincestylized violencestrong female characterdestinybow and arrowcountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandcrossbowseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomsword duelblack magicdaggerframed for murderunclepalaceswordsmanparkourfortresssorcereradopted sonmacguffinrobesword fightingsword and sandaltitle in titleempirecorrupt officialsubterraneanshot with a bow and arrowarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All) |
This is the story an amusement park employee named Jamal Walker who is magically transported back to medieval times in 14th-century England. There, Jamal meets Sir Knolte, a dissolute knight, before he stumbles into the court of the usurper King Leo. Jamal is impressed by what he thinks is the reali β¦sm of the theme park; only after witnessing a gory beheading does he realize, with horror, where he really is. Jamal encounters the beautiful Victoria who is scheming to return the queen to the throne, and falls afoul of the evil Sir Percival. Joining forces with Sir Knolte and Victoria, Jamal teaches the rebels some helpful football, golfing, and boxing moves, before he dons the armor of the awesome "Black Knight"! (Read More)
Subgenre: | martial artsfish out of wateralternate history |
Themes: | time travellovemagicseduction |
Locations: | villagewoodscastle |
Characters: | african americanbully |
Period: | 2000s |
Story: | sexkissinterracial sexsurprise endingbattleswordsex in bedhand to hand combatcolor in titlecombatdecapitationsword fightaxefictional warking β¦princesskissing while having sexchessbow and arrowspearflatulencerebellionknightshieldmedieval timesdungeonsiegesword dueldictatorpeasantbully comeuppancefast foodtyrantmartial arts traininganachronismshot with a bow and arrowcomeuppanceaxe fightbattle axeflaming arrowcomic heroaltering history14th centuryend of warheimlich maneuver1300speasant revoltpeasant army (See All) |
Following the events in "Beneath the Planet of the Apes", Cornelius and Zira flee back through time to 20th Century Los Angeles, where they face fear and persecution similar to what Taylor and Brent suffered in the future, and discover the origins of the stream of events that will shape their world.
Subgenre: | dystopiaalternate history |
Themes: | time travelmurderfriendshippregnancyfeardrunkennessescapeinvestigationnuclear holocaustpost nuclear |
Locations: | hotellos angeles californiaouter spacemuseum |
Characters: | husband wife relationshipsoldierpsychiatristpregnantpregnant wifedrinking while pregnant |
Period: | futureyear 1973 |
Story: | sequelflashbackcigarette smokingpartysurprise endingshot to deathfalling from heightplace name in titleanimal in titlescientistwinecaliforniastrangulationspaceshipthird part β¦on the runbinocularschampagneu.s. presidentpresidenttragic eventciacircustv newskilling an animalreference to adolf hitlercagetape recorderfaintinghelmetrecordingspacecraftaccidental deathpress conferencebirthend of the worldzooshoppingamerican presidentastronautbananabelief in godrefrigeratorgiving birthwomen's rightsfirearmgorillatape recordingbubble bathmilitary basexenophobiachimpanzeenewscastnuclear warapeintellectualexpectant motherpacific oceaninfantarchaeologistexpectant fathermob of reportersorderlycrawlinghearingtempershipyardpacifismabandoned shipteasealtering historybreedingagencyplanet in titlesimian fictioncigarette caseadvisortruth serumsketch artistzoologistd box motion codeoil tankershopping spreeorange the fruitape mancravingbaby switchkilled by an animalplanet of the apesreel to reel tape recorderrecording devicescience lessonmocking laughterpresidential advisor (See All) |
1000 feet below the ocean, navy divers discover an object half-a-mile long. A crack team of scientists are deployed to the site in Deepsea Habitats. What they find boggles the mind as they discover a perfect metal sphere. What is the secret behind the sphere? Will they survive the mysterious 'manife β¦stations'? Who or what is creating these? They may never live to find out. (Read More)
Subgenre: | suspensepsychological drama |
Themes: | time travelmurderdeathsurrealismfearsupernatural powerparanoiainsanitysurveillance |
Mood: | gore |
Locations: | helicopterkitchenshipouter spacespaceoceanlaboratorysubmarineu boatsea monster |
Characters: | alienterrorbabe scientistbiologist |
Period: | 1980s |
Story: | based on novelbloodone word titleflashbacktitle spoken by characterexplosionsurprise endingshowerfiredreammirrorsecretbookbathroomhallucination β¦scientistflashlightspaceshipdrowningattempted murderpilotelectrocutionskeletonuforevelationhypodermic needleeggsecurity camerapsychologypsychologistanimal attackfloodimaginationexplosiveautopsyhologramraised middle fingerbrushing teethburned to deathtorso cut in halftranslatorsuffocationfire extinguishertimebombcomputer crackermathematicsu.s. navycodechapter headingsexploding shipburn victimtime loopdivermicrowave ovenjellyfishblack holesquidmathematicianeeltroubled productionsphereunderwater photographypactdiving suitheimlich maneuvercoralnightmare becomes realitycyclonemarine biologistmanifestationheliumastrophysicistendless loopoperating tablebottom of the oceanreference to deepak chopradecompression chamberchapterwise storytellingunderwater base (See All) |
In the year 2058, the Earth will soon be uninhabitable after the irreversible effects of pollution and global warming! Professor John Robinson, lead scientist of the Jupiter 2 Mission, will lead his family to the habitable planet Alpha Prime to prep it for colonization. The Jupiter 2 is equipped wit β¦h a hyperdrive that allows faster-than-light travel, which will eventually be employed to evacuate the citizens of Earth. However hypergates must be constructed on Earth and Alpha Prime to provide stable points of departure and arrival. Dr. Zachary Smith is bribed by a terrorist organization to sabotage the mission, and ends up an unwilling stowaway as the ship blasts off. (Read More)
Themes: | time travelbetrayalterrorismdysfunctional familyspace travel |
Locations: | desertouter spacespace battle |
Characters: | family relationshipsfather son relationshipboyvillainbabe scientistfemale scientist |
Period: | future |
Story: | kissexplosionthree word titleheld at gunpointrobotscientistspaceshipbased on tv seriesfireworksflirtingsabotageteen angstspacecraftplanetreverse footage β¦insectsunhologrammutationlaser guntime machinemajorfighter pilotstarshipalien creaturespacesuitx rayed skeletonspace explorationcryogenicshuman versus alienzero gravitytrapped in spacehuman in outer spacealien attackexploding planettime portalhyperspace2050sstasisstasis podalien creature as petexploding starshipstarship interior (See All) |
Anton belongs to the Forces of the Light as do his powerful girlfriend and apprentice, but his son is a powerful teenager from the Darkness and Anton protects him. When the balance between Light and Darkness is affected by the death of some evil vampires, Anton is framed and accused of the murders, β¦and he chases an ancient chalk that has the power of changing the destiny of its owner. (Read More)
Subgenre: | cult filmdark fantasy |
Themes: | time travelmurderdeathlesbianismdrunkennesssupernatural powerredemptionapocalypseregret |
Mood: | nightdarkness |
Locations: | russia |
Characters: | father son relationshipvampirewitchrussian |
Story: | based on novelbloodviolencesequelflashbacktwo word titlefemale rear nudityfightlesbian kisssurprise endingcell phoneshot to deathblood splattershot in the head β¦slow motion scenewritten by directorbattlefalling from heightsecond partcar crashdecapitationgood versus evilflashlightsword fightdeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationsevered headbirthday partypantyhosestabbed in the backpoisonpossessiondarkfemale stockinged legsdestructionhead buttwitchcraftsevered fingerstabbed in the throatblack and white sceneevidencedeath of loved oneparrotlightfemale in showerframed for murdermoscow russiamarketbugsecret societyburnt facesorcerysuntan pantyhosesevered footbody swapbody painttrolleymosquitohit by a busclairvoyanceyo yodog collarchalksoul transferencestrawbreaking through a walltruceflip bookfemale pantyhosed buttocksflieschanging historynight watch (See All) |
When a magic scepter accidentally transports April back through time to 17th Century Japan, the boys take-off in hot pursuit, cowabungling their way out of the sewers right into Samurai-O-Rama! Now they must battle the evil Lord Norinaga to reclaim the magic scepter that will bring them back below t β¦he subways of New York City. (Read More)
Subgenre: | independent filmmartial artscult filmsuperhero |
Themes: | time travelsurrealismheromagicsamurai |
Mood: | poetic justice |
Locations: | japansewer |
Characters: | teenagertough guywarrioraction herosamurai sword |
Period: | 1900s1600s |
Story: | violencesequelfightexplosionchasefirefistfighthorsebattlebrawlhand to hand combatfightingcombatkung fusword fight β¦based on comic bookambushdisarming someonefictional warvoice overthird partfive word titleninjatough girlopening action scenemartial artistmercenaryvigilantearsonbattlefieldpizzamartial arts masterbow and arrowspearelectronic music scoreheroineslow motiontalking animallifting someone into the airroman numeral in titlepart of trilogyaction heroinechop sockycannonkatana sworddual wieldanthropomorphic animalturtlearmorsword duelsequel to cult favoritestick fightkung fu fightingkung fu classicfemale fighterninjitsuvigilante justiceunsubtitled foreign languagemusketroman numbered sequelwarlordbo staffcavalryliquidanimal that acts humanshot with a bow and arrowflintlock riflehorse chaseflintlock pistolnunchuckslifting male in airreference to clint eastwoodfurryhockey stickteenage mutant ninja turtlesfeudal japanmusketeersaininja turtlemirage comicslampshade (See All) |
Eight strangers find themselves waking up in a strange cube-shaped room with no recollection of how they came to be there. Soon discovering that they're in a strange fourth dimension where our laws of physics don't apply, they have to unravel the secrets of the "hypercube" in order to survive...
Themes: | time travelmurderdeathlovesurrealismkidnappingcannibalismstarvation |
Characters: | detectiveengineer |
Story: | sexfemale nuditynumber in titlesequelknifesurprise endingcorpseshot in the headslow motion scenesunglassesnumbered sequeldecapitationbound and gaggedmontagestabbed to death β¦colon in titlesuicide attemptstabbed in the chestold womannecklacedangerstabbed in the backmissing persontragic eventsplit screenneck breakingthreatened with a knifesevered armred dressstabbed in the stomachwristwatchtimestrangercrushed to deathbarefootattorneycannibalblood on shirtalternate realitystabbed in the eyeroomdead woman with eyes opensequel to cult favoriteblindimprisonmenthackermazemathematicswatchlawsuitblind womanhanged manalter egooverhead camera shotparallel universecut into pieceslocked in a roomclose up of eyedying during sexhead ripped offwoman's neck brokenblind girlmathgravitymathematiciancount downsequel with unusual numbersummary executiontrapped in a roomwhite roomcut to piecesreference to mother theresasecret recordingsenilerecording devicereference to muammar gaddafizero gravity sexmathematical geniusintroducing selfmurder of an old womantesseractwriting on skintime dilation (See All) |
Jesse begins experiencing a number of disturbing and unexplainable things after the death of his neighbor. As he investigates, it isn't long before Jesse finds he's been marked for possession by a malevolent demonic entity, and it's only a matter of time before he is completely under its control...
Subgenre: | supernaturalfound footage |
Themes: | time travelmurdersuicidekidnappingdrunkenness |
Locations: | apartmentfarm |
Characters: | teenagerbrother sister relationshipbest friendlatinowitchgrandmother grandson relationship |
Period: | year 2012 |
Story: | bloodfemale frontal nuditydogfemale rear nudityphotographsingingpartycorpseshot to deathmachine gunshot in the chestshotgunwritten by directorfalling from heightcar crash β¦neighbordemonf wordsubjective camerabragangstrangulationvideo camerabasketballdeath of friendstabbed to deathstabbed in the chestsevered headno opening creditsritualcharacter repeating someone else's dialogueknocked outprankdeath of brotherbasementoccultfalling down stairspot smokinggamebreaking and enteringeggfriendship between menspin offwitchcraftgrocery storeunderage drinkingfalling to deathbody landing on a carlooking at self in mirrorlens flaredemonic possessionhit with a baseball batmexican americanlevitationbonghiding in a closetportalyoung version of characterno title at beginning18 year oldunsubtitled foreign languagevhsaltered version of studio logohome videodeath of grandmothersuperhuman strengthtrapdoorgang memberpentagramfirecrackerattempted robberyloss of controlhigh school graduationwriting in bloodshaky cambitten on the armreference to sherlock holmesmissing person postercovenapartment complexoxnard california (See All) |
The world of our distant future is a veritable utopia, thanks to the lyrics of two simple-minded 20th Century rock and rollers, Bill S. Preston, Esq. and Ted "Theodore" Logan. However, a would-be conquerer threatens to throw history off-track by sending "most non-non-heinous" evil robot Bill and Ted β¦s back to kill their good counterparts. Finding themselves dead, the boys must outwit the Grim Reaper and traverse Heaven and Hell to return to the land of the living, rescue their "babes" and have a "most triumphant" concert at the all-important Battle of the Bands. (Read More)
Subgenre: | independent filmcult filmteen movieteen comedyalternate history |
Themes: | time traveldeathsupernatural powerdevilafterlifethe devil |
Characters: | reference to god |
Story: | character name in titlesequelsecond partrock musicrobottelephonegay sluractor playing multiple rolespossessionback from the deadandroidreference to satanheavensequel to cult favorite β¦historical fictiontelephone boothseancewagerdisembodied headboard gamehappy birthday to yougrim reaperlucifermartiantelephone boxaltering historyeaster bunnydepiction of godbattle of the bandscharacter appears in newspapertwister the gamewedgiecharacter appears on magazine cover27th centurybill and tedreference to clue or cluedo (See All) |
Miser Ebenezer Scrooge is awakened on Christmas Eve by spirits who reveal to him his own miserable existence, what opportunities he wasted in his youth, his current cruelties, and the dire fate that awaits him if he does not change his ways. Scrooge is faced with his own story of growing bitterness β¦and meanness, and must decide what his own future will hold: death or redemption. (Read More)
Subgenre: | cgi animationghost story3d animation |
Themes: | time traveldeathchristmasghostpovertyredemptionregretchristmas past |
Mood: | nightbreaking the fourth wall |
Locations: | snowlondon englandengland |
Characters: | reference to godemployer employee relationshipuncle nephew relationshipseeing a ghostghost from the past |
Period: | 19th century |
Story: | based on novelchasethree word titlecryingremakefalling from heighttearsdead bodycoffinactor playing multiple rolesskeletonmoonflying3 dimensionalchristmas eve β¦3dshadowhorse and carriagehappy endingvictorian eraapparitionundertakerholiday in titlecripplefrightnight timechainsholiday seasonlifting person in airrich manhooded figurechange of heartchristmas daycharles dickensbreaking the fourth wall by talking to the audiencebackwards time travelmotion capturesee you in hellmiserscroogeminiatureopen gravetalking to a ghostchristmas morningmoon shotdoor knockervisitationalternate futurestorybook in opening shotghostly visitationfull bodied apparitionbah humbugcharacter says god bless us everyone (See All) |
Hector is an ordinary man who's moving to a new house with his wife. One evening, while he's looking through his binoculars, he sees a naked girl in the woods. He decides to go there just to find that same girl laying on a rock. Suddenly, a man with a pink bandage covering his face, stabs Hector in β¦his arm with scissors... (Read More)
Themes: | time travelsurrealismtravel |
Locations: | carbicyclewoodstrucklaboratory |
Characters: | husband wife relationship |
Story: | female nuditybloodflashbacktwo word titlepantiescar accidentvoyeurtelephonescientistflashlightnonlinear timelinewhite pantiesradiobinocularsdirectorial debut β¦answering machinefalling down stairsinjurywalkie talkieladderpeeping tomhaircutseriesgrocery storeplot twistscissorsfat manaccidental killingone daydead girlgateforced to striprunning awaytime machinefencemachinestabbed in the armjacketmoving inroofhitchcockiancrowbargarbage cantime loopstabbed with scissorsmultiple time framesfalling off a roofbloody facebatterypokiestime travelerlooploud musicradio programproblem solvinganonymous telephone callback in timebandaged headfacial injurybandaged facecoffee machinecar crashing into a treeduplicatebootstrap paradoxdirector's debuthair cuttingmultiple selvesshoulder rubcar crashes into a tree (See All) |
Three friends discover a time machine which takes pictures of the future. They begin to use it to win race bets and everything goes fine till one gets greedier than another. They begin to lose faith in each other giving a sense of backstabbing as uglier truths unfold in the photos and the situation β¦soon gets out of control. (Read More)
Subgenre: | independent film |
Themes: | time travelmurderdrugsjealousyvoyeurismblackmailgambling |
Locations: | apartment |
Characters: | african americanboyfriend girlfriend relationshippolicemanartistlove trianglebest friendsecurity guardcheating girlfriend |
Story: | two word titlekissphotographpartypistolcell phonecorpseshot to deathblood splattercameraarrestpaintingheld at gunpointdead bodyneighbor β¦bound and gaggedold manstabbed to deathpainterbaseball batdiarythreatsilencerhatred dresshammerclockpillsblood on facedeath threatplot twistengagement ringintimidationgamblertime machinejournalgolf clubtime in titlemachineblood stainpocket watchdeath of boyfriendwoman shotposinghit with a hammerpolaroid camerawoman with gunzippo lighterfedoramoney falling through the aircrystal ballhit with a golf clubpaintbrushpolaroid photographwoman wearing a red dressenvelope full of moneyapartment complextime paradoxcell phone cameradog raceburnt corpsebootstrap paradoxface spattered with blood (See All) |
A medieval nobleman and his squire are accidentally transported to contemporary times by a senile sorcerer. He enlists the aid of his descendent to try to find a way to return home, all the while trying to cope with the cultural and technological changes distinguishing his time from ours.
Subgenre: | cult filmfish out of waterdeadpan comedytime travel comedy |
Themes: | time travelmurderdeathmarriagetravel |
Mood: | satire |
Locations: | hotelfrancecastle |
Characters: | family relationshipswitchfiance fiancee relationship |
Period: | 1990sfutureyear 1993 |
Story: | swordvomitingexploding carmistaken identityringhorse ridingfarcequestassaultservantknighthonordentistbuddymedieval times β¦local blockbusterdruggedpostmanmiddle agesvisitorsorceressnoblemannobilitycountesssecret passagewaydutyhidden doorchateaumagical potionluxury hotelhidden treasureetiquettestealing foodtime paradoxsame actor playing two characters simultaneously on screen12th centuryfuture time travelderanged womanamnesiacmace the weaponchivalry11th centuryhygienenobledestroying a carmanservantchanging the pastsquirecar smashingcoat of armssocial misfitbetrothalreturn to the pastsubserviencesootperfume bottlehidden chamberserf (See All) |
When Jacob discovers clues to a mystery that spans different worlds and times, he finds a magical place known as Miss Peregrine's Home for Peculiar Children. But the mystery and danger deepen as he gets to know the residents and learns about their special powers... and their powerful enemies. Ultima β¦tely, Jacob discovers that only his own special "peculiarity" can save his new friends. (Read More)
Subgenre: | dark fantasy |
Themes: | time travelmonster |
Locations: | snowshipghost train |
Characters: | family relationshipschildren |
Period: | year 1943year 2016 |
Story: | f ratedcharacter name in titlebased on novelfirebombbirdunderwater scenejourneytransformationtreesix word titlecircusexperimentidentitygothic β¦cagefloridapsychologistgas maskcameoshoesgrandfatheramusement parkmutationpipe smokinginvisibilityeyefake identityshipwreckmetamorphosispipewalessuper powertitle same as bookfather son estrangementsuperhuman strengthtime loopdeath of grandfatherbird cageidentity theftsnowballinvisible manbased on young adult novelstopwatchbackwards time travelbird watchingmultiple identitiesbutterfly effectinvisible monsterwhite eyesbad parentsharbor townsmoking a pipefloating in the aireating eyesupernatural childwoman smoking a pipe (See All) |
A 12-year-old boy goes missing in 1978, only to reappear once more in 1986. In the eight years that have passed, he hasn't aged. It is no coincidence that at the time he "comes back", a flying saucer is found, entangled in power lines.
Subgenre: | music video |
Themes: | time travelartificial intelligencemissing childalien abduction |
Locations: | hospitalboatbicyclepolice stationpolice carouter spaceoceanwater pistol |
Characters: | family relationshipsdoctorbrother brother relationshipboyalienparent child relationship |
Period: | 1980s1970syear 1986year 1978 |
Story: | dogmirrorurinationrobotfour word titlespaceshipunderwater sceneproduct placementmissing personcharacter says i love youfireworksufolifting someone into the airagingflorida β¦presumed deadtokyo japantelescopebackpackpet dognasahappy ending12 year oldname callingboy with glassesbaseball captrain tracksstation wagontwo way mirrorfourth of julyflying saucergolden gate bridgetwo brothersalien creaturepre teenearth viewed from spacefrisbeeconvoyvinehospital gownsparklerfirst crushindependence daybrain scanreference to coca colareference to jimmy carterpurple hairolder brotherravinefuture time travelsouth floridaspeed of lightfort lauderdale floridaalien creature as petreunited with familyreference to the bee geesextraterrestrial robottubesocksreference to twisted sisterbratty childlost years (See All) |
A young boy's wardrobe contains a time hole. Through this hole an assortment of short people (i.e. dwarfs) come while escaping from their master, the supreme being. They take Kevin with them on their adventures through time from Napoleonic times to the Middle Ages to the early 1900s, to the time of β¦Legends and the Fortress of Ultimate Darkness where they confront Evil. (Read More)
Subgenre: | independent filmcult filmblack comedysword and sorcerysteampunk |
Themes: | time travelsurrealismmagictheftevil |
Mood: | satire |
Locations: | desertlondon england |
Characters: | reference to god |
Story: | surprise endinghallucinationgood versus evilmapchild abusekingcowboyfugitivemissiontankcult directorcagequestlifting someone into the airtreasure β¦giantadventurerdwarfburglarypsychotronicbooby trapfirefighterbanditfortressschoolboytreasure huntbritish renaissancepolaroid camerapsychotronic filmalternate dimensionloss of parentsabsurdmicrowave ovenancient greecetitanicogrepuppet showship wrecklifting an adult into the airnapoleonic warscaught in a netminotaurfishing netnapoleontogatroupeevil geniusbad parentsinvisible barrier (See All) |
Time travel, still images, a past, present and future and the aftermath of World War III. The tale of a man, a slave, sent back and forth, in and out of time, to find a solution to the world's fate. To replenish its decreasing stocks of food, medicine and energies, and in doing so, resulting in a pe β¦rpetual memory of a lone female, life, death and past events that are recreated on an airports jetee. (Read More)
Subgenre: | experimental filmpost apocalypse |
Themes: | time traveldeathsurrealismmemorychildhoodamnesia |
Mood: | avant gardeapocalyptic |
Locations: | forestairplaneparis franceairportfrancemuseum |
Characters: | boy |
Period: | futurenear future |
Story: | photographvoice over narrationnonlinear timelinefictional warcult directorexperimentno dialoguelosshaunted by the pastchildhood memorywhalepost warnuclear warhuman experimentslide show β¦title spoken by narratorhuman experimentationworld war threetime travelerfrench new wavephoto montagehuman guinea pigfuture shocktime travellerfrench science fictionnouvelle vaguebeating heartunsynchronized soundphoto filmstillsorly airport paris (See All) |
A 43-year-old mother and housewife who's facing divorce is thrust back in time when she attends her high-school reunion. Given the chance to change the course of her life, she finds herself making many of the same choices.
Subgenre: | alternate historytime travel comedy |
Themes: | time travellovedivorcedysfunctional familypoetrynear death experience |
Mood: | high schoolaffection |
Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlfemale protagonistex husband ex wife relationshipself discovery |
Period: | 1960s |
Story: | character name in titletitle spoken by characterwatching tvpantyhoseautomobiledatereunioncharacter says i love youheart attacknerdteen angstfatebikergirl with glassesbreakup β¦nostalgiainventormarital probleminventionreference to the beatlesamericanamusic boxtime looptitle appears in songalternate timelinerepeated eventhigh school reunionwoman smoking cigarettereference to ernest hemingwayclass reunionlodgelife changingreference to napoleon bonapartereference to neil armstrongtime travel romancetheory of relativityrebellious teenagerdo overpoetry quotationmasonic lodgereference to william butler yeatsreference to yeats18 year old girlappliance storefilmed in mirrorreference to the great gatsbyedselrunning tracksecret ritual (See All) |
A retelling of the classic Dickens tale of Ebenezer Scrooge, miser extraordinaire. He is held accountable for his dastardly ways during night-time visitations by the Ghosts of Christmas Past, Present, and future.
Subgenre: | cult filmghost story |
Themes: | time travellovechristmasghostmemorylonelinessredemptiongreedchildhooddisabilityregret |
Mood: | one night |
Locations: | snowlondon englandengland |
Characters: | little boyemployer employee relationship |
Period: | 19th century1840s |
Story: | based on novelsequelvoice over narrationsongbedroomfour word titlejourneytalking to the camerapuppetholidaycompassionbosslove at first sightmentorchristmas eve β¦snowinghappy endingvictorian eralost lovebitternessholiday in titlesecond chanceenglishmanthe muppetsholiday seasontop hatchristmas movieturkey the birdchristmas seasonhostilitylessonchange of heartheadstonevisiting a gravecharles dickensbreaking the fourth wall by talking to the audiencerich snobbackwards time travelgratitudemisermuppetscroogemixed marriagetalking to a ghostchristmas morningdoor knockerboss from hellghostly visitationfull bodied apparitionscene at a windowbah humbugtalking fruitwhy are we whispering (See All) |
After his impetuous musician girlfriend, Samantha, dies in an accident shortly after they had a fight (and nearly broke up), a grief-stricken British businessman, Ian Wyndham, living in London gets a chance to relive the day all over again, in the hope of changing the events that led up to her getti β¦ng killed. (Read More)
Themes: | time travelbreak up |
Mood: | raintearjerker |
Locations: | hospitalrestauranttrainlondon englandtaxikitchentaxi driver |
Characters: | boyfriend girlfriend relationshipteacherstudentwaitressamerican abroaddeath of girlfriend |
Story: | bloodbare chested malesingingsurprise endingbeerlingeriecar crashguitarconcerthairy chestpubnipples visible through clothingheavy rainloss of loved onewristwatch β¦poolclassical musicviolinmale underwearboxer shortsblood on faceholding handsviolinistfemale teachertrue lovepremonitionferris wheeldeath of boyfriendawkward situationmusic teacherdeja vumultiple outcomestaxi rideloss of girlfriendpersonal growthconcert halldying womanfemale musicianlondon eyefast motion sequence (See All) |
Alice returns to the magical world of Underland, only to find the Hatter in a horrible state. With the help of her friends, Alice must travel through time to save the Mad Hatter and Underland's fate from the evil clutches of the Red Queen and a clock like creature, known as Time.
Subgenre: | fairy taledark fantasy |
Themes: | time travelsurrealismrivalry |
Locations: | seashipcastle |
Characters: | female protagonistsister sister relationship |
Story: | character name in titlesequeldogfiremirrorcatfalling from heightliesecond partprisoneranimaldragonrabbitqueenchess β¦sistertalking animalhatblockbusterclockanthropomorphism3 dimensionalbutterflyinvisibilitycrownfantasy worldtalking dogred hairsailing shipfire breathing dragonbackwards time traveldeus ex machinabiscuitsudden change in sizechanging sizemad hattergrowing in sizeoverweight boycheshire catbig headrivalry over throne (See All) |
When Lou finds himself in trouble, Nick and Jacob fire up the hot tub time machine in an attempt to get back to the past. But they inadvertently land in the future with Adam Jr. Now they have to alter the future in order to save the past - which is really the present.
Subgenre: | time travel comedy |
Themes: | time travel |
Characters: | gay sex |
Story: | female nuditymale nuditybare breastssequelmale frontal nuditybare chested maletitle spoken by charactermale full frontal nudityvomitingsecond partmontagecocainehot tubtime machinedance club β¦shot in the crotchalternate timelinefictional game showconcealed nuditychild pornographyreference to lord of the ringsacid triptime lordreference to jennifer lawrencereference to neil patrick harris (See All) |
When two people "connect" the bond between them can be so pure and simple as to stir hearts in heaven. When they connect in all the right places at all the wrong times, heaven weeps for broken hearts. To heal these broken hearts, heaven breaks time.
Themes: | time traveldeathdrinkingdeath of fatherwriting |
Mood: | rain |
Locations: | hospitalbarrestauranttrainsnowbuslakechicago illinoistrain stationbus accidentrunning after a train |
Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother brother relationshipgirldancerwriterlawyerlittle girllove letter |
Story: | dogkissdancingpartythree word titlesurprise endingcryingcell phonecar accidentmirrorslow motion scenewatching tvcomputerdrinkletter β¦paintingbookbeertearsbirthdaycafewinebridgehousedrawingbirthday partycoffeetreekeydeath of brotherstalkingsplit screengiftfireworksgraffitiblack americanheart attackchesspickup truckscene during opening creditsarchitecturepatientarchitectattorneyconstruction sitepet dogshovelsculptureice skatingatticvoice over letterfemale doctorbrushing teethbenchglobal warmingpigeonbarking dogcartoon on tvconstruction workerpaintsailboathospital roomhospital bedmailmailboxroad accidentgurneystation wagonford mustangvalentine's daytenantwriting a letterpackingtalking to oneselfreading a letternew year's eve partystray dogreference to friedrich nietzschehit by a bushospital visittalking to a dogsurprise birthday partywatching a movie on tvringing telephonereference to dostoyevskyreference to clark gableparty invitationplumbingreference to jane austenparallel timeremake of asian filmskating rinklake michiganlove across timefloorboardreference to frank lloyd wrightglass houseanimal trackreference to jack kerouaceating a sandwichvalentine's cardreference to barcelona spainshouting surprisewriting memoirschevrolet pickup truckremake of korean filmhospital cafeteriastood up for dinnerreference to budweiserrunning on a bridgehand delivered letterreference to crime and punishment the novelstartled by phone (See All) |
Darius is a young intern at a Seattle-based magazine and jumps at the chance to investigate the author of a classified ad seeking someone to travel back in time with. Along with Jeff, the staff writer, and Arnau, a fellow intern, the three go on a road trip to a coastal town. While Jeff just wants t β¦o chase after his high school crush and Arnau wants some kind of life experience, Darius spends her time with Kenneth, a man who believes that he has built a time machine. The closer they become and the more they understand about each other, the less clear it becomes if Kenneth is just crazy or if he actually is going to successfully travel back in time. (Read More)
Subgenre: | independent film |
Themes: | time traveldrunkennessrobberylonelinessdeath of motherparanoiafalling in loveregret |
Locations: | beachforestmotelcampfire |
Characters: | father daughter relationship |
Story: | interviewflashbackcigarette smokingphotographtitle spoken by characterthree word titlesurprise endingpistolshotgunsunglassesf wordjournalistdinerman with glassesbirthday party β¦vantrainingbinocularscharacter repeating someone else's dialoguevirginmassagecollege studentchickentwenty somethingwoman with glassesmagazinelasermasked mangrocery storejob interviewtitle appears in writingturtlelens flaregovernment agentseattle washingtonlaptop computerbeing followedreference to facebooktime machineyoung version of characterold flameinterracial kisstavernreference to albert einsteinpost officereference to star warsfinger guninternfootball gameindian americanwashington stateanti socialfootball fieldreference to david bowiebumper carcampsiteclassified adshooting practiceprosthetic body partgo kartreference to craigslist (See All) |
When the ability to travel through time is perfected, a new type of law enforcement agency is formed. It's called Time Enforcement Commission or TEC. A cop, Max Walker, is assigned to the group. On the day he was chosen, some men attack him and kill his wife. Ten years later Max is still grieving bu β¦t has become a good agent for the TEC. He tracks down a former co-worker who went into the past to make money. Max brings him back for sentencing but not after telling Max that Senator McComb, the man in charge of TEC, sent him. Max has his eye on McComb. (Read More)
Subgenre: | martial artscult film |
Themes: | time travelherohome invasion |
Mood: | rain |
Locations: | hospitalwheelchair |
Characters: | husband wife relationshippolice officertough guyaction herohitman |
Period: | 1990s2000sfuture19th century1920s20th century21st century1860s |
Story: | female nuditybloodviolencefemale frontal nuditysex scenekissfemale full frontal nuditynipplespistolshootoutshot to deathblood splatterfistfightmachine gun β¦shotgunpunched in the facegunfightbrawlbased on comicriflehand to hand combatbased on comic bookdisarming someoneone man armyone against manykarateelectrocutionkicked in the faceopening action scenefirst partsemiautomatic pistolsecret agentredheadmachismocopkicked in the stomachkickboxingdual wieldpunched in the stomachm 16senatorpunched in the chestknife fightwisecrack humoralternate realitytough copbody landing on a carkarate choplasersightgovernment agenttimebombtime machinequick drawcorrupt politiciandirector also cinematographerexploding houserevolving dooralternate timelinec4 explosivespregnant woman murderedu.s. marshalkicked in the chestpunched in the nosedark horse comicsfictional government agencytime portalhouse explosionpunched in the mouthtemporal agenttime travel agency (See All) |
Marty McFly has only just gotten back from the past, when he is once again picked up by Dr. Emmett Brown and sent through time to the future. Marty's job in the future is to pose as his own son to prevent him from being thrown in prison. Unfortunately, things get worse when the future changes the pr β¦esent. (Read More)
Subgenre: | cult filmteen movieteen comedyalternate historytime travel comedy |
Themes: | time traveladultery |
Mood: | rain |
Locations: | cemeteryurban setting |
Characters: | family relationshipsteenagerboyfriend girlfriend relationshipteenage boyyounger version of character |
Period: | 1950sfuture2010syear 1985year 2015 |
Story: | number in titlesequeldoglettersecond partcafeguitarbandwomandinerrock bandattempted murdersuburbpay phoneactor playing multiple roles β¦product placementlightningautomobileloss of fathersix word titleprofanitypizzawalkie talkieguitaristroman numeral in titlemad scientistblockbusterpart of trilogyclockreverse footagepet dogkicked in the crotchthunderstormalternate realitysequel to cult favoritejewelryporn magazinegamblercartoon on tvirish americantime machinetelling someone to shut upcomputer cracker17 year oldelectric guitardrive by shootingexperiment gone wrongfamous scorecrotch grabdivaroman numbered sequelintergenerational friendshipteenage herothronealternate timelinepayphoneflying carfax machinehigh school dancepepsisequel mentioned during end creditssecond in trilogygirl next doorreference to isaac newtonbackwards time travelfiredsame actor playing two characterswalking canealtering historyyear 1955fainting manporch swingactor playing female rolereading a letter aloudcharacter appears on front page of a newspapersame actor playing two characters simultaneously on screendelorean dmc 12reference to pepsiactress playing dual rolehandwritten letterjawsfuture time travelwhite haircitroenhit with a doorvideo telephonehoverboardmanurematchbookfuture shockabsent mindednessplaying electric guitarjapanese businessmanhit by a doortime travellertunnel chase scenephotograph in newspapermeeting future selfthumbs up gestureburning a bookreversal of fortuneshot back to backmale time travelleradult actor playing teenage boyfax transmissionfainting girlspace time continuumgambling winningsusa today the newspaperwaking up in strange surroundingswestern unionabandoned libraryalmanac (See All) |
An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t β¦o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)
Subgenre: | martial artscoming of agewuxia |
Themes: | time travelmurderrevengedrunkennessherorobberyvengeancephilosophy |
Locations: | forestdesertvillagerooftopcavechinacampfire |
Characters: | teenagertough guywarrioraction herobullyvillainwitchamerican |
Story: | based on novelbloodviolenceflashbackfighttitle spoken by characterchasebeatingdreamfistfighthorseshot in the chesturinationbattlesword β¦brawlfalling from heightshootingshowdownhand to hand combatfightingcombatkung fushot in the backorphanflashlightwinesword fightstrangulationmountainambulancestabbingmixed martial artsbirddisarming someoneduellegendkaratestatuemartial artistwaterfallwhippingstylized violencemartial arts masterbow and arrowspearquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopswordsmankatanaalleyhairparkourshot with an arrowarcherywelldrumparamedicartifactpotionresponsibilitypawnshopinnmiddle ageswarlordbo staffcavalrystaffrelicwu shusecret loveshot with a bow and arrowslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneoutnumberedprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All) |
Marty McFly, a typical American teenager of the Eighties, is accidentally sent back to 1955 in a plutonium-powered DeLorean "time machine" invented by a slightly mad scientist. During his often hysterical, always amazing trip back in time, Marty must make certain his teenage parents-to-be meet and f β¦all in love - so he can get back to the future. (Read More)
Subgenre: | cult filmteen movieteen comedyalternate historytime travel comedy |
Themes: | time traveldysfunctional family |
Mood: | high school |
Locations: | helicoptersmall townbicycleurban settingschool dance |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipteenagerteenage girlteenage boybullyself worth |
Period: | 1980s1950sfutureyear 1985 |
Story: | dogphotographtitle spoken by characterchasesurprise endingfireunderwearshotgunslow motion sceneguitartelevisionbandterroristvideo camerawoman β¦four word titledinerhit by a carracial slursuburbfirst of seriespay phoneproduct placementmistaken identityrace against timelightningautomobilefirst parttv newsdestinyteen angstjeeplifting someone into the airbarnmad scientistoverallsblockbusterpart of trilogycrushskateboardpeeping tomclocktelescopeunderage drinkinginventorshopping malllove at first sightfirst kissthunderstormbulletproof vestgeekparking lotcar troublefire extinguisherirish americancafeteriafirst datetime machinecomputer crackerbully comeuppancepolitical campaignfamous scorereference to ronald reaganunwanted kiss555 phone numberflying carpepsisequel mentioned during end creditsparadoxgirl next doornuclear powerspit takefamous songfalling from a treetoyotacastle thunderperson in car trunkclock toweraltering historyyear 1955lifting a male into the airplutoniumreference to darth vaderbattle of the bandsreference to pepsireference to jerry lewisbutt grabmanurerube goldberg machineremote control cardeloreanchocolate milktime travellerinterrupted kissburger kingself fulfillmentreference to chuck berryreversal of fortunebreakfast machinedigital watchmale time travellerscale model of citybottle openercoonskin capwaking up in strange surroundingsaudio feedbackmalt shop (See All) |
In the small town of San Dimas, a few miles away from Los Angeles, there are two nearly brain dead teenage boys going by the names of Bill S, Preston ESQ. and Ted Theodore Logan, they have a dream together of starting their own rock and roll band called the "Wyld Stallyns". Unfortunately, they are s β¦till in high school and on the verge of failing out of their school as well, and if they do not pass their upcoming history report, they will be separated as a result of Ted's father sending him to military school. But, what Bill and Ted do not know is that they must stay together to save the future. So, a man from the future named Rufus came to help them pass their report. So, both Bill and Ted decided to gather up historical figures which they need for their report. They are hoping that this will help them pass their report so they can stay together. (Read More)
Subgenre: | alternate history |
Themes: | time travel |
Locations: | police station |
Characters: | stepmother stepson relationship |
Story: | rock musicteen angstguitaristtime machinebowling alleyreference to star warsreference to abraham lincolnreference to sigmund freudreference to ludwig van beethovenancient greecereference to noahoedipus complexreference to socratesaltering historyreference to joan of arc β¦reference to moby dickice cream parlorfuture time travelreference to napoleon bonapartecheating at cardsschool projectassumed deadtime travel romancereference to genghis khanmusic shopyear 1879year 1901year 1863reference to billy the kidyear 1810getting out of jail (See All) |
Preston, Idaho's most curious resident, Napoleon Dynamite, lives with his grandma and his 32-year-old brother (who cruises chat rooms for ladies) and works to help his best friend, Pedro, snatch the Student Body President title from mean teen Summer Wheatley.
Subgenre: | independent filmcult filmteen movie |
Themes: | time travelfriendshipdanceweddingbullyingphotography |
Mood: | satirehigh school |
Locations: | restaurantsmall townbicyclemexicoschool busmotorcycle accidentbus stationschool dancebicycle accident |
Characters: | family relationshipsmother son relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipboyteenage boygirldancerphotographerbullycousin cousin relationshipuncle nephew relationshipgrandmother grandson relationship |
Story: | character name in titledancingphotographtitle spoken by charactersingingtelephone callcell phonefoodhorseface slapshot in the headshotgunwatching tvcomputercamera β¦riflecafeclassroomgangbasketballinternetanti herodrawingvanmicrophonelocker roompay phonedollbraceletfarmerconvertiblewigelectionchickenclasscownerdkilling an animaleggcakeoverallsamerican footballmilkinterracial friendshippicnicinterracial romancehit in the crotchkickingrejectiontitle appears in writingfootball playerlionsalesmantigermustachenotebowlingsign languageshaved headsurprise after end creditsmexican americanvideo tapewedding ceremonycafeteriatime machinetaekwondoloserboy with glassesmedalself defensepeer pressureinterracial marriagemisfitanimal abuseinterracial kissbowling alleyfootsie under the tablewhite trashbased on short filmjockutahroller skateswatching a videofamous lineschool lifeonlinewater fountaintrack and fieldmirror ballidahogeneration ysand dunepinatahensteakcyberspaceschool lockerbelchdune buggyvestwolverinename tagllamapopular girlhamkeychainmale to female footsie playingchicken farmnunchuckstallionreference to loch ness monsterspanish accentclass presidentinternet romancecorsageinternet chatroomhigh school electionlying about one's ageschool auditoriumtetherballblowing nosejuarez mexicochicken farmersleeper hit (See All) |
Gil and Inez travel to Paris as a tag-along vacation on her parents' business trip. Gil is a successful Hollywood writer but is struggling on his first novel. He falls in love with the city and thinks they should move there after they get married, but Inez does not share his romantic notions of the β¦city or the idea that the 1920s was the golden age. When Inez goes off dancing with her friends, Gil takes a walk at midnight and discovers what could be the ultimate source of inspiration for writing. Gil's daily walks at midnight in Paris could take him closer to the heart of the city but further from the woman he's about to marry. (Read More)
Themes: | time travellove |
Locations: | paris france |
Characters: | detectivewriteramericanamerican abroadamerican in europe |
Period: | 2010s19th century1920s20th century1890s21st century |
Story: | three word titlepaintingplace name in titlepaintercity name in titlemagical realismcoupleprivate detectivepastnostalgiasculpturenoveltime in titleearringcity in title β¦modern artmidnightart historyantique shopfrench accenttime warptime travelerseine riverfamous songantique dealernude paintingback in timememorabiliafamous paintingflappertime portalcult film referencereference to f. scott fitzgeraldugly americanamerican touristgolden agesepiafamous authortime travel romancemontmartre parisfamous peoplereference to jean cocteaufamous singerfrench stereotypereference to cole porterreference to james joycecancan dancepalace of versaillespearl earringsome scenes in sepiabelle epoquefilm blanccritiquereference to auguste rodinmoulin rougeeuropean artreference to modiglianistroke of midnightbell tollingpicasso paintingflapper costumereference to a famous paintingvintage film cinematographywandering the streetsreference to georges braquesepia tinted scene (See All) |
After total humiliation at her thirteenth birthday party, Jenna Rink wants to just hide until she's thirty. Thanks to some wishing dust, Jenna's prayer has been answered. With a knockout body, a dream apartment, a fabulous wardrobe, an athlete boyfriend, a dream job, and superstar friends, this can' β¦t be a better life. Unfortunately, Jenna realizes that this is not what she wanted. The only one that she needs is her childhood best friend, Matt, a boy that she thought destroyed her party. But when she finds him, he's a grown up, and not the same person that she knew. (Read More)
Subgenre: | coming of agefish out of waterteen moviecoming of age film |
Themes: | time travelfriendshipbetrayaldanceweddingunrequited lovefirst love |
Locations: | new york citytaxi driver |
Characters: | father daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipteenage girlteenage boyfemale protagonistphotographerbest friendchildhood friendfiance fiancee relationship |
Period: | 1980s2000syear 1987 |
Story: | number in titlebare chested malekisspartydigit in titlethongbirthdaymanhattan new york cityfour word titlebrunettebirthday partylibrarystripteaseprankhairy chest β¦blindfoldhateteen angstathleteagingmagazinenew jerseytaking a pictureco workermakeupwishclosetbirthday presentcentral park manhattan new york cityblindfoldededitortween girl13 year oldcamcorderchick flickdance sceneestrangementjunior high schoollong brown hairbody swapreference to madonnanightgownwish fulfillmentmale female friendshipgreenwich village manhattan new york cityempire state building manhattan new york citydollhouseblamemagazine editoraltering historyfemale tearswhat if30 year oldbody transformationcomfortage in titlereference to eminemchild as adultoffice jobtime travel romancebusiness presentationturmoilstaff meetingends with weddingschool photobirthday wishdo overmud maskreference to bambispontaneous choreographykissing gamemagical duststolen idea13th birthdaypitch meetingcompeting businessesthriller danceworkplace rivalry (See All) |
Taylor and two other astronauts come out of deep hibernation to find that their ship has crashed. Escaping with little more than clothes they find that they have landed on a planet where men are pre-lingual and uncivilized while apes have learned speech and technology. Taylor is captured and taken t β¦o the city of the apes after damaging his throat so that he is silent and cannot communicate with the apes. (Read More)
Subgenre: | cult filmpost apocalypsedystopia |
Themes: | time travelmurderdeathfriendshipreligionescapeheroracismhuntingspace travelevolution |
Mood: | satire |
Locations: | beachdesertwaterlakeouter spacecavemuseumearth |
Characters: | friendvillain |
Period: | future |
Story: | based on novelmale nudityviolencemale rear nuditybare chested malegunkissexplosionchasesurprise endingpistolfirebased on bookshootoutcorpse β¦horserescuerifleanimal in titlesciencescientistswimmingdeath of friendweaponmaptrialforeign language adaptationsearchjourneyskinny dippingdangerprologuescreamingfirst of seriescharacter's point of view camera shotdollamerican flaghairy chesttied upfirst partwaterfallclass differencesdominationshavingwoundheroinetalking animalloss of friendcaptivehunterbeardhidingspacecraftplanetblockbusterladdertorchdead womanbarefootmuteplot twistastronautdead mancanelaughingholding handsplanthorseback ridingnude swimmingauntflagforced to stripstrandedgorillacornfieldcrash landingartifactscarecrowsole black character dies clichechimpanzeeapestatue of libertycreationismlifting person in airscience runs amokloinclothspace explorationcryogenicspapervivisectionnetbrain surgerynepheworangutancaged humancaught in a netbasketlobotomypaper airplanerelativeattempted escapesimian fictionfuture time travelman forced to stripstolen clothesblack horseembarrassing male nudityinflatable boatlife raftape mandeath of womanplanet of the apesthrowingwriting in sandfamous twistforbidden zoneinflatable life raft (See All) |