Please wait - finding best movies...
In the late 1940s, Prince Seretse Khama of Bechuanaland is studying law in Britain in preparation for his eventual ascension to the throne. There, the dashing prince falls in love with a white British clerk, Ruth Williams, and they plan to marry. While they suspect that his uncle, the Regent, would …disapprove, nothing prepares them for the diplomatic firestorm and domestic political tumult their defiant love would spark. Now facing a citizenry leery of a white Briton as their Queen, the international opposition is even more unyielding from the British holding their land as a protectorate and fearful of South Africa's racist backlash to this affront to their apartheid domination. Against all odds, King Khama and Ruth must struggle to maintain their love and help their people in a land that would become the Republic of Botswana. (Read More)
| Themes: | racismbetrayal |
| Locations: | africalondon england |
| Characters: | interracial relationship |
| Period: | 1950s1940s |
| Story: | crown princebritish parliamentabdicationbotswanabanishmentinterracial marriageinterracial kisscolonialismexileforbidden loveriotprincequeenchildbirthprotest …marriage proposalkingdancingf rated (See All) |
A sumptuous and sensual tale of intrigue, romance and betrayal set against the backdrop of a defining moment in European history: two beautiful sisters, Anne and Mary Boleyn, driven by their family's blind ambition, compete for the love of the handsome and passionate King Henry VIII.
| Themes: | betrayaldeathmarriageinfidelityrapereligionjealousypoliticsadulterypregnancydanceweddingincestseductionextramarital affair …unfaithfulnessexecutiondyingwealthaffairhunting (See All) |
| Mood: | rainwedding night |
| Locations: | beachchurchcourtroomcastle |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother sister relationshipprostitutedancerbabysister sister relationshiplove trianglecatholicuncle niece relationship |
| Period: | 16th century |
| Story: | queenchildbirthkingdancingsexcharacter name in titlebased on noveldogkisstitle spoken by charactersingingcryingsongfoodface slap …undressinglietearsdecapitationwomanfalse accusationtrialtentdeath of childcourtwitnesstrustinjuryroyaltycrucifixbrother sister incestbirthambitionrear entry sexarranged marriageintriguesibling rivalryhorse and carriagewedding receptionmiscarriagepalacehorseback ridinggiving birthbeheadingpopemenstruationtreasoncrownloss of childpearl necklacenewborn babyillegitimate childdeath sentenceriskdressingsailing shipnightgownprotestantwashinghand kissingbraided hairqueen of englandgeesebraidsroyal courtguilty verdictinfluencesecret marriagemorning sicknessravinequeen elizabeth inightshirtlady in waitingstillbirthannulmentriding accidenttower of londontudorindictmentline of successionpalace intrigueking henry viiibetrothalkent england1520sheir to thronestill birth1530sanne boleynbastard son1510scrowningenglish courtside saddle (See All) |
England's Prince Albert must ascend the throne as 'King George VI' (qv), but he has a speech impediment. Knowing that the country needs her husband to be able to communicate effectively, Elizabeth hires Lionel Logue, an Australian actor and speech therapist, to help him overcome his stammer. An extr …aordinary friendship develops between the two men, as Logue uses unconventional means to teach the monarch how to speak with confidence. (Read More)
| Subgenre: | political drama |
| Themes: | deathfriendshipmarriagechristmasmoneydrinkingfeardivorcedeath of fatherfaithdyingdisabilityunlikely friendship |
| Mood: | rain |
| Locations: | london englandsnowairplaneelevatorenglandgermanychurch of england |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfrienddoctorsingerbrother brother relationshipnursephotographerreference to godlittle girlaustralian …americandoctor patient relationshipself confidence (See All) |
| Period: | world war two1930syear 1939 |
| Story: | british parliamentabdicationprincequeenmarriage proposalkingdancinginterviewdogkisscigarette smokingtitle spoken by charactersingingthree word titlebased on true story …telephone callpunctuation in titlecryingsongfoodhorsecameradrinksecretbookliebeertearsapostrophe in titlereference to jesus christprayertelephonef wordsubjective camerawinemontageeatingapologyno opening creditsradiocigar smokingprincessparklimousinemicrophonefired from the jobumbrellaauditionstorytellingreadingchristmas treespeechdeath of brothercrossprofanityreference to william shakespearetypewritertruststrong female characterrecord playereyeglassesapplauseteawhat happened to epiloguereference to adolf hitlerfriendship between menlistening to musicrecordingroyaltymale bondingfraudeccentricrehearsalservantclassical musiccrying mancompassionchokingpromisenicknamescotlandnewsreel footageanxietyheadphonescigarette lighterfogchoirbalconyhorse and carriagedivorceenannychauffeurhorseback ridingprime ministerunderdogceremonyearphonesdementiabarking doghandshakedefecationtreasonlooking out a windowmajorcomic reliefunited kingdom13 year oldteasinglistening to radiogreat depressiongiving a toastwhistlingchandelierbritaintitle in titlebritish soldiercowardnazismreference to shakespeare's hamletdistruststutteringmovie camerakiss on the cheekepilepsybiplanethroneflash cameratop hatphonographbromanceradio broadcastends with textscottishreference to josef stalintalking to oneselfportrait paintingreference to charles dickensmonarchymovie projectorempowermenthand kissingdead brotherwaltzkiltmodel airplanepneumoniawine cellarbbccoronationjoke tellingstuttertiarabritish royal familybritish empirecold the temperaturespeech impedimentmarblesignaturerocking horserepeated dialoguevoice recordingreference to shakespeare's othelloking of englandair raid sirenpre world war twoyear 1936archbishopcigarette casefountain penused car salesmanhelplessnessreference to australiabritish prime ministerreference to queen victoriabritish governmentdeath of kingprince of waleschivalryyear 1925air raid sheltertherapist client relationshipstammeringpug dogyear 1934mumblingscenario which perverts factsdiaphragmreference to berlin germanyspeech therapiststamp collectiongarglingreference to shakespeare's twelfth nightprotocolspeech therapytongue twisterhandednesscongratulationsduke of windsorcorgiking george vireference to duchess of windsordeclaration of warhouse of windsorreference to neville chamberlainreference to pandora's boxbrewerreference to scotland yardshakespearean quoteshillingdecorumradio speecharchbishop of canterburybuckingham palace londondeath of teenage boyfelling a treemantle clockreference to geoffrey chaucerreference to new zealandvocal exercisebuilding model airplaneelocutionking edward viiiwestminster abbey (See All) |
It is the 21st birthday of Prince Akeem of Zamunda and he is to marry a woman he never saw before. Now the prince breaks with tradition and travels to America to look for the love of his life.
| Subgenre: | fairy talefish out of water |
| Themes: | friendshipmoneyhomelessnesswealth |
| Mood: | satire |
| Locations: | africanew york citysnownightclubairportusaamerica |
| Characters: | father son relationshipfather daughter relationshipafrican americanboyfriend girlfriend relationship |
| Period: | 1980swinter |
| Story: | princequeenkingdancingfemale nuditysecretmanhattan new york citybasketballactor playing multiple rolesflirtingroyaltyblockbusterjanitorswitchblade …arranged marriageghettoirreverencesidekickassumed identitybarberurban decayhamburgerrole reversalman wearing glassesbarbershopbride and groomsuitorearringsfake commercialfictional countryqueens new york cityreference to martin luther king jr.studio logo segues into filmtaxi ridecold weatherrudenessspit taketrailer narrated by percy rodriguezmadison square garden manhattan new york citybarkingimplied fellatiomopping a floorobnoxiousnessmale actor playing a female characterconcordetwo suitorsreference to hugh hefnerjheri curl hairstylereference to rocky marcianohold up man (See All) |
This is the story of Anna Leonowens, the English schoolteacher who came to Siam in the 1860s to teach the children of King Mongkut. She becomes involved in his affairs, from the tragic plight of a young concubine to trying to forge an alliance with Britain to a war with Burma that is orchestrated by … Britain. In the meantime, a subtle romance develops between them. (Read More)
| Themes: | murderexecution |
| Mood: | rain |
| Locations: | beachschoolboatship |
| Characters: | father son relationshipmother son relationshipfather daughter relationshipchildren |
| Period: | 19th century1860s |
| Story: | forbidden loveprincekingdancingcharacter name in titleexplosionsurprise endingbased on true storyletterbookriverdecapitationmassacrebridgewidow …four word titletrialbirthday partypoisondeath of childringgeneralclassfireworksclass differencessingle parenttraitoreggslaveryelephanttempleculture clashtelescopebuddhismpalaceprime ministerharborteachingdead childrentreasonambassadorxenophobiaschoolteachertrumpetmusic boxbriton abroadpolygamycapital punishmentandrogynymonarchywaltzsoutheast asiaconcubinepublic executiondowrycholeravictorian agechildren's choirvictorian fashionmass hangingpaddle steamercasteismforeign diplomatsiam (See All) |
Follows the life of 'Karen Blixen' (qv), who establishes a plantation in Africa. Her life is Complicated by a husband of convenience (Bror Blixen), a true love (Denys), troubles on the plantation, schooling of the natives, war, and catching VD from her husband.
| Subgenre: | epic |
| Themes: | lovefriendshipmarriageinfidelitymoneyadulteryweddingfuneralnatureextramarital affairdivorceunfaithfulnesswritinghunting |
| Mood: | movingwedding night |
| Locations: | africatrainschoolcemeteryfarmjunglecampfireairplane accident |
| Characters: | husband wife relationshipfrienddoctorfemale protagonistlove triangleself destructiveness |
| Period: | 1930s1920s1910s |
| Story: | colonialismmarriage proposaldancingsingingbased on true storyfirevoice over narrationbased on bookdreamface slapdeath of friendracial slurgravepassionstorytelling …tragic eventgiftworld war onewildlifetwinhunterdenmarkblockbusterculture clashrailway stationparadeanimal attackpicnicinterracial romanceadventurerfloodwhipthunderstormlionmarital problemwedding receptionreflectioncar troubleunhappy marriagebankergramophonetoastinfertilitygigolobankruptcyfamous scorekenyabagpipesbiplanecolonycompassplantationmarriage of convenienceglovecountry in titlenew year's eve partyfireworknobilitybaronreceptionloss of boyfriendsafarisyphilisshampoonative tribeaccentcuckoo clockmalariababoonswahiliprivate clubcolonialdomestic servantbritish colonialtribal chiefshooting partybritish colonialismbritish expatriatebig game huntercoffee plantationdressagecolonial africacolonial eragreat white hunter (See All) |
After a beloved King vanishes, his ruthless wife seizes control of the kingdom and keeps her beautiful 18-year-old stepdaughter, Snow White, hidden away in the palace. But when the princess attracts the attention of a charming and wealthy visiting prince, the jealous Queen banishes the girl to a nea …rby forest. Taken in by a band of rebellious but kindhearted dwarfs, Snow White blossoms into a brave young woman determined to save her country from the Queen. With the support of her new friends, she roars into action to reclaim her birthright and win back her Prince in this magical adventure comedy that will capture the hearts and imaginations of audiences the world over. (Read More)
| Subgenre: | fairy talebased on fairy tale |
| Themes: | friendshipmarriagejealousyescapedancedeceptionmagicrobbery |
| Locations: | forestsnowwoodslakecastletown |
| Characters: | female protagonistwitchstepmother stepdaughter relationshipevil witch |
| Story: | banishmentprincequeenkingf ratedcharacter name in titletwo word titlebare chested malekisstitle spoken by characterpartychasehorsemirrorremake …swordbirthdaygood versus evilsword fightdisguiseno opening creditsbirdprincesstrainingattempted murderdangerpuppetkeyscene during end creditsbare chested male bondagestrong female characterchessrepetition in titleroyaltywitchcraftvillainessstrong female leadappledwarfbutcherkingdompuppyblack magicdaggerspellinsecurityfemale fightercockroachstepmothercrownrumorbeast18 year oldhanging upside downscorpionheiresshiding under a bedfinancial problemcanceled weddinghung upside downpendantsong and dancebarongalamagical potiondisobeying ordersleechhands tied behind backsnow whiteevil queentaxmagical mirrorevil plotmirror does not reflect reality18th birthdayevil stepmotherwoman fights mantalking to mirrordark powertax collectorpoison appleturned into an animalwicked witchsong during creditsseven dwarvesunder a spellenchantresshalf naked manorders to killdecreehuman chessboard (See All) |
In 1767, the British Princess Caroline is betrothed to the mad King Christian VII of Denmark, but her life with the erratic monarch in the oppressive country becomes an isolating misery. However, Christian soon gains a fast companion with the German Dr. Johann Struensee, a quietly idealistic man of …the Enlightenment. As the only one who can influence the King, Struensee is able to begin sweeping enlightened reforms of Denmark through Christian even as Caroline falls for the doctor. However, their secret affair proves a tragic mistake that their conservative enemies use to their advantage in a conflict that threatens to claim more than just the lovers as their victims. (Read More)
| Subgenre: | conspiracyperiod dramaperiod piececostume drama |
| Themes: | betrayallovemarriageinfidelityreligionpoliticsadulteryprisonpregnancyfeartorturedanceextramarital affairdepressiondrug use …insanityhumiliationillnessmental illnessexecutiondyingrevolution (See All) |
| Mood: | rain |
| Locations: | beachchurchsnowbathtubenglandgermanybrothelsex in public |
| Characters: | family relationshipshusband wife relationshipmother son relationshipdoctorprostituteteenage boypriestlove trianglereference to godlittle boymaidfrenchcrying babystepmother stepson relationshipin love |
| Period: | 18th century1700s |
| Story: | queenchildbirthprotestkingdancingf ratedfemale nuditynuditybloodflashbackmasturbationdogbare chested malesex scenekiss …female rear nuditybased on true storyvoice over narrationcryingbeatingcorpsehorsemirrorface slapslow motion scenearrestundressingbare buttlettervomitingtearsdead bodydecapitationspygay slurcandleeatingnarrationbathflash forwardconfessionfired from the jobhairy chestcrosshorse ridingreference to william shakespearelooking at oneself in a mirrorroyaltydemonstrationdenmarkdysfunctional marriageservantmobrebellioncrying mantorchfatestreet lifepromisecensorshiparranged marriageintrigueunfaithful wifehistoricaltheatre audiencedead manvoice over letterprison celllanternpublic humiliationpassionate kisshorse and carriageholding handspalaceimprisonmenthorseback ridingdanish royal familybeheadingunhappy marriagepeasanthit in the facephysiciantreasonstepmotheridealismrumorstage play16 year oldfencingbare chested boycopenhagen denmarkillegitimate childsexual repressionenlightenmentcoup d'etataristocracyradicalsecret loveends with biographical notesstagecoachroyal familytortured to deathpuppet showcoupmasqueradecouncildanish historytalking to a doggreat danespitting on someonepublic executionmarital rapecopenhagenreformsmallpoxdestroying propertymarriage as hellreference to voltairevaccination1770slady in waitingmasked ballmasquerade partywoman in a bathfree thinkerringing a bellreference to jean jacques rousseaureference to king arthur1760sman in bathdanish politicsgovernment ministerpolitical reformmarriage troubleinoculationtalking to a horsemale male embracedowagerfancy dress party (See All) |
Pompous phonetics professor Henry Higgins is so sure of his abilities that he takes it upon himself to transform a Cockney working-class girl into someone who can pass for a cultured member of high society. His subject turns out to be the lovely Eliza Doolittle, who agrees to speech lessons to impro …ve her job prospects. Higgins and Eliza clash, then form an unlikely bond -- one that is threatened by an aristocratic suitor. (Read More)
| Subgenre: | coming of agefish out of water |
| Themes: | lovedanceunemploymentinheritance |
| Locations: | london england |
| Characters: | mother son relationshipfather daughter relationshipprofessorself centeredness |
| Period: | 1910s |
| Story: | forbidden loveprincequeendancingbased on playhorsemansionapologytransformationfantasy sequenceclass differencespubeavesdroppingstreetblockbuster …gossipculture clashcolonelstarrainstormbetaristocratteachingschememisogynisthorse racingmakeoverselfishnessbachelorlanguagegramophonewagertutorrole reversalrags to richesbachelor partyopposites attracthorse raceprice of famefiring squadsocialitephonographracetrackhigh societysuitorhorse drawn carriagesnobscreenplay adapted by authorwaltzsteamopera housebased on stage musicalcinderella storymilitary veteranetiquetteclass distinctionlinguisticsmarblesnubile womanpillarlinguistpygmalion70mm filmflower vendorstreet urchinflower girlclass prejudicewalking with a book on one's headbased on stage musical based on stage playflower market (See All) |
Italy, 1944. As the war takes its toll on Allied forces in Europe, a squadron of black pilots known as the Tuskegee Airmen are finally given the chance to prove themselves in the sky - even as they battle discrimination on the ground. It's a tribute to the unsung heroes who rose above extraordinary …challenges and ultimately soared into history. (Read More)
| Themes: | racismmilitaryalcoholismu.s. military |
| Locations: | baritalytunnelairplane on fire |
| Characters: | interracial relationshipafrican americanteenage boygermanamerican abroadself empowerment |
| Period: | 1940sworld war twoyear 1944year 1942 |
| Story: | interracial kissmarriage proposaltwo word titlebare chested maletitle spoken by characterexplosionshot to deathshot in the chestpunched in the facebattlearrestcolor in titleshot in the backdeath of friendshot in the leg …racial slurbinocularscharacter repeating someone else's dialoguecharacter says i love youdirectorial debutgeneralsubtitled sceneblack americantwenty somethingitaliancaptainjeepjail cellcolonelbar fightmechanicbraveryairplane crashparachuteprisoner of wardeath of loved oneheroismblood on camera lensswastikamajorplane crashstretcherexploding truckmilitary basefighter pilotexploding shipdogfightaerial combatflare gunfighter planeu.s. air forceexploding airplanepentagonends with textracial segregationjet fighteroxygen maskfreight trainblowing a kissinsubordinationtrain wreckprisoner of war campanti aircraft gunplane shot downspeaking germanexploding trainaerial bombardment50 calibre machine gunstrafingriding motorcyclesmoking a pipetuskegee airmenbail outboeing b 17 flying fortressnorth american p 51 mustangfighter escortmesserschmitt me 109daredevil pilotamphibious landingblack jesusdouglas c 47 skytrain (See All) |
Biograpical epic of Malcolm X, the legendary African American leader. Born Malcolm Little, his father (a Garveyite Baptist minister) was killed by the Ku Klux Klan. Malcolm became a gangster, and while in jail discovered the Nation of Islam writings of Elijah Muhammad. He preaches the teachings when … let out of jail, but later on goes on a pilgrimage to the city of Mecca, there he converts to the original Islamic religion and becomes a Sunni Muslim and changes his name to El-Hajj Malik Al-Shabazz. He is assassinated on February 21, 1965 and dies a Muslim martyr. (Read More)
| Subgenre: | cult filmconspiracyepicbased on autobiographypolitical drama |
| Themes: | racismmurderdeathdrugsreligionpoliticsprisongangsterangerdrug useredemptionsurveillancepolice brutalityreligious conversion |
| Locations: | africanew york citybarbeachtraininner city |
| Characters: | interracial relationshiphusband wife relationshippolicemother son relationshipafrican americanboyteenage boytough guyself discovery |
| Period: | 1950s1940s1960s1930s1920s |
| Story: | character name in titlebloodviolenceflashbacktwo word titlephotographtitle spoken by characterpistolvoice over narrationcryingbeatingshot to deathshot in the chestshotguntears …jailmanhattan new york citycriminalassassinhuman rightsman with glassesassassinationcontroversyshot in the legracial slurmicrophonespiritualityfbiwritten and directed by cast memberconvertiblespeechamerican flagtragic eventsadnessshot in the armciahateblack americaneyeglassesrace relationsrageislambrooklyn new york citycompassionpreachercivil rightsburglarmiddle eastburglaryhatredboston massachusettsdeath threatdeath of protagonistracistconvictloss of husbandtragic herohustlershot multiple timesmain character diesintoleranceurban decay16 year oldbaseball capracial prejudicemosquefight the systemex conblaxploitationpolitical activistracial tensiondeath of title characterfirst person narrationku klux klanracial discriminationmain character shotsolitary confinementharlem manhattan new york citycivil rights movementkennedy assassinationmultiple time framesstreetcarracial segregationpenitentiaryracial violenceblack historydirected by co starrise to powerracial injusticeblack powerblack man white woman relationshipanti racismcrusadeblack white relationsstreet hustlerracial identitystreet preacherracial intoleranceracial integrationflag burningwest indianblack militantnation of islamblack activistbedford stuyvesant brooklyn new york cityblack radicalismrodney king incident (See All) |
The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma …iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)
| Subgenre: | cult filmcoming of ageepicswashbucklersword and fantasy |
| Themes: | betrayalmurderdeathlovesurrealismkidnappingghostescapemagicunrequited lovehopedyingcourage |
| Locations: | beachforestsnowbathtubvillagestorm |
| Characters: | friendteenage boybabywitchyounger version of characterevil witch |
| Period: | 1870s1850s |
| Story: | princequeenkingdancingf ratedbased on novelviolenceone word titleflashbackkisstitle spoken by characterexplosionchasefirevoice over narration …foodhorsemirrorblonderescueswordfalling from heightletterrunningbirthdayscientistgood versus evilcandlesword fightdeath of friendeatingno opening creditsbirdcoffinbathunderwater sceneprincesstransformationconfessionattempted murderargumentprologuerace against timelightningdeath of brotherdeath of sontied upflowersleepingcross dressingmoonpirateballoongothiccageelephantmousewitchcrafthonorslavetelescopethundermisunderstandingensemble castinsultlightstick fightmannequinhappy endinginvisibilitydead animaltowerblonde womancrownbroken mirrorfencingmeat cleavercheeseimplied sexlong brown hairstaffcupwaltzstickcrossroadsliverblue blooddeath of kingtied togetherpushed off a cliffintestinemusic score features choirevil princesilver dress (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
| Subgenre: | martial artssword and sorceryswashbucklersword and fantasy |
| Themes: | betrayalmurdermarriageescapeherodeath of fathertime travel |
| Locations: | snowdesert |
| Characters: | soldiertough guywarrioraction hero |
| Story: | princekingviolenceflashbackkisstitle spoken by characterexplosionchasehorsebattleswordshowdownhand to hand combatcombatkung fu …good versus evilfoot chaseorphanassassinsword fightambushaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armyfictional warprincesson the runone against manyfugitivebrotherstylized violencestrong female characterdestinybow and arrowcountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandcrossbowseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomsword duelblack magicdaggerframed for murderunclepalaceswordsmanparkourfortresssorcereradopted sonmacguffinrobesword fightingsword and sandaltitle in titleempirecorrupt officialsubterraneanshot with a bow and arrowarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All) |
This sweeping account of the life of Pu-Yi, the last emperor of China, follows the leader's tumultuous reign. After being captured by the Red Army as a war criminal in 1950, Pu-Yi recalls his childhood from prison. He remembers his lavish youth in the Forbidden City, where he was afforded every luxu …ry but unfortunately sheltered from the outside world and complex political situation surrounding him. As revolution sweeps through China, the world Pu-Yi knew is dramatically upended. (Read More)
| Subgenre: | epicbased on autobiography |
| Themes: | murdersuicidemarriagedrugsadulteryprisonweddingdivorcecommunismdrug addictionrevolution |
| Mood: | wedding night |
| Locations: | airplanebicyclejapanrooftopchinamuseum |
| Characters: | brother brother relationshipjapanese |
| Period: | 1950s1940sworld war two1960s1930s1920s1910s1900s |
| Story: | abdicationprotestdancingfemale nuditythreesomesingingthree word titlefireshot in the headinterrogationmenage a troisbisexualsuicide attemptnonlinear timeline …confessionflowerloss of motherarsoneyeglassesroyaltymousemovie theatertennisrailway stationparadehaircutcamera shot of feetarranged marriagenewsreel footagerainstormbuddhismextortiontourpalacegatespit in the facebreast feedingtreasongardeneremperoranimal abusefoot closeupvaletembassytutoractual animal killedpolitical prisonertitle in titlefamous scoredecadencepolygamydeath of title characteropiumthronebeijing chinainfanticidescotcricketfemale stockinged footcoronationinkreceptioneunuchjapanese armycultural revolutionconcubinetradition versus modernityempresssino japanese warseclusionfemale bare footreference to mao tse tungspectacleswanting a divorcechinese historyimperial japanrepublic20th century historytime magazinebased on historywet nursechinese emperormanchuriareference to hiroshimaparty memberred chinareference to harold lloydeye testforbidden cityreference to chiang kai shekpowerlessnessillegitimate pregnancyjapanese occupation of chinaasian historytianjin chinachild rulereating flowermoral reformationpicture on time magazinepuppet state (See All) |
Hamlet, son of the king of Denmark, is summoned home for his father's funeral and his mother's wedding to his uncle. In a supernatural episode, he discovers that his uncle, whom he hates anyway, murdered his father. In an incredibly convoluted plot--the most complicated and most interesting in all l …iterature--he manages to (impossible to put this in exact order) feign (or perhaps not to feign) madness, murder the "prime minister," love and then unlove an innocent whom he drives to madness, plot and then unplot against the uncle, direct a play within a play, successfully conspire against the lives of two well-meaning friends, and finally take his revenge on the uncle, but only at the cost of almost every life on stage, including his own and his mother's. (Read More)
| Subgenre: | tragedyepic |
| Themes: | betrayalmurderdeathlovefriendshiprevengesuicideghostpoliticsfuneralangerdeath of fatherdeath of motherparanoiadysfunctional family …insanitygriefmadness (See All) |
| Locations: | traincastle |
| Characters: | family relationshipsfather son relationshipmother son relationshipbrother sister relationshipactorlustuncle nephew relationshipstepfather stepson relationship |
| Period: | 19th century |
| Story: | princequeenkingcharacter name in titlebloodone word titlebased on playface slapfalling from heightsword fightdrowningduelgravewritten and directed by cast memberpoison …directed by starpremarital sexroyaltydenmarkskullhaunted by the pastvisiondeath of sisterdead woman with eyes openmelancholyphysical abusemain character diespalacefencingpoisoningstar crossed loverstwo way mirrorverbal abusedying wordsfratricidedead woman on floorshakespeare's hamletshakespeare playregicideskull maskintermissionfamily betrayalusurperreference to herculesresentment toward stepfatherresentment toward motherpressure from fathercontemplating murderpressure from sonresentment toward unclesuspicion of another's madness (See All) |
"All eyes will be on you," says the Austrian Empress, Maria Theresa to her youngest daughter Marie Antoinette. The film, marketed for a teen audience, is an impressionistic retelling of Marie Antoinette's life as a young queen in the opulent and eccentric court at Versailles. The film focuses on Mar …ie Antoinette, as she matures from a teenage bride to a young woman and eventual queen of France. (Read More)
| Subgenre: | alternate historyrevisionist history |
| Themes: | deathmarriageinfidelityadulterydrinkingdrunkennessweddingseductionextramarital affairdeath of fatherdeath of motherdrug useunfaithfulnesshumiliationgambling …illnesstheatrerevolutionhuntingfrench revolutiondeath of babyamerican revolution (See All) |
| Mood: | up all night |
| Locations: | paris francebathtubfrancebrothel |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother daughter relationshipdoctorsingerbrother sister relationshipprostitutefemale protagonistdancermusicianbabypriestsister sister relationshipmaid …catholicgrandfather grandson relationshipfiance fiancee relationshipfrench soldier (See All) |
| Period: | 18th century |
| Story: | queenchildbirthkingdancingf ratedsexfemale nuditycharacter name in titlebased on novelnuditydogkissfemale rear nuditysingingparty …voice over narrationcryingsongtitle directed by femalefoodhorsemirrorslow motion scenedrinkswordundressingbare buttletterpaintingtearsbirthdaybedspyoperacandlewomanmontageeatingdinnerchildcoffinbirthday partybathritualfemme fataleprincesspublic nudityvirginfactorychampagnestorytellingtentreadingdeath of childflowerswiggardenfireworkseuropescandalbirthday cakeapplausetraditionloss of virginitycakelifting someone into the airroyaltyelephantbuttocksgossipbirthorchestrashoesfanmourningintrigueunfaithful wifepet dogshoppingrowboattheatre audiencecard playingbilliardsalternate realityvoice over letterhorse and carriageparrotpipe smokingpalacemale virginwoman in bathtubhorseback ridingmotherhoodgiving birthjewelrycandysailboatnaivetyaustriavienna austriaambassadorchandeliersunrisebishopopera singerfeatherclothingdecadencedivagame playingrevoltritediceanachronismbride and groomlocketcustomdiamondswoman initiating sexhappy birthdaysexual innuendostagecoachportrait paintingroyal familysnuffaustriancrossing selfdukecountessjugglerharpcoronationcounttobaccomasqueradeempressversaillestaxesbelchsister in law sister in law relationshipreference to thomas jeffersonduchesssexless marriagebeagleharpsichordreference to mozarthair dresserdressmakerreference to alexander the greatsalonsmallpox1780spugdance party1770slady in waitingmasked balldeath of kingmasquerade partyannulmentwearing clothes in a bathtubpug dogself indulgencereference to jean jacques rousseauextravagance1760sman refusing sexmasquerade ballbastillehorse drawn hearsedauphineye maskunconsummated marriageransacked roompolitical adviserlawn croquetpowdered wigrococotricorne (See All) |
Based on Rosalie Ham's best selling novel, The Dressmaker is the story of femme fatale Tilly Dunnage who returns to her small home town in the country to right the wrongs of the past. A stylish drama with comic undertones about love, revenge and haute couture.
| Subgenre: | dark comedyabsurdism |
| Themes: | betrayalmurderlovefriendshiprevengesuicideinfidelityadulterydrinkingdanceweddingfuneralmemoryextramarital affairdeath of mother …drug useunfaithfulnessillnessrivalrybullyingfashionmadness (See All) |
| Locations: | london englandnew york citytrainchurchhotelcemeterysmall townparis francebathtubbusrural settingwheelchairaustraliafrancetrain station …spainschool teachertown (See All) |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendsingerbrother brother relationshipboyfemale protagonistgirldancerphotographerbullymother …witchmother in law daughter in law relationshipcrying girlpolice sergeantin love (See All) |
| Period: | 1950s |
| Story: | exilemarriage proposaldancingf ratedbased on novelbloodviolenceflashbackdogbare chested malesex scenekisscigarette smokingphotograph …singingknifechasetelephone callfirevoice over narrationsongtitle directed by femalemirrorface slapcameradrinkarrestundressingsecretletterbooklieriflesunglassesrunningmarijuanareference to jesus christtelephonef wordnewspaperflashlightstabbingdeath of friendwomanfootballapologycoffinspaceshipbathfemme fataledrowningflash forwardtheatercursemicrophonecostumescreamingumbrelladebtbankfarmerpursuitwigcrossdeath of sonthreatchickenflowerloss of mothersleepingreference to william shakespearearsonhatestrong female characterrecord playertransvestitescandaleyeglassesgolfteacakelistening to musicscene during opening creditsrecordingloss of friendmousehidingcrying womanmovie theateraccidental deathgossipcheating husbandstrong female leadwhiskeynicknametelescopeboxer shortsloss of sonrivalfallboarding schoolwedding dressgasolinecanelanterntrophybonfirebenchwedding receptionholding handsmannequinmale objectificationtriple f ratedgolf clubname callinglooking out a windowbroken mirrorfalling into waterbusiness cardhead injurybleeding to deathsewing machineundressing someonehorse and wagonreturning homereference to supermanhouse on firebride and groombroken neckclimbing out a windowflash cameramilan italyhometownred carpetpassing outmelbourne australiatrain conductorfemale objectificationburning housejumping ropegeneral storelooking in a windowbloody mouthhead bandagehidden truthwoman in a wheelchairgolf ballapplying lipstickreference to shakespeare's macbethbest manwoman in a bathtubdead soncheating on wifeillegitimate daughterslip the undergarmenttelephone operatorslanderfeeding someonecostume designerwoman directortrailer houseaccused of murdermama's boydressmakerwolf whistlereflection in a mirrordefamationaccidental suicidehaute coutureyear 1951opera musicthrowing foodfalling to the groundhit with a brickschool belltape measurechocolate milkreference to billie holidaygas pumpmiceshunningreference to gloria swansontheater productionrevealing the truthteacher's petwrapped in a blanketkissing someone's neckreference to gilbert and sullivanreference to lizzie bordenclipping toenailsdrama clubhit with a golf ballreference to christian diorunwanted personwashing a dead bodyblowing a raspberrydefecation slurdress designerhit on the head with a brickwhispering into someone's earlegs crossedlooking into a windowmatador costumetown gossip (See All) |
China, Later Tang Dynasty, 10th Century. On the eve of the Chong Yang Festival, golden flowers fill the Imperial Palace. The Emperor (Chow Yun Fat) returns unexpectedly with his second son, Prince Jai (Jay Chou). His pretext is to celebrate the holiday with his family, but given the chilled re …lations between the Emperor and the ailing Empress (Gong Li), this seems disingenuous. For many years, the Empress and Crown Prince Wan (Liu Ye), her stepson, have had an illicit liaison. Feeling trapped, Prince Wan dreams of escaping the palace with his secret love Chan (Li Man), the Imperial Doctor's daughter. Meanwhile, Prince Jai, the faithful son, grows worried over the Empress's health and her obsession with golden chrysanthemums. Could she be headed down an ominous path? The Emperor harbors equally clandestine plans; the Imperial Doctor (Ni Dahong) is the only one privy to his machinations. When the Emperor senses a looming threat, he relocates the doctor's family from the Palace to a remote area. While they are en route, mysterious assassins attack them. Chan and her mother, Jiang Shi (Chen Jin) are forced back to the palace. Their return sets off a tumultuous sequence of dark surprises. Amid the glamour and grandeur of the festival, ugly secrets are revealed. As the Imperial Family continues its elaborate charade in a palatial setting, thousands of golden armored warriors charge the palace. Who is behind this brutal rebellion? Where do Prince Jai's loyalties li… (Read More)
| Subgenre: | martial artsmelodramawuxia |
| Themes: | betrayalsuicideheroincestexecutionmadness |
| Locations: | china |
| Characters: | father son relationshipsoldierluststepmother stepson relationship |
| Story: | crown princeprincequeenkingfightbased on playswordsword fightmassacrehouseprincessbeaten to deathstabbed in the backpoisonninja …passionflowerfireworkspowerrebelbrother sister incestrebellionpalacelocal blockbustersecret societyemperorpoisoningfinal battleempirearcherplanmedical doctorbanquetfamily feudsecret lovefeastroyal familyembroideryswordplaycastawayempresscalligraphymarriage crisisaccidental incestbeating with a beltheir to the throne10th centuryroyal palacescheming wifetang dynasty7th centurychrysanthemumfather beating sonimperial chinaattempted murder by poisoningex wife new wife relationship (See All) |
In 1893, Gandhi is thrown off a South African train for being an Indian and traveling in a first class compartment. Gandhi realizes that the laws are biased against Indians and decides to start a non-violent protest campaign for the rights of all Indians in South Africa. After numerous arrests and t …he unwanted attention of the world, the government finally relents by recognizing rights for Indians, though not for the native blacks of South Africa. After this victory, Gandhi is invited back to India, where he is now considered something of a national hero. He is urged to take up the fight for India's independence from the British Empire. Gandhi agrees, and mounts a non-violent non-cooperation campaign of unprecedented scale, coordinating millions of Indians nationwide. There are some setbacks, such as violence against the protesters and Gandhi's occasional imprisonment. Nevertheless, the campaign generates great attention, and Britain faces intense public pressure. Too weak from World War II to continue enforcing its will in India, Britain finally grants India's independence. Indians celebrate this victory, but their troubles are far from over. Religious tensions between Hindus and Muslims erupt into nation-wide violence. Gandhi declares a hunger strike, saying he will not eat until the fighting stops. The fighting does stop eventually, but the country is divided. It is decided that the northwest area of India, and eastern part of India (current day Bangladesh), both places wh… (Read More)
| Subgenre: | epic |
| Themes: | racismmurdermarriagereligionpoliticsprisonfuneralherobrutalitypolice brutalityreligious intolerancereligious violence |
| Locations: | london englandtrainchurchdesertenglandindiatrain tunnel |
| Characters: | photographerpriestlawyertough guyreference to godchristianitymuslimdeath of hero |
| Period: | 1940sworld war two1930s19th century1920s1910s20th century1890s |
| Story: | riotprotestcharacter name in titleviolenceone word titletitle spoken by characterpistolbased on true storyshot to deathmachine gunhorsebattleswordarrestrifle …jailbritishcombatreporterassassinsword fightmassacrepoliticiannonlinear timelineman with glassestrialno opening creditsassassinationpolice officer killedopening action scenespeechglassesarsonheart attackelephantislamloss of wifemobrailway stationsouth africaindianconstruction siteministernewsreel footagepeacepiertragic herobonfiremain character diesprime ministersermonmigrationpakistanhinduindependencecricket the gamereference to albert einsteinpolitical prisonerbritish soldierbritish renaissancein medias ressaltmain character shotbaldpolitical activismsurname as titlehinduismsikhreference to mahatma gandhilabor strikefuneral pyrebolt action riflepacifistcivil disobediencefemale photographerbritish historybritish empireethnic conflicthunger strikepacifismpolitical oppressionsouth asianradio broadcastingfastinglarge format camerapolitical persecutioncremated remainsyear 1948tarmacbombay indiabritish militaryindependence movementbald herobritish colonialnew delhi indiaarmy vs civiliansends with funeralcalcutta indiaviceroyyear 1893indian historybritish indiageneral strikeamritsar india (See All) |
At the University of Wisconsin in Madison, Paige, a pre-med student and a farm girl from Manitowoc, meets Eddie, a fellow student from Denmark, whom she first dislikes but later accepts, likes, and loves. Paige takes Eddie to her home for the Thanksgiving weekend. Paparazzi find and photograph the c …ouple, and Paige learns that Eddie is truly Crown Prince Edvard. Failing health causes King Haraald to abdicate in favor of Edvard, so Eddie returns to Copenhagen, then Paige follows her heart to Copenhagen, where Edvard warmly welcomes her, takes her to the castle, and introduces her to the royal family. Queen Rosalind first expresses opposition to Paige but later relents; King Haraald soon warms to her; Edvard proposes, Paige accepts, and he gives her a ring. However, Paige recalls her previous dream of going to Doctors Without Borders, so she breaks off and returns to school. Still, though, Edvard shows up at Paige's graduation and suggests an alternate plan. (Read More)
| Subgenre: | melodramateen movie |
| Themes: | loveillness |
| Characters: | professoremployer employee relationship |
| Story: | princequeenkingf ratedtitle directed by femalecollegeroommateprincesslatex gloveslibrarycollege studentfarmeruniversitybodyguardreference to william shakespeare …class differencesstrong female characterroyaltydenmarkservantstrong female leadpicnicthanksgivingcar racetv commerciallaundromatpaparazzimedical studentexamreference to shakespeare's hamletopposites attractreference to shakespeare's romeo and julietvaulttabloidwisconsincollege lifecoronationmedical schoolcinderella storydairy farmdelicatessenreference to shakespeare's king learcrown jewelsfarmers daughterwealthy parent (See All) |
An affair between the second in line to Britain's throne and the princess of the feuding Irish spells doom for the young lovers.
| Subgenre: | tragedy |
| Themes: | betrayalmurderdeathrevengemarriageinfidelityrapeadulteryescapedanceweddingfuneralextramarital affairdeath of fatherbrutality …death of motherguiltunfaithfulnessrivalrygreeddeath of wifehuntingmurder of family (See All) |
| Mood: | rainnightmare |
| Locations: | beachchurchforestboatvillagewoodsseacastletunnelboat on fire |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboybrother sister relationshipgirlsoldierdancerpriestlove trianglewarriorlust |
| Story: | forbidden lovequeenkingdancingfemale nuditycharacter name in titlebloodmale nudityviolencebare chested malekissfightthree word titlefire …punctuation in titlewoman on topdreamhorseblondebattleswordliehand to hand combatrunningrivercombatdecapitationorphansword fightambushdisguisemontagemapsevered headprincessflash forwardlegendattackliarpoisonpassionrabbitbracelethangingdeath of husbandirelandlove interestkissing while having sexbare chested male bondagebattlefieldpowerchild murdertraitorbow and arrowwounddemonstrationhuntersevered handirishknighthonorback from the deadambitionstabbed in the throatkickingmercilessnesskicked in the crotchrowboatmedieval timescapturetribepassionate kissaxe murderkingdomdaggerhorseback ridinghistorical fictionbandagewar violencetowerblonde womansailboatcrownsword and sandaldisembodied headstar crossed loverstragic lovemilitary traininganguishman on firetrapdoorhorse and wagonrise and fallthroneblasphemydying wordscryptmedievalchantingstreet vendorantidotefeastaxe fightbattle axelong blonde hairlordflaming arrowbaronfuneral pyrecoronationruinhanged boypageantcornwallhand chopped offsword and shieldspit in facedrawbridgeelixirlong sworddark agesjoustingtreatythrown from a horseyorkpyrerebuildingplus sign in titlefuneral cortegeceltlutesaxonhuman in a cagebetrothaldeath of queenpuffer fish6th centurythought deadunderground passagewaybritanniaviking funeralsword woundburning a corpsenursing someone back to healthburned out houseroman ruin (See All) |
Cecil Gaines was a sharecropper's son who grew up in the 1920s as a domestic servant for the white family who casually destroyed his. Eventually striking out on his own, Cecil becomes a hotel valet of such efficiency and discreteness in the 1950s that he becomes a butler in the White House itself. T …here, Cecil would serve numerous US Presidents over the decades as a passive witness of history with the American Civil Rights Movement gaining momentum even as his family has troubles of its own. As his wife, Gloria, struggles with her addictions and his defiant eldest son, Louis, strives for a just world, Cecil must decide whether he should take action in his own way. (Read More)
| Subgenre: | revisionist history |
| Themes: | racismmarriagerapeprisonfuneraldeath of fatherdeath of wifeprejudicefreedom bus |
| Locations: | hotel |
| Characters: | father son relationshipafrican american |
| Period: | 1950s1980s1970s1960syear 2008year 1961 |
| Story: | riotprotesttwo word titlepartybased on true storyvoice over narrationcamerawomanhouseno opening creditsu.s. presidentpresidentdeath of sonwashington d.c.birthday cake …waiterbreaking and enteringrace relationsvietnam warwhite housecivil rightsbombingarchival footagebutleramerican presidentblack and whitetuxedoactivisminjusticereference to barack obamaman cryinghandshakemolotov cocktailgerman shepherdno title at beginningunited states of americaracial prejudicen wordapartheidsewing machineracial tensionku klux klanracial discriminationnashville tennesseesegregationcut handcivil rights movementkennedy assassinationtear on cheekmartinimultiple time framesreference to mahatma gandhibechdel test failedreference to martin luther king jr.grave side ceremonybirmingham alabamacaught in the rainholy biblepropaganda filmstartledracial violenceblack historyestranged sonrichard nixondrinking problemyear 1957stealing foodbased on newspaper articlereference to j. edgar hooverblack powerman wearing a tuxedoriding a busronald reaganblack panther partymilitary funeralplaying pokerwhite glovesdomestic servantblack panther2008 presidential electionprogressivismoil paintingdirty jokehungrylocked in jaillyndon johnsonreference to malcolm xafrican american historyburning crossjackie kennedyjimmy carterconstipationsit inyear 1926flag draped coffinmartin luther kingcotton fieldhome aquariumspitting in faceclothes hangerdrink thrown in facescaldedthe white house21 gun salutedrinking fountainfreedom riderreference to sidney poitierseeing father murderedsetting a tablebuglerlunch countermartin luther king assassinationbloody sundaylying on the floorstudent activistplate of cookiespresidential speechselma alabamabandaging a woundmacon georgiaportrait of george washingtonrace baiting (See All) |
Cathy is the perfect 50s housewife, living the perfect 50s life: healthy kids, successful husband, social prominence. Then one night she stumbles in on her husband Frank, kissing another man, and her tidy world starts spinning out of control. In her confusion and grief, she finds consolation in the …friendship of their African-American gardener, Raymond - a socially taboo relationship that leads to the further disintegration of life as she knew it. Despite Cathy and Frank's struggle to keep their marriage afloat, the reality of his homosexuality and her feelings for Raymond open a painful, if more honest, chapter in their lives. (Read More)
| Themes: | racismfriendshipmarriageinfidelitychristmasadulterydrunkennessseductionextramarital affairdivorceunfaithfulnessprejudicegay love |
| Mood: | neo noir |
| Locations: | bartrainswimming poolhotelbusnightclubpolice stationgay bar |
| Characters: | interracial relationshipfamily relationshipshusband wife relationshiphomosexualafrican americanbest friendgay kisshomosexualitypsychiatristmaidsecretarygay relationshipsingle fathergay father …homosexual father (See All) |
| Period: | 1950s |
| Story: | forbidden lovedancingsexcigarette smokingcryingsunglassestelephonebisexualdinerconfessionsuburbwidowerumbrellavacationchristmas tree …domestic violencefilm within a filmgay coupletherapypickup truckcloseted homosexualrace relationsloss of friendassaultmovie theatergossipgay parentswimsuitnew year's everailway stationart gallerybarefoothypocrisyhousewifemiami floridamakeupdiscriminationlipstickspyinghousekeeperfamily dinnerbigotrybriefcaseimpotenceunhappy marriageglovesphysicianintolerancedrunk drivinggardenerredheaded womanrumorhate crimeautumnretropondfirst gay sexual experiencescarforchestral music scoreart exhibitioncruisingbaltimore marylandsegregationbow tieflash cameraoverhead shotfedoramodern artcatastropheconnecticutadvertising executiveharpleafcocktail partygay husbandpaper airplaneart showfemales talking about sexmusic score features pianostoningconversion therapypostmoderndecolletageballet shoessymphonic music scoremislaid trustblack maidsexual problemsholiday resorthomemakerunhappily married womansame sex situationfarewell scenefemale sex talkmale slaps a femaleconneticutcrane shothartford connecticutkerchief (See All) |
The myth of King Arthur brought once again to the screen. Uthur Pendragon is given the mystical sword Excalibur by the wizard Merlin. At his death Uthur buries the sword into a stone, and the next man that can pull it out will be King of England. Years later Arthur, Uthur's bastard son draws Excalib …ur and becomes king. Guided by Merlin, Arthur marries Guenivere and gathers the Knights of the Round Table. Arthur's evil half-sister Morgana sires a son with him, who may prove his downfall. (Read More)
| Subgenre: | sword and sorcery |
| Themes: | deathfriendshipsurrealismmarriageinfidelityadulteryfearescapedeceptionmagicincestangerbrutalitysupernatural powerdying …falling in love (See All) |
| Mood: | affection |
| Locations: | forestwaterwoodslakecastlecave |
| Characters: | husband wife relationshipfriendlustwitchevil witchself injury |
| Story: | forbidden lovequeenkingfemale nuditynuditybloodmale nudityviolenceone word titlefemale frontal nuditymale rear nuditysex scenekissfemale rear nudity …fighttitle spoken by characterfirebased on bookbeatingcorpsehorseblondebattleswordbrawlhand to hand combatmale pubic haircombatsword fightold manaxemassacredisguisestabbingimpalementstabbed to deathstabbed in the chestsnakebrunettefictional wartransformationpublic nuditytreelegendmissiondragonpassionrabbithangingtragic eventdeath of husbandhorse ridingspearquesthelmetmagiciancovered in bloodknightwizardmedieval timesfogdead maneye gougingarmorsiegeattractionowlcrowspellhistorical fictionassumed identitydying manpatricidebleedinghanged manflamebloodshedmatricidemiddle agesbritish renaissancewhite dressrise and fallhalf brotherdying wordsweepinghalf sistermagical swordevil powerking arthurholy graildeath by impalementdeath of main characterkilled with a swordsword and shieldcamelotexcaliburarthurian legendattempted escapebloodstainmace the weaponround tablefighting with selfjoustknights of the round tablerape by deception6th centurysword in stone5th century (See All) |
A girl named Ella (Cinderella) has the purest heart living in a cruel world filled with evil stepsisters and an evil stepmother out to ruin Ella's life. Ella comes one with her pure heart when she meets the prince and dances her way to a better life with glass shoes, and a little help from her fairy … godmother, of course. (Read More)
| Subgenre: | fairy taledisneybased on fairy talelive action and animation |
| Themes: | betrayallovedancemagicdeath of fatherdeath of motherhopefalling in loveforgivenesshunting |
| Locations: | forestwoodsfrance |
| Characters: | father daughter relationshipmother daughter relationshipfemale protagonistsister sister relationshipfrenchfatherstepmother stepdaughter relationship |
| Period: | 17th century |
| Story: | princekingcharacter name in titleone word titledogtitle spoken by charactersingingpartyvoice over narrationhorseremakecatswordpaintingorphan …sword fightwidowprincesstransformationcharacter repeating someone else's dialoguerace against timegardeneuropedressroyaltymouseservantstrangerguardfairyfemale leadballensemble castattickingdomhorse and carriagemeetingpumpkinhorseback ridinghappy endingoppressionforename as titlelizardyoung version of characterbased on cartoonheld captivekindnessgoosecinderelladukeaudio flashbackcinderella storyfairy godmotherrider horse relationshipstepsister stepsister relationshipevil stepmothergirl horse relationshipbareback ridinglive action remakeretellingbased on adaptationlost shoefemale horse rideropening creditsglass slipperroyal balldance ballsecret gardenlive action adaptationmagical word (See All) |
The 25th Hour depicts the last day of freedom for a young man before he begins serving a seven-year jail term for drug dealing. Prowling through the city until dawn with his two close male friends and his girlfriend, he is forced to re-examine his life and how he got himself into his predicament, wh …ich leads to a shocking, disturbing finale. (Read More)
| Themes: | racismbetrayallovefriendshipsurrealismdrugsparanoiaguiltregret |
| Mood: | neo noir |
| Locations: | new york citybarbathtubnightclubdesertchinese restaurantsex in a bathtub |
| Characters: | interracial relationshipfather son relationshipboyfriend girlfriend relationshiptattooteacherhomosexualityteacher student relationshiprussian mafiatalking to oneself in a mirrorself reflection |
| Story: | interracial kissdancingbased on novelnumber in titleflashbackdogtwo word titlegunsex scenekissinterracial sexpartydreammirrorface slap …interrogationgay slurbasketballdrug dealernonlinear timelineorganized crimewidowerfantasy sequencechampagnefugitivesadnesshandgunkissing while having sexfreeze framejazzlooking at oneself in a mirrorragemonologueassaultcrushdrug dealingplaygroundanxietyone daytragic heroethnic slurreflectionsaving a lifehigh school teacherirish americanjazz musicanimal abusetoastecstasystatue of liberty new york citysofadistrustkiss on the cheekpost september 11 2001lolitascreenplay adapted by authorsnorricampreparatory schooldrug bustlong black hairambiguityprison sentencestockbrokerdog biteinternal monologuenew beginningground zeromirror does not reflect realitydolly zoomdrug enforcementconflicted herobathroom mirrorreference to montgomery cliftsecond thoughtsreflection in windowarab slurtube topreflection in glassdifferent face in mirrorlost in thought (See All) |
Shakespeare's classic tale of romance and tragedy. Two families of Verona, the Montagues and the Capulets, have been feuding with each other for years. Young Romeo Montague goes out with his friends to make trouble at a party the Capulets are hosting, but while there he spies the Capulet's daughter …Juliet, and falls hopelessly in love with her. She returns his affections, but they both know that their families will never allow them to follow their hearts. (Read More)
| Subgenre: | cult filmtragedy |
| Themes: | murderdeathlovefriendshiprevengesuicidemarriagedysfunctional family |
| Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipteenage girlteenage boycousin cousin relationship |
| Story: | banishmentexileforbidden lovecharacter name in titlemale nuditymale rear nuditybased on playswordbrawlsword fightdeath of frienddisarming someoneduelpoisonpassion …opening action sceneteen angstloss of virginitybuttocksfaked deathfeudyoung lovebalconysword dueldaggermain character diesswordsmanadolescencepoisoningteenage sexualitystreet fightobsessive lovepotionstar crossed loversfamous scoretragic loveteen suicidefamily feudsecret lovenobilityshakespeare's romeo and julietstory continued during end creditslying in bedclergyshakespeare playbrief female frontal nuditydoomed loverapierends with funeralnursemaidsecret from familypressure from fatherverona italybreasts covered by hair (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget …her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
| Subgenre: | coming of agesupernatural |
| Themes: | deathfriendshipartmagicangerdysfunctional familygriefchildhoodboy girl friendshipdeath of best friend |
| Locations: | churchforestwoodsrural settingfarmpolice carmuseumschool busschool teacherart museumschool bullynew girl in townschool friend |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendbrother sister relationshipteenage girlteenage boyteacherpolice officerstudentartist …best friendlittle girlbullylittle boyteacher student relationshipchildhood friendlove letterbest friendsblonde girlnew friend (See All) |
| Story: | queenkingdancingbased on noveldogphotographsingingthree word titlebased on bookpunched in the facewatching tvpaintingtearsplace name in titlerunning …birthdayclassroomdeath of friendbridgedrawingkeyfantasy sequenceproduct placementstorytellingdollpianisttragic eventbirthday cakeroperacelifting someone into the airloss of friendguitaristcrushcgirealityimaginationchild's point of viewpet dogbelief in goddeerswingkingdomatheistdead girlbirthday presentfemale teacheroutsidertween girlcrownsquirrelgreenhousefantasy worldblackboardtrollanguishrunnerchurch servicegrievingcreeknext door neighbororganistsocial outcastlifting a female into the airgirl next doornonconformityschoolyardfalling from a treelittle sisteranimal trapreference to leonardo da vincineglected childsketchbookbelief in hellpoor familyfemale bullyclubhousereality vs fantasysinging happy birthdaymake believeschoolboy crushtwo friendsfoot racetree houseanimate treeteacher crushreference to theodore rooseveltoff screen deathswinging on a ropemusic classtree swingsobbing femaleimaginary worldfear of hellrope swingrunning racedog as a giftcatching someone who fallsreference to teddy rooseveltknocked to the groundlost keysmuseum tripreference to pieter bruegelwooden bridgelog bridge (See All) |
The film serves as Garrone's English-language debut and will interweave three separate story strands bookended by brief bits in which Italians Alba Rohrwacher and Massimo Ceccherini will play a street circus family. In one tale Salma Hayek will play a jealous queen who forfeits her husband's life. I …n another, Vincent Cassel plays a king whose passion is stoked by two mysterious sisters. (Read More)
| Subgenre: | fairy talesword and sorceryadult fantasy |
| Themes: | murderdeathlovepregnancyunrequited love |
| Mood: | gore |
| Locations: | forestlakecastlecavesea monstercanyon |
| Characters: | mother son relationshipfather daughter relationshipgirlsister sister relationshipmotherwitchdaughtermysterious girlin love |
| Period: | 17th century |
| Story: | queenkingsexfemale nuditynuditybloodmale nudityviolencebare breastsbare chested malesex scenesinginglesbian kisstopless female nudity …woman on topsex in bedmenage a troisaxesevered headanthologytransformationflash forwardpublic nuditytreevirginbased on short storydragonhorse ridingneck breakingbeartwincircusapplausespearnipples visible through clothingtwinsfemale singercovered in bloodtorcharranged marriagefairyheartbeheadingwoman cryingwoodfall from heightscuba divinggraphic violencemagnifying glassthroat cutbaroquefuneral processionfingerogreplaying acoustic guitarskinwoman in laboralbinoskinned alivewild boarspying on couple having sexfire eaterspying on someonefleasouthern italythrown out a windowtwins separated at birthsedan chairpost punkbeating heartclimbing over a wallconjugal rapecutting a ropehorse drawn wagonwooden boxbreast feeding an adultimmaculate conceptiongold chainhigh wirewater springyouth restoreditalian literature (See All) |
Conquering 90% of the known world by the age of 25, Alexander the Great led his armies through 22,000 miles of sieges and conquests in just eight years. Coming out of tiny Macedonia (today part of Greece), Alexander led his armies against the mighty Persian Empire, drove west to Egypt, and finally m …ade his way east to India. This film will concentrate on those eight years of battles, as well as his relationship with his boyhood friend and battle mate, Hephaestion. Alexander died young, of illness, at 33. Alexander's conquests paved the way for the spread of Greek culture (facilitating the spread of Christianity centuries later), and removed many of the obstacles that might have prevented the expansion of the Roman Empire. In other words, the world we know today might never have been if not for Alexander's bloody, yet unifying, conquest. (Read More)
| Subgenre: | martial artscoming of ageconspiracytragedymelodramaepicchrist allegory |
| Themes: | betrayalmurderdeathfriendshiprevengemarriagejealousypoliticspregnancyfeardrunkennessescapedanceweddinghero …deceptionseductionangerdeath of fatherbrutalityparanoiadysfunctional familywrestlingfaithexecutioncouragephilosophynear death experiencegreek mythologyhomosexual love (See All) |
| Mood: | gorewedding nightgreek myth |
| Locations: | snowdesertcavejungleindiawalled city |
| Characters: | interracial relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorteachersoldierdancertough guywarrioraction herobest friendhomosexualityteacher student relationship …snipergay frienddeath of herohomosexual kissdancing girl (See All) |
| Story: | colonialismprincequeenkingdancingfemale nuditycharacter name in titlebloodmale nudityviolenceone word titlebare breastsfemale frontal nudityflashbackmale rear nudity …dogbare chested malefemale rear nudityfightfemale full frontal nuditytitle spoken by characterpartyknifesurprise endingfiretopless female nudityvoice over narrationcorpseshot to deathblood splatterfistfighthorseshot in the chestface slapshot in the headslow motion scenepunched in the facecatbattleswordarrestbrawlbare buttletterhand to hand combatbedhallucinationorgyrivercombatshot in the backsubjective cameradecapitationcleavagebisexualsword fightstrangulationaxemountainstabbingdeath of friendthroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapsnakenonlinear timelinesevered headno opening creditsanti heroscantily clad femaleassassinationdouble crossritualspankingfemme fataleshot in the legprincesstrainingflash forwardattempted murdertreelegendargumentstabbed in the backpoisoncharacter's point of view camera shotstatuetentlightningopening action sceneringshot in the shouldercourtmanipulationscargiftloss of fatherthreatened with a knifesevered armshot in the armgeneralbeardismembermentmonkeybattlefieldtraitordestinyloyaltybow and arrowrevelationwhat happened to epiloguespearassassination attemptnipples visible through clothingelectronic music scoreheavy rainhelmetslaveryroyaltytold in flashbackelephantloss of loved onedysfunctional marriageblockbusterservantparadehonortorchfateanimal attackcrushed to deathambitionindianslavefull moonshieldvisionbraveryinvasionstabbed in the throathatredstabbed in the neckshot in the facegreecestabbed in the headthunderstormstabbed in the legdeath of protagonistdark heroliondisembowelmentaerial shotrainstormtigertribestabbed in the eyepassionate kisskingdomtragic herosevered legarrowparrotmain character diespalacedrugged drinkcamelblood on camera lensbisexualityforename as titlegreekshot in the neckwar herometaphorwar violencesex slaveeuthanasiatreasonlost loveshot with an arrowyoung version of characterarcherycrownidealismstabbed in the armemperorpsychedelichead bashed inwetting pantsmercy killingshamanarenaleadereaglesword and sandalstabbed in the shoulderfinal battleshot in the throathistorianarcherspastabbed in the facedeath of title characterdistrustharemspitting bloodwarlordheroic bloodshedsorceresscavalryflashback within a flashbacksnake bitephilosopherancient egyptanimal killingbanquetassassination plotrainforestknife held to throatepic battleends with textretreatclothes rippingdutch anglescrollbird cageleadershipancient greecememoirmutinystabbed in the footjugglerone eyed manstruck by lightningbody armoreunuchcouncilbad motherpantherscreaming in painreference to aristotleoutnumberedoedipus complexantiquityhusband wife estrangementspear throwingjungle warfareconquestanimal sacrificeentrailsherculeschariotfilm starts with quotewar woundpersiastabbed through the chestzeusbloody sprayfire eatercave paintingtrippyends with historical notesmeleemacedonia25 year oldalchemistguerrilla warfarecavalry chargehadessurroundedpoisoned drinktemptresstitanthrown from a horsetunicathenaancient worldblack panthercriminal trialapollocave drawingfield hospitalnile riversnake charmerbabylonreference to zeusalexandria egyptjourney shown on mapmonsoonanti arabharnesssuccessordereliction of dutypiketroyafrican lionscribeherbal medicinereference to oedipusshot through the chestalexander the greatbabylon babyloniapersian catreference to achillesmedeaconquerorman boy loveinspirational speechcity stateprometheusreference to aphroditebattle cryreference to prometheusexecuting the woundedone eyed characterriding at a gallopfalse colorpolitical marriageroman salutebattle tactic (See All) |
Against the backdrop of aged has-been rock star Billy Mack's Christmas themed comeback cover of "Love Is All Around" which he knows is crap and makes no bones about it much to his manager Joe's chagrin as he promotes the record, several interrelated stories about romantic love and the obstacles to h …appiness through love for Londoners are presented in the five weeks preceding Christmas. Daniel's wife has just passed away, leaving him to take care of his adolescent stepson Sam by himself. Daniel is uncertain how to deal with Sam and his problems without his wife present, especially in light of a potential budding romance within their household. Juliet and Peter have just gotten married. They believe that Peter's best friend and best man Mark hates Juliet but won't say so to his or her face. Others looking at the situation from the outside believe Mark is jealous of Juliet as he is in love with Peter himself. Jamie, a writer, is taking a writing retreat by himself in rural France following catching his latest girlfriend in an indiscretion. Jamie ends up spending much time in France with Aurelia, the Portuguese woman hired as the housekeeper. The question becomes not only if they can communicate their day-to-day needs with each other as she speaks no English, he speaks no Portuguese, and neither speaks French well, but communicate what seems to be their increasing mutual attraction to each other. Sarah has been in love with her co-worker Karl for the two years they have worked to… (Read More)
| Subgenre: | music videocult filmmelodrama |
| Themes: | betrayalfriendshipmarriageinfidelitychristmaspoliticsadulterydrinkingweddingfuneralfilmmakingextramarital affairtravellonelinessdeath of mother …paranoiadrug useunfaithfulnessillnessmental illnessunrequited lovedeath of wifefirst love (See All) |
| Mood: | satirerain |
| Locations: | london englandbarrestaurantchurchmotorcycleairportenglandfranceoffice |
| Characters: | interracial relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipbrother sister relationshipmusicianactorwriter …christianactresswaitresslustsecretaryfrenchemployer employee relationshipuncle nephew relationshipamerican abroaduncle niece relationshipaunt niece relationshipbrother in law sister in law relationshipstepfather stepson relationshipamerican in the ukfather christmas (See All) |
| Period: | winterchristmas party |
| Story: | interracial marriageinterracial kissmarriage proposaldancingfemale nuditymale nudityfemale frontal nudityinterviewmale rear nuditytwo word titlebare chested malesex scenekiss …female rear nudityphotographtitle spoken by characterpartyleg spreadingpantiestelephone callvoice over narrationcryingcell phonewoman on topunderwearcar accidentblondecomputerdrinkcondomundressingsex in bedpaintingtearslingerievoyeurreference to jesus christguitarcleavagefoot chasebandmontagewidowpoliticianscantily clad femalecoffinpublic nuditycostumewidowerproduct placementdollchristmas treeu.s. presidentscene during end creditsamerican flagbodyguardpresidentfemale removes her clothessplit screencharacter says i love youloss of motherreference to william shakespearetypewritereuropesubtitled sceneholidaytransvestitewaiterteabeer drinkingrecordingred dresscooksex on floorloss of wifedysfunctional marriageblockbusterpress conferencecrushart galleryrock starorchestrapreacherwatching televisionmale prostitutecameobreakupministermovie setlove at first sightensemble castmakeupchristmas evefilm setchoirred pantieshousekeeperrecording studiomarital problemwedding receptionmelancholyseparationdrumsprime ministerenglishman abroaddjmental patientmultiple storylinedirector cameopublisherfluteblue pantiesreference to the beatlessimulated sexunited kingdomdepartment storelanguage barriersaxophonecellodisappointmentepilogueradio showcleaning ladyhorninesstrumpetwoman in lingeriepsychiatric hospitalmanuscriptmetal detectorbriton abroadtv interviewlobsterorganpost september 11 2001wisconsinschool playbromancechristmas decorationschristmas giftpersonal assistantreference to harry potterensemble filmreference to winston churchilltravelermatchmakingtransportationpendantmatchmakerinterviewerportuguesestore clerkreference to brad pittdevil costumenational anthemreference to britney spearslanguage learningchalkboardeelchristmas songagonyairport securityoffice romancetalking during sexamerican womanart studiomilwaukee wisconsinmobilesecret admirermistletoetrombonecatererreference to leonardo dicaprioimplied fellatiomusic manageroverweight manpulpitwedding videoradio announcerred lingeriebritish prime ministerdrum setchristmas cardcheating on one's boyfriendrekindled romanceromantic kissexpensive giftchristmas pageantswimming in a lakenottingham englandreference to ringo starrtv show within a filmradio studioreference to david beckhamreference to joni mitchellchristmas shoppingpapier machenativity playimitating fellatiomob of photographersnokiareunited with familysex interrupted by telephonespeaking with accentreference to jon bon jovistand ingoodnight kissmarseilles franceschool pageantaging rockerreference to kate winsletself preservationchristmas carolinglobster costumeoctopus costumepastry boxreference to dunkin' donutsreference to prince williamheathrow airport londonkellogg's frosted flakeslight meterportuguese womanreference to claudia schifferreference to the bay city rollerssoftcore porn filmmakingv for victory hand gesture (See All) |
After being captured by Turks during the Crusades, Robin of Locksley and a Moor, Azeem, escape back to England, where Azeem vows to remain until he repays Robin for saving his life. Meanwhile, Robin's father, a nobleman loyal to King Richard the Lionhearted, has been murdered by the brutal Sheriff o …f Nottingham, who helped install Richard's treacherous brother, Prince John, as king while Richard is overseas fighting the Crusades. When Robin returns home, he vows to avenge his father's death and restore Richard to the throne. Even though Maid Marian, his childhood friend, cannot help him, he escapes to the Forest of Sherwood where he joins a band of exiled villagers and becomes their leader. With their help he attempts to cleanse the land of the evil that the Sheriff has spread. (Read More)
| Subgenre: | sword and sorceryswashbuckler |
| Themes: | murderfriendshippregnancytortureweddingmagicrobberytheftcourageprison escapemurder of father |
| Mood: | poetic justice |
| Locations: | forestvillageenglandcastle |
| Characters: | singerbabypriestthiefwarrioraction herowitchcousin cousin relationshippregnant wifepoaching |
| Story: | princechildbirthkingfemale nuditymale nuditymale rear nuditydogexplosionknifeshowerfirefistfighthorseshot in the chestface slap …shot in the headrescueswordbare buttfalling from heightlettershowdownhand to hand combatrivercombatshot in the backgood versus evilcleavagesword fightambushstabbingstabbed to deathstabbed in the chestdisarming someonedueldangerperson on fireattackpassionstatuekicked in the faceattempted rapedeath of brotherloss of fatherarsonbattlefieldgoldbow and arrowstabbed in the stomachrebelknighttorchguardcrossbowhit in the crotchrowboatstabbed in the legmedieval timesoutlawknife throwingraidsiegesword duelarrowdaggerstick fighthorseback ridingswordsmanwedding ceremonypeasantrobberbreadshot with an arrowjerusalemarcheryhideoutadventure herofalling into watercrashing through a windowfriends who live togethersword and sandalbarbarianarchermiddle ageenglishmanfacial scaroutlaw gangmiddle agesbutt slapwriting a letterman on fireforced marriagemasshalf brothershot with a bow and arrowhorse chasemedallionbattle axecousinflaming arrowenglishwomanfall to deathkrav magawhite horsestained glass windowdevil worshipinterrupted weddinggunpowderstabbed with a swordmelonstabbed in the heartwind chimereturn homecatholic masskilled with a swordagainst the oddsballadeermistletoecrusadesking of englandsitting in a treesword and shieldfacial cutdeath of cousincorrupt priest12th centuryman murders a womanface woundfacial injurykneed in the crotchstabbed with a spearpublic hangingsaved from hangingspitting in someone's faceblack horseblood oathmoorsthrown out a windowfriarkilled with an arrownottingham englandhorseback chasehot candle waxriver battlemass hangingscars on backhiding in a treeantlerhit with a stickholding one's hand over someone's mouthvow of revengewoman slaps a womancut on faceoutdoor weddingdeer antlersplantagenetheld at sword pointswordsmanship1100senglish nobilityinability to swimquarterstaffreference to the prodigal sonvillage set on firepushed through a windowcan't swimcutting the palm of one's handdrum rollface scarsword held to throatunable to swim1190sband of outlawsexploding barrelfather's gravemurder of cousinstolen horsedagger held to throatlife debtscimitarsherwood forestchildbirth complicationking richard ioutlaw hideoutstabbed with a dagger (See All) |
Birth of a legend. Following King Richard's death in France, archer Robin Longstride, along with Will Scarlett, Alan-a-Dale and Little John, returns to England. They encounter the dying Robert of Locksley, whose party was ambushed by treacherous Godfrey, who hopes to facilitate a French invasion of …England. Robin promises the dying knight he will return his sword to his father Walter in Nottingham. Here Walter encourages him to impersonate the dead man to prevent his land being confiscated by the crown, and he finds himself with Marian, a ready-made wife. Hoping to stir baronial opposition to weak King John and allow an easy French take-over, Godfrey worms his way into the king's service as Earl Marshal of England and brutally invades towns under the pretext of collecting Royal taxes. Can Robin navigate the politics of barons, royals, traitors, and the French? (Read More)
| Subgenre: | epic |
| Themes: | murderdeathrevengepoliticsfuneralgamblingblindness |
| Mood: | rain |
| Locations: | london englandbeachchurchforestvillageenglandfranceshipcastle |
| Characters: | mother son relationshipsoldiertough guywarrioraction herosheriffyounger version of characterfrench girl |
| Story: | crown princequeenkingdancingcharacter name in titlebloodviolenceflashbackmale rear nuditydogtwo word titlebare chested malekissexplosionsinging …surprise endingfirevoice over narrationshot to deathblood splatterfistfighthorseshot in the chestface slapshot in the headslow motion scenepunched in the facebattleswordbrawlfalling from heighthand to hand combatcombatshot in the backdecapitationsword fightambushaxearmyimpalementstabbed to deathstabbed in the chestmapno opening creditsdisarming someoneshot in the legstabbed in the backperson on firekicked in the facetough girlringattempted rapedeath of brotherdeath of sondeath of husbandcharacter says i love youkissing while having sexsubtitled scenebattlefieldtraitorfireplaceloyaltybow and arrowburned alivehead buttcaught having sexkicked in the stomachknighttorchcrushed to deathbald manshieldinvasioncrossbowchaosshot in the facerowboatmedieval timesoutlawtitle at the endsiegeblind mansword duelarrowowldaggerstick fightprequelpalacehorseback ridinginterrupted sexswordsmanshot in the neckwar violencereading aloudbeeshot with an arrowcrownadventure herodomineering motherfilm starts with textshot in the throatarcherenglishmanfacial scarfrenchmanoverbearing motherwoman slaps a manunwanted kissstaffdying wordsscottish accentfather in law daughter in law relationshipfather in lawpoacherbegins with textaxe fightscotsmanflaming arrowenglishwomanfuneral pyreoystershot in the sidewhite horsestabbed with a swordenglish subtitles in originalfrenchwomanwelshmanbritish royaltyproduced by actortaxkilled with a swordsign of the crossdaughter in lawking of englandmurdered priestsword and shieldbeekeeperends with narrationgrainsham marriagemother son conflictblind personferal childcrusade12th centuryface woundfacial injuryking of francechain mailbill of rightsdragged by a horsefriarkilled with an arrowmother slaps sonnottingham englandposing as husband and wifebody odorirish wolfhoundaxe in the backburning a documentelbowed in faceshell gamespoiled sonthrowing water on someoneinscriptiondeath of father in lawfemale slaps a malepretending to be marriedenglish nobilityreference to the prodigal sonface scar1190sarrow through neckdeath of a kingassuming identity of a dead personblind person reads a facedonkey cartking richard iprince johnstabbed with a daggertrampled by a horseunpaid taxes (See All) |
Edward De Vere, Earl of Oxford, is presented as the real author of Shakespeare's works. Edward's life is followed through flashbacks from a young child, through to the end of his life. He is portrayed as a child prodigy who writes and performs A Midsummer Night's Dream for a young Elizabeth I. A ser …ies of events sees his plays being performed by a frontman, Shakespeare. (Read More)
| Subgenre: | conspiracy theory |
| Themes: | betrayalmurderdeathlovemarriagemoneyghostpoliticsprisonpregnancydrinkingtorturedrunkennessweddingincest …death of fatherblackmailpoetryexecutiontheatrefreedomwritinginheritance (See All) |
| Mood: | rain |
| Locations: | london englandnew york citysnowboatitalyenglandcastlespain |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerboyprostitutegirldancermusicianactorwriteractressreference to godcatholic …frenchyounger version of character (See All) |
| Period: | 16th century |
| Story: | banishmentqueenkingdancingnuditymale nudityone word titleflashbackdogbare chested malesex scenekisssingingchasefire …voice over narrationcryingsonghorsemirrorface slapdrinkswordarrestbare buttshootingbookdead bodyjailprayermanhattan new york cityshot in the backcandleambushstrangulationmassacrestabbingbridgecontroversypainflash forwardauthorprologueumbrellatentcover uppursuitcrossirelandflowerpoetfireworksreference to william shakespearekissing while having sexarsonchessitalianapplausetraitorlooking at oneself in a mirrorlifting someone into the airroyaltyjail cellhidingfraudservantaudiencerebelliontorchpicniccannondwarfthundermourningintriguebackstageliteraturerowboatstabbed in the legrosewedding ringcaneplayhorse and carriagemother son incestdaggerhorseback ridingbriberybag of moneybeheadinggreekmetaphortreasonplagueabandonmentcrownplaywrightwhisperingfencinggiving a toastchandelierepilogueilliteracywalesbritish soldierbroadway manhattan new york citymusketbettingreference to shakespeare's hamletreference to shakespeare's romeo and julietexposeflashback within a flashbackleg woundspotlighthunchbackillegitimate sonprotestantscotsmannoblemanmessengerbreaking down a doorcoronationinkfilicidereference to platoincestuous sexprinting pressexecutionerpublishingreference to shakespeare's macbethpolitical unrestpolitical intrigueimplied incestbritish royaltyshakespeare playheresycaricatureaccidental incestbadmintonrhymeanonymitypuritanqueen elizabeth iamnestybooingtheatre boxsonnettower of londonelizabethan eraalegoblettudorreference to shakespeare's a midsummer night's dreamreference to shakespeare's julius caesarreference to shakespeare's twelfth nightline of successionreference to shakespeare's richard iiitolling bellbookend scenescoat of armshandheld mirrorreference to homerdeath of queenquill penmother murders sonseditionreference to shakespeare's henry vflashback within a flashback within a flashbackhissinglondon skylineking philip ii of spainreference to christopher marlowereference to mary queen of scotsreference to venus the roman goddessstratford upon avonsuccession to the throneassassination threatprivy council (See All) |
After many years of sleeping in his coffin, the vampire Lestat awakens only to find that the world has changed and he wants to be a part of it. He gathers a following and becomes a rock star only to find that his music awakens the ancient Queen Akasha and she wants him to become her king...
| Subgenre: | music videomartial artssupernatural |
| Themes: | murderdeathrevengelonelinesssupernatural power |
| Mood: | night |
| Locations: | london englandcemeterylos angeles californianightclubairportengland |
| Characters: | singervampirekillermother |
| Story: | queenkingbased on novelbloodsequelflashbackfirevoice over narrationdreamblood splatterwatching tvpaintinghand to hand combatislanddecapitation …concertcaliforniathroat slittingrock bandsevered headfemme fataleperson on firestatueevil manskeletondiaryrock 'n' rollneck breakingmurdererundeadburned alivegothicfamemagazinemediapress conferencesadomasochismviolinrock starreverse footagerock concertnew orleans louisianaimmortalityhomoeroticismkilling spreeburned to deathtelekinesisviolinistgothreference to elvis presleyliving deadlevitationsecret societyfemale vampireredheaded womanpredatorhollywood signbitten in the necktitle in titleevil womanpart computer animationfatal attractionbloodshedvampirismhomosexual subtextgroupieheart in handcryptfetishismblood drinkingsecret organizationegyptiansecret passagewayslide projectorbloody mouthmediterraneanturned to stonemisanthropestardomstar died before releasefanshuman preycold blooded murdercovenvampire human loveevil queenparanormal investigatorpreymisanthropygingercold blooded killerspeciesismdeath valleyinhumanity1780sspeciesmojave desertspontaneous combustioninterspecies romanceblood drainingpredator turns victimrolling stone magazinehunting peoplerose petalevil versus evilsuperiority complexepiscopaliankiller vs killersupremacyreading magazinepredator chases prey (See All) |
A rich and successful lawyer, the Counselor, is about to get married to his fiancee but soon becomes entangled in a complex drug plot with a middle-man known as Westray. The plan ends up taking a horrible twist and he must protect himself and his soon to be bride as the truth of the drug business is … uncovered and targets are eliminated. (Read More)
| Themes: | murderdeathkidnappingprisongriefpoetrygreedphilosophy |
| Mood: | neo noircar chase |
| Locations: | london englandbarrestaurantchurchnightclubdesertchicago illinoismexico |
| Characters: | interracial relationshippriestlawyeramerican abroad |
| Story: | interracial kissmarriage proposalcharacter name in titlebloodflashbackbare chested malesex scenefingeringpartypistolshootoutcorpseshot to deathblood splatter …shot in the headslow motion scenedecapitationmansioncocainesevered headfemme fataleshot in the legshot in the foreheadconfessionbinocularscharacter repeating someone else's dialoguehorse ridingcharacter says i love youuzino pantiesscene during opening creditsred dresscowboy hatbikerdiamondsevered fingerarizonablack eyelens flareimpersonating a police officermarijuana jointblood on camera lensdrug smugglingcatholicismamsterdam netherlandsdrug traffickingnihilismman punching a womansnuff filmprison visitwoman in a bikinidrug cartelferrariman with no nameu.s. mexico bordernameless characterdiamond ringshot in the buttcheetahfatalismjuarezel paso texasrazor wireexotic pet (See All) |
In the early 1970s, Nicholas Garrigan, a young semi-idealistic Scottish doctor, comes to Uganda to assist in a rural hospital. Once there, he soon meets up with the new President, Idi Amin, who promises a golden age for the African nation. Garrigan hits it off immediately with the rabid Scotland fan …, who soon offers him a senior position in the national health department and becomes one of Amin's closest advisers. However as the years pass, Garrigan cannot help but notice Amin's increasingly erratic behavior that grows beyond a legitimate fear of assassination into a murderous insanity that is driving Uganda into bloody ruin. Realizing his dire situation with the lunatic leader unwilling to let him go home, Garrigan must make some crucial decisions that could mean his death if the despot finds out. (Read More)
| Themes: | racismbetrayalmurderdeathfriendshipmarriageinfidelitypoliticsadulterypregnancytorturedrunkennessextramarital affaircorruptionterrorism …unfaithfulnessexecutionabortionphilosophymadness (See All) |
| Mood: | rain |
| Locations: | africahospitalswimming poolairplanebusnightclubairportvillage |
| Characters: | interracial relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfrienddoctorchildrensingersoldierphotographerhostageasianwitch doctor |
| Period: | 1970s |
| Story: | kingdancingsexfemale nuditybloodmale nudityviolenceflashbackmale frontal nuditymale rear nuditybare chested maleguncigarette smokinginterracial sex …photographtitle spoken by characterexplosionpartypistoltelephone callbased on booksongbeatingdreamshot to deathunderwearfoodmachine guncar accidentshot in the chesturinationshot in the headpunched in the facecameraundressingbare buttshootingbeerdead bodysex standing upmale pubic hairshot in the backswimmingsoccerjournalistambusheatingarmyassassinationhit by a carshot in the foreheadgunshotattempted murderlimousinemicrophoneprologuescreamingpoisonbaseball batspeechinjectiongovernmentsevered armgeneraldismembermentsyringekilling an animalspearmass murderhypodermic needlejeepmorguearchitectpress conferenceflatulenceswimsuitgenocidepassportpillsinvasionscotlandkickingdrummermedical examinationfamily dinnerdictatorphysical abusepalacet shirtdictatorshipvillain played by lead actorgirl in bra and pantiesgraduationhindunaivetyidealismx raydrumtoastisraeliatrocityseizurefather son estrangementpolygamysick childdistrustcoup d'etatmass gravetailordiplomatepilepsyphilosopherglobescottishdrinking alcoholscotaustrianhand injuryugandafemale in bra and pantieskiltconvulsionransackingpeacocksparringdrummingpolice stateforbidden sexmurder of a pregnant womanaspirinman and woman in bedswahilimutilated bodyarchitectural modelpharmaceuticalsgrottovaccinationfoolishnessbritish governmentugandanairplane hijackingpenicillincivil engineerwatching a porno moviehead of stateattempted poisoningdeath of expectant motherswim racevomit sceneholiday innkampalaconcertinaerotic dancerforeign ministerhung by a hookidi aminentebbe ugandasexual compulsionisraeli governmentpresidential palace (See All) |
Julie and Jason have been best friends for years with no romantic interest in each other. He sleeps with someone new every few days, and she's looking for Mr. Right. Now in their thirties, they notice that their friends seem to lose all their good qualities when they have children - child rearing an …d the spark of Eros don't seem to co-exist. So, they decide to have a child together, share in child rearing, but pursue their own romantic lives. Things go well until he meets Mary Jane and she meets Kurt. Both seem like perfect mates. What could go wrong? (Read More)
| Themes: | friendshipjealousypregnancydrunkennessdivorcedatingbreak up |
| Mood: | moving |
| Locations: | hospitalnew york citybarrestaurantsnowelevator |
| Characters: | interracial relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipchildrendancerbabybest friendlittle boychinese foodbaby boy |
| Story: | interracial marriagechildbirthf rateddogkisstelephone callcryingcell phonetitle directed by femaleurinationbirthdaybedroomnew yorksubwaydinner …written and directed by cast memberchristmas treecabingrandmotherbirthday cakehugginggamegroup of friendsnew year's evebrooklyn new york citybootsskiingthirty somethingbrushing teethpajamasnannyphoto albumatheistbirthday presentbreast feedingloud sexgiving a toastsnowboardingbiracialhappy birthday to youreference to george w. bushdiarrheapackingoverhearing sexmoving outtoddlerchild swearingtantrumsledvermontgolden retrieverwoman in laborbiracial childcuddlingbaby monitorlistening to sextemper tantrumunconventionalchristmas cardfailed marriageski triplife coachfriends with benefitsbiological clockquichetwo year oldco parentinginterviewing a nanny (See All) |
This rock opera tells the story of one year in the life of a group of bohemians struggling in modern day East Village New York. The story centers around Mark and Roger, two roommates. While a former tragedy has made Roger numb to life, Mark tries to capture it through his attempts to make a film. In … the year that follows, the group deals with love, loss, AIDS, and modern day life in one truly powerful story. (Read More)
| Subgenre: | black comedyepicdocumentary filmmaking |
| Themes: | deathfriendshipdrugschristmasdrinkingfeardrunkennessfuneralartrobberytheftpovertyparanoiadrug useyouth …exploitationbreak updyinghomelessnessaidsdrug addictionphilosophyregretstarvationgay lovegay marriage (See All) |
| Mood: | rainnightmare |
| Locations: | hospitalnew york citybarrestaurantsnowmotorcyclecemeterybicyclerooftopnew mexicofire escape |
| Characters: | interracial relationshiphusband wife relationshiphomosexualpolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipsingerteacherpolicemandancer …musicianlawyerthiefhomosexualityjewfilmmakergay relationshiplesbian relationshipboyfriend boyfriend relationshipfather in law son in law relationshipbar mitzvahhomosexual kiss (See All) |
| Period: | 1980s1990syear 1989year 1990 |
| Story: | interracial kissriotprotestdancingf ratedfemale nuditynuditybloodone word titlemasturbationdogkissfemale rear nudityfight …cigarette smokingphotographtitle spoken by charactersinginglesbian kisstelephone callfirecryingsongbeatingfooddrinkbare butttearscafemarijuananeighborhandcuffsreference to jesus christguitarmanhattan new york cityhalloweenbisexualwinecandlevideo cameradrug dealermontageeatingcocainesubwayman with glassescoffinroommategraveyarddrug addictmicrophonekeypay phonechampagnemissing personflowersinjectiondategay couplecross dressinggraffiticowheroinpowermoontransvestiteeyeglassestv newswaiteranswering machineteadrag queenbreaking and enteringhypodermic needledemonstrationloss of loved onedrug abusenew year's everebellionhome moviemilkcelebrationpromiseinterracial romancemourningspanishjob interviewpool tablehungerjunkiechristmas evebalconysongwritersnowingmale male kisspassionate kisssodomytangoworld trade center manhattan new york citylandlordneighborhoodpromiscuityvodkafemale female kissalleyevictionstairwaybeggarwallethuman immunodeficiency virusgroup therapyrabbifilm cameradrug dealdenialanarchygay romancecoughingmooningtransvestismmuggingfevermarriage engagementpawnshopfirst gay sexual experienceinterracial couplecross dresserreference to james bondpole dancersupport groupbegginggarbage canhuman immunodeficiency virus positivecommitmentrentspotlightsquattercamera focus on female buttdignitybulldoggirlfriend girlfriend relationshipchristmas decorationsdocumentary filmmakerbroken engagementhiv positiveperformance artistautomated teller machinesaying goodbyefreezingcondominiumpulitzer prize sourcecat costumepierced nippledrug withdrawalbased on stage musicalcountry clubshooting upsparklerbrokememorial servicenursery rhymeschool expulsionbenefactornew york universityskylighttenementlower east side manhattan new york citydrug rehabartist's studioglorytitle sung by charactereviction noticebongo drumcommunity centermusic clubsanta fe new mexicodrumsticksradio city music hall manhattan new york cityemotional healingrange roverreference to akira kurosawareference to spike leeman wearing woman's clothingnew year's resolutionstreet riotliving on the streetreference to lenny brucetent citysmack the drugaztdiet cokeerotic dancerreference to martin heideggersound equipmentla bohememissing person flyerapartment evictionwhite lightplastic bucketlife partnerm.i.t.scarsdale new yorksteel barrel (See All) |
Set in the year 1999 during the last days of the old millennium, the movie tells the story of Lenny Nero, an ex-cop who now deals with data-discs containing recorded memories and emotions. One day he receives a disc which contains the memories of a murderer killing a prostitute. Lenny investigates a …nd is pulled deeper and deeper in a whirl of blackmail, murder and rape. Will he survive and solve the case? (Read More)
| Subgenre: | martial artscult filmconspiracydystopiavideocyberpunktech noir |
| Themes: | racismbetrayalmurderdeathrevengesurrealismsuiciderapechristmasdeceptionmilitarymemoryrobberycorruptionpsychopath …paranoiasurveillancepolice brutality (See All) |
| Mood: | rainneo noircar chasehip hop |
| Locations: | barbeachrestauranttrainchurchswimming poolhotelhelicoptermotorcyclelos angeles californianightclubelevatorkitchenapartmentrooftop |
| Characters: | interracial relationshippolicemother son relationshipprostitutesoldierpolice violence |
| Period: | 1990sfutureyear 1999 |
| Story: | interracial kissriotsexfemale nuditybloodviolencefemale frontal nudityflashbackdogtwo word titlefightcigarette smoking …explosionpartyknifechasesurprise endingpantiespistolfirecell phoneshootouttitle directed by femalebeatingcorpseshot to deathblood splatterfistfightmachine gunmirrorshot in the chestface slapshot in the headshotgunpunched in the facecomputerbrawlthongfalling from heightvomitingshowdownheld at gunpointhand to hand combatbathroomprostitutionhandcuffsrevolversciencetelevisionshot in the backfoot chaseflashlightstrangulationsubwayexploding carno opening creditsdisarming someonedouble crossunderwater scenepolice officer killedfemme fatalenews reportshot in the foreheadlatex glovesracial slurlimousineblack pantiesstabbed in the backelectrocutionpay phoneundercoverproduct placementtankopening action sceneshot in the shoulderlong takewigsemiautomatic pistolblindfoldsilencerfireworkscorrupt copstrong female charactersexual fantasyprivate detectiverockmass murdersecurity cameracrucifixvillainessvideotapeswat teamvirtual realitynew year's everapistinterracial friendshippump action shotguninterracial romanceswitchbladetelescopechaosblood on shirtbulletproof vestbody landing on a cargasolinehustlerberettaex coptasergun in mouthspiral staircaselizardflarehate crimesnuff filmcorrupt policeshot through the mouthcar set on firewoman fights a manmimedirty copbagpipescocaine snortingman hits a womanbreaking a bottle over someone's headrock singerrevolving doorpolice commissionermacedriver's licensejumping from a rooftopcrotch shothit with a chairwhite male black female relationshipmusic producercompact disckicked in the chestfirst personrap starracial violencelock pickrollerblading8 trackchoked to deathkiller coppanties slipend of the millenniumcolor blindnesspsycho copsousveillancekiller wearing a ski masknew year's eve show (See All) |
Paris is starving, but the King of France is more interested in money and bedding women. When a young soldier dies for the sake of a shag, Aramis, Athos and Porthos band together with a plan to replace the king. Unknown to many, there is a 2nd king, a twin, hidden at birth, then imprisoned for 6 yea …rs behind an iron mask. All that remains now is D'Artagnan, will he stand against his long time friends, or do what is best for his country? (Read More)
| Subgenre: | conspiracyperiod dramaswashbucklercostume drama |
| Themes: | deathsuicideprisonescapefuneralseductionangerdeath of fathergriefabductionself sacrificeprison escapestarvation |
| Locations: | churchparis francefranceprison fight |
| Characters: | father son relationshipmother son relationshipfriendbrother brother relationshippriestsuicide by hanging |
| Period: | 17th century |
| Story: | riotqueenkingdancingbased on novelnuditymale nudityviolenceflashbackmale rear nuditytitle spoken by characterknifesurprise endinghorseremake …punched in the facebattleswordbrawlsex in bedsecretmasklettershootingtearsprayerrivergood versus evilbound and gaggedcandlesword fightprisonerforeign language adaptationvoice overnecklaceduelconfessiongravekeyactor playing multiple rolesevil manscreamringwigdeath of sonpigloss of fatherbrothersuspicionsix word titletwinlove interestkissing while having sexeuroperedheadpowermoonfireplaceloyaltyassassination attemptroyaltybarnloss of friendbuttocksflatulencegaggedtorchorchestracannonguardshieldattempted suicideloss of sonrowboatfather figureaccidental killingdungeonmustachelanternkingdomsword duelhorse and carriagedaggermoral dilemmaviolinistmain character diespalacevillain played by lead actorswordsmanfountainabuse of powerblonde womandual roletwin brothercostume partynarcissismpatricidetyrantidentical twinsnooseprison breakmuskettwo brotherspsychotronic filmdeath of loverthronelast standflintlock rifleillegitimate sonflintlock pistolbaroquesecret doorsecret passagewaycollapsing buildingbody doublemasqueradehanged womanloss of boyfriendswordplayretireepaternity revealeddeath scenefidelityrapiermusketeertwin brotherswhite glovesfriends falling outjesuitmasked balllong haired manends with funeralgender in title1660sking louis xivrotten foodthree musketeersmasquerade ballpalace intriguebastilleimpersonating a priestmaking a sceneopening creditssecret entrance21 gun saluteheld at sword pointiron maskdeath noticeportcullishalberdriotingroyal ballneck scarfqueen mother (See All) |
Based on the real life story of legendary cryptanalyst Alan Turing, the film portrays the nail-biting race against time by Turing and his brilliant team of code-breakers at Britain's top-secret Government Code and Cypher School at Bletchley Park, during the darkest days of World War II.
| Subgenre: | gay interesttragedy |
| Themes: | deathsuiciderobberyblackmailbullyinghomophobiaprejudicefirst loveautism |
| Mood: | archive footage |
| Locations: | london englandbarenglandu boat |
| Characters: | homosexualpolice officerdetectivebullyhomosexualitypolice detectivebibleprofessorgay teenagercrying boyboy crying |
| Period: | 1950s1940sworld war two1930s1920syear 1939 |
| Story: | marriage proposalflashbacktitle spoken by characterthree word titlebased on true storyfirevoice over narrationcomputerspygay slurdeath of friendwomanjokenonlinear timelineargument …coming outfired from the jobsecret agentnerdgamewhat happened to epiloguereference to adolf hitlerjoggingloss of friendgay lead characterrailway stationpuzzlecrying manappleconfrontationinventorjob interviewsexismnewsreel footageevacuationdespairengagementbonfirearrogancegeniusengagement ringman cryingpost world war twoaccordiondiscoveryinventionmathematicsmachinegay crushunited kingdomschoolboypolice interrogationreference to albert einsteincollege professorawkwardnesstop secretcodepersecutionprivate schoolteenage crushin medias rescarrotenigmaheadmastergreat britaintorpedopanic attackpioneerburningends with biographical notesenvelopereference to josef stalinmultiple time framescrossword puzzlereference to winston churchillsecrecyvisionaryanalysisintelligence agentmathematicianbomb shelterreference to isaac newtonstatisticsmale tearscyanideemotional breakdownsubterfugeteen loveair raid sireninformation leakreference to queen elizabeth iirussian spysecretsthinkingmi6code breakingclassified informationcryptographycloseted gay manthoughtsuspected homosexualyear 1951commanding officerbased on biographyyear 1928crackersocial engineeringencryptionmale hustlermass damagesoviet spyconfidentialitycipherdecodingenigma machinedecoderking george vihormone treatmentcrackingdifferencepeassecurity clearancesodomy crimecryptographerreference to alan turingturing testunsung herocode breakergross indecency (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | betrayalmurderdeathfriendshiprevengesurrealismkidnappingmoneyjealousyprisonfearescapefuneralmonsterdeception …magicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | london englandforestboatwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | riotqueenkingcharacter name in titlebloodviolenceflashbackdogbare chested malefighttitle spoken by characterexplosionknifechasesurprise ending …firebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenecreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralarsonbattlefieldpowerfreeze framestylized violencehenchmantraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
| Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
| Themes: | betrayalmurderdeathloverevengesurrealismkidnappingmarriagefearescapemonsterherodeceptionmagicanger …obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
| Locations: | churchforestsnowvillagewoodscastlecampfire |
| Characters: | soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy |
| Story: | banishmentforbidden lovequeenkingcharacter name in titlebloodviolencesequelflashbackbare chested malekissfightexplosionknifechase …surprise endingvoice over narrationbeatingcorpsefistfighthorsemirrorshot in the chestface slapshot in the headrescueslow motion scenepunched in the facebattleswordbrawlshowdownhand to hand combatsecond parthallucinationrivercombatsubjective cameragood versus evilorphancandlesword fightambushaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirddisarming someoneone man armychild in perilfictional wardouble crosscreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controltorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
Six incarnations of Bob Dylan: an actor, a folk singer, an electrified troubadour, Rimbaud, Billy the Kid, and Woody Guthrie. Put Dylan's music behind their adventures, soliloquies, interviews, marriage, and infidelity. Recreate 1960s documentaries in black and white. Put each at a crossroads, the a …rtist becoming someone else. Jack, the son of Ramblin' Jack Elliott, finds Jesus; handsome Robbie falls in love then abandons Claire. Woody, a lad escaped from foster care, hobos the U.S. singing; Billy awakes in a valley threatened by a six-lane highway; Rimbaud talks. Jude, booed at Newport when he goes electric, fences with reporters, pundits, and fans. He won't be classified. (Read More)
| Subgenre: | cult filmcoming of agedocumentary footage |
| Themes: | loverevengesurrealismmarriagedrugspoliticsdrinkingdrunkennessfilmmakingvoyeurismdivorcetheftdrug usecelebrityillness …poetryfaiththeatrebreak upcrueltydrug addictionreligious conversion (See All) |
| Mood: | satirerain |
| Locations: | london englandhospitalnew york citybarrestauranttrainmotorcyclesmall townairplanebathtubbustaxiairportelevatorwheelchair …englandtrain stationmotorcycle accidentairplane trip (See All) |
| Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanchildrensingerboygirlnursedancermusicianactorphotographerbabythief …artistchristianjewishchristianitybiblefrenchex boyfriend ex girlfriend relationshipairplane stewardess (See All) |
| Period: | 1950s1970s1960s19th century20th centuryyear 1968year 1963year 1973year 1974year 1964 |
| Story: | exileriotprotestdancingsexfemale nuditynuditymale nudityinterviewmale frontal nuditymale rear nuditydogbare chested malefight …cigarette smokingphotographmale full frontal nuditysingingpartyknifethree word titlepantiesbased on true storytelephone callfirevoice over narrationpunctuation in titlesongcorpseunderwearfoodhorseslow motion scenewatching tvcameradrinkbare buttpaintingriflesunglassesapostrophe in titledead bodycafepianojailvoyeurreference to jesus christprayermale pubic hairguitarmanhattan new york cityreportersubjective cameranewspaperjournalistwinebandconcertcaliforniaaxemontageeatingsubwaynonlinear timelineman with glassespaintercoffinbathunderwater scenelooking at the cameratalking to the cameraparklimousinelegenddrug addictmicrophonecowboyumbrellaon the roadflowerspianistamerican flaghairy chestfilm within a filmrock 'n' rollfeminismpoetfreeze framerecord playerperiod in titleeyeglassesapplauseclaim in titlelooking at oneself in a mirrorrecordingtitle based on songjail cellguitaristcrucifixdemonstrationwatching a moviemagazinespidervietnam warpress conferencetv showfaked deathcarnivalpreacherhitchhikingdrug overdosecivil rightspillsnew jerseyplaygroundministerhippiemillionairenewsreel footagetheatre audienceensemble casttime lapse photographyfilm setoutlawautopsysongwriterexistentialismalienationactivistfast motion scenehorseback ridingsermonmale objectificationtitle ends with periodwomen's rightsmultiple storylineanti warsuccessmen's bathroomreference to the beatlesharmonicatraffic jamfascistscalpelelectric guitarcoughingmetamorphosisrallyurinalcontraction in titlerags to richesfolk musicperformance artmusic festivallabor unionreference to john f. kennedyfirst person titlecircular staircaseprice of famejailbreakneck braceblues musicenigmahobominnesotaprophethermitreference to richard nixonneo westernradicaldressinglynchinggiraffeharlem manhattan new york cityliberalflash camerakennedy assassinationmultiple perspectivesprotestormultiple personalityevangelisttarantulagolf cartreference to martin luther king jr.music producerwashing dishesostrichconcert tourgreenwich village manhattan new york cityblackfacegospel musicmotorcycle crashclothed female naked malefreight traincfnm scenechurch choircoffeehousewoodstockactress playing male roleknife attackbible studyprecociousnessblack pantherslyricistbeatnikdead horsevagabondrecord albumyear 1959reference to lyndon johnsonfalling off a bridgeblack panther partyentouragefolk singergreeting cardhit over the head with a bottletumbleweedboxcarcontradictionjumping onto a trainreference to judasmultiple actors for one characterlawlessnesspeace treatyreference to lee harvey oswaldmultiple identitiesreference to judas iscariotreference to arthur rimbaudrising starstiltwalkerawards banquetfalling from a trainpentecostalrole played by multiple actorstroubadourestate salewhitefacedust bowlpeace negotiationphotograph comes to lifetrestlenewport rhode islandriding the railsreference to billy the kidfemale voyeurholy visionlondon 1960sstockton california (See All) |
An elderly Jewish widow living in Atlanta can no longer drive. Her son insists she allow him to hire a driver, which in the 1950s meant a black man. She resists any change in her life but, Hoke, the driver is hired by her son. She refuses to allow him to drive her anywhere at first, but Hoke slowly …wins her over with his native good graces. The movie is directly taken from a stage play and does show it. It covers over twenty years of the pair's life together as they slowly build a relationship that transcends their differences. (Read More)
| Subgenre: | family tragedy |
| Themes: | racismfriendshipmarriagechristmasfuneralunlikely friendship |
| Mood: | affection |
| Locations: | churchcemeteryelevatorroad tripgas station |
| Characters: | policemother son relationshipafrican americanfemale protagonistjewishself discovery |
| Period: | 1950s1940s1970s1960s |
| Story: | character name in titlethree word titlebased on playcar accidenturinationcookingwidowbirthday partyold womanracial slurbusinessmangiftsuspicionstrong female characterrace relations …woman with glassesblockbusterstrong female leadinterracial friendshipcivil rightsanti semitismold agefemale leadawardhousekeepermahjongthanksgivingchauffeurgardeningilliteracynursing homeatlanta georgiasegregationtalking while drivingbanquetsynagoguebaptistracial issuesbossy womansenilitystrong femalemaster servant relationshippulitzer prize sourcefemale lead charactercar dealertelephone boxretireesouthern bellestrong female protagonistcross cultural relationshailstormmatronhousekeepingmobile alabamareference to antonin dvorakpay raise (See All) |
A rule bound head butler's world of manners and decorum in the household he maintains is tested by the arrival of a housekeeper who falls in love with him in pre-WWII Britain. The possibility of romance and his master's cultivation of ties with the Nazi cause challenge his carefully maintained venee …r of servitude. (Read More)
| Subgenre: | historical event |
| Themes: | friendshippoliticsmemorydeath of fatherunrequited lovewealthself sacrifice |
| Locations: | carbicycleengland |
| Characters: | father son relationshipdoctorjewishmaidolder man younger woman relationshipfrenchgermanamerican |
| Period: | 1950s1940s1930s |
| Story: | marriage proposalbased on noveldogkisssingingcryinghorsebookbritishnewspaperold manmansionpoliticiandinnerdriving …horse ridingloss of fatherflowerclass differencespubrecord playerterminal illnesswaiterloyaltyreference to adolf hitlerservantanti semitismworkbutlerenglishseasideattractionhousekeepercareerpigeonmelancholyauctionprime ministerunhappy marriagepost warestaterepressionstroketaverntoastambassadorupper classbritaincountry housenazismestrangementping pongbroken bottlerecordhigh societycongressmanboarding housemanorrunning out of gasreference to winston churchillmaster servant relationshipcollapsepolitical unrestsocial classestranged wifedeliberate crueltypre warservicecountry homeemployerclass systemtripping and fallingupstairs downstairsdomestic servantfox hunthoundbilliard roomsoaking feetgodfather godson relationshipnazi sympathizerrepressed lovesetting the table (See All) |
Humbert Humbert, a British professor coming to the US to teach, rents a room in Charlotte Haze's house, but only after he sees her 14-year-old daughter, Dolores (Lolita), to whom he is immediately attracted. Though he hates the mother, he marries her as this is the only way to be close to the girl, …who will prove to be too mature for her age. They start a journey together, trying to hide they're not just (step)father and daughter, throughout the country, being followed by someone whom Humbert first suspects to be from the police. The profound jealousy, and maybe some guilt from the forbidden love, seem slowly to drive the man emotionally labile. (Read More)
| Subgenre: | independent filmtragic romance |
| Themes: | murdermarriagerapemoneyjealousypregnancydrinkingdrunkennessvoyeurismincestseductiontravelobsessiondeath of motherblackmail …redemptionsexualitydatingillnessdeath of wifewriting (See All) |
| Mood: | rainnightmare |
| Locations: | hospitalschoolswimming poolhotelbicyclepolice carroad triplakemotelgas stationnew england |
| Characters: | family relationshipshusband wife relationshippoliceteenagermother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorsingerteenage girlteenage boyteacherdetectivepolicemandancer …writerpriestlustmaidprofessorolder man younger woman relationshipself destructivenessfrench kissstepfather stepdaughter relationshipdeath of girlfriendpregnant teenagersex with teenager (See All) |
| Period: | 1950s1940s1920s |
| Story: | forbidden lovedancingsexcharacter name in titlebased on novelbloodmale nuditymale frontal nuditymale rear nuditydoggunkissfightcigarette smokingleg spreading …pantiespistolshowertelephone callfirevoice over narrationcryingunderwearcar accidentface slapslow motion scenedrinksex in bedsecretshootinglietearssunglassesbedcollegepianovoyeursubjective cameraswimmingcleavageambulancewidowtoiletaccidentwhite pantieschild abusescantily clad femalehit by a carcontroversyold womanblack pantiesvirginscreamingmini skirtpianistpursuitfemale removes her clothesdatesuspicionrecord playergirl in pantieseyeglassesdesirenipples visible through clothingloss of virginitysexual attractionvirusdysfunctional marriagetenniscoitusvirginityfollowing someonesexual desiretarget practiceconfrontationbackstagemay december romancepedophilelipstickbananabrushing teethreckless drivingcopulationpajamasadolescentflat tireage differencepervertpedophiliaspiral staircasesummer campjazz musicplaywright14 year oldwhisperingsex educationlandladyballerinamailcollege professorchewing gumunderage sexwoman wearing only a man's shirtstation wagoncadillactragic lovesex with a minorfrenchmanhouse fireschool playlolitaprecocious childrocking chairdental bracesolder man young girl relationshipsleeping pillflirtationcannesclothes linenail polishbubble gumpreparatory schoolstatutory rapebraided hairlawn sprinklergirl man relationshiplovesickvintage carunderage girlcomic stripdirty old manteepeelasciviousnessporch swingcrossing oneselfhandwritingpromiscuous daughterdental retainerplayer pianobug zapperjitterbugnymphettecollege teachervibrating bedfake rabbit earswet dressschool theateradult actress playing minor girllifting up a dressjawbreakerlying to a childmilk moustachesoda fountainwind machine (See All) |
Three grown prodigies, all with a unique genius of some kind, and their mother are staying at the family household. Their father, Royal had left them long ago, and comes back to make things right with his family.
| Subgenre: | independent filmcomedy of manners |
| Themes: | racismdeathfriendshipmarriagelesbianismweddingfuneralartincestextramarital affairdivorcedeath of fatherdepressiondysfunctional familyredemption …grieftheatrechildhooddrug addictionwealth (See All) |
| Locations: | hospitalnew york cityswimming poolhotelcemeterybathtubtaxiurban settingpolice car |
| Characters: | interracial relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshippolice officernursepriestlawyerartistlittle girl …professorgrandfather grandson relationshiptalking to oneself in a mirror (See All) |
| Story: | interracial kissforbidden lovesexcharacter name in titlebloodinterviewflashbackdogcigarette smokingphotographknifelesbian kissthree word titlepantiesvoice over narration …car accidentslow motion scenewatching tvcameracar crashfoot chasebranew yorkambulancejudgeman with glassesbirdcoffinchild in perilgravemassagetentskeletonactor shares first name with characterratcharacter says i love youballetheart attackrecord playerterminal illnessprivate detectivefalling down stairskilling an animaltape recordercowboy hatmousestabbed in the stomachloss of wifeservantbrother sister incesttennisinterracial romanceface paintshopliftingreconciliationsevered fingerattempted suicidepet dogtitle appears in writingnovelisttheatre audiencemedical examinationmedicationthrown through a windowblood on shirtmarital separationnervous breakdownplaysirengeniusmusic bandplaying cardsfiremanbisexualityaccountantmental breakdownfamily reunionphysicianreference to the beatlesclimbing through a windowplaywrightboy with glassesstage playballerinawrist slittingfinger cut offrazor bladewriter's blockbankruptcyshot in the handcruise shipdarkroomarcheologistboard gamechapter headingsestrangementadopted daughterdogfightracial stereotypeestranged fatherfinancechild prodigyeast indianphonograph recordbandaged handpainted facereference to the rolling stonestennis playerdelinquentfire enginefalconluxury hotelknife woundclergyshaving headextended familydalmatianfrat packfake illnesswar paintchequedeadpanneurologistdrug referencebb guntennis matchestranged family memberdeadbeat dadchild smoking a cigaretteelevator operatorhigh blood pressuremescalinebook coverplaying doctorstomach cancerex assassinliterary narrationfire drilltent indoorsrunning in traffic (See All) |
In late nineteenth century Vienna, renowned illusionist Eisenheim is reunited with the Duchess von Teschen when she is volunteered from the audience to participate in an illusion during one of his performances. Despite having not seen each other in fifteen years when they were teenagers, they almost … immediately recognize each other as Eduard Abramovich and Sophie von Teschen, they who had a doomed romance at that time due to their class differences. The Duchess is soon to be wed to the Crown Prince Leopold in what would be for him a marriage solely in pursuit of power: overthrowing his father, the Emperor Leopold, as well as overtaking the Hungarian side of the empire. The Crown Prince is known to use violence against women if it suits his needs or purposes. As such, the Duchess, who realizes that she still loves Eisenheim and he her, can never leave the Crown Prince without it jeopardizing her life. After Eisenheim humiliates the Crown Prince at a private show which results in an incident between the Crown Prince and the Duchess, the battle between Eisenheim and the Crown Prince moves into the public performance realm, which many believe demonstrates Eisenheim's supernatural powers. Much of the work for the Crown Prince in the battle with Eisenheim is conducted by Chief Inspector Uhl, who would become the Chief of Police under the Crown Prince's reign. As such, Uhl may have ulterior motives in turning a blind eye to any unlawful act of the Crown Prince against Eisenheim or t… (Read More)
| Subgenre: | independent filmsuspenseconspiracyparanormal phenomenasteampunkperiod film |
| Themes: | murderdeathfriendshiprevengesuicidemoneyghostjealousydrinkinginvestigationmagicobsessionsupernatural powertheatrehunting …first loveafterlife (See All) |
| Locations: | london englandtrainrural settingcastle |
| Characters: | frienddoctorboygirldetectivefiance fiancee relationshipsuicide by gunshotpolice surveillancesuicide by shooting one's self in the head |
| Period: | 19th century1880s1870s |
| Story: | crown princeforbidden loveprincefemale nuditymale nudityflashbacktwo word titlegunsex scenekisscigarette smokingphotographtitle spoken by charactersurprise endingpistol …voice over narrationfoodhorsemirrorface slapshot in the headdrinkswordarrestundressinglettershootingpaintingrifleinterrogationrivernewspaperwinecandledisguiseeatingnonlinear timelinefalse accusationbirdsearchtreeargumentbased on short storysuitcasedisappearancesadnessreunionclass differencesbreaking and enteringeggroyaltymagicianloss of loved oneassaultfrogfaked deathrailway stationbackstagetheatre audiencehypnosiscard playingrosebutterflysoulbalconylanternhorse and carriagepolice inspectorcoinframed for murderpipe smokinghorseback ridingvictorian eraillusionelectricitymagic trickapparitionpickpocketteenage loveflutebeggarlost lovefilm projectorpocket watchvienna austriastablebroken heartstar crossed loverscarpentertrickmorphinejewellocketsecret loveman slaps a womanspiritualismchildhood sweetheartangry mobcard trickbroken engagementaustrianskepticismillusionistnobilityhandkerchiefcoupfake beardwood carvingseedstage magiciantrystlemonduchessmagician's assistantskeptichypnotistexcaliburnineteenth centuryspiritualistgemstonemanifestationorange the fruityoung loversneck wounddeer antlerstheatre producershowmanshipfull bodied apparitionorange treeaustrian alpsaustrian empiregaslightlocket with photographvaporchief inspectorthe other sideaustrian soldierfootlights (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com