Please wait - finding best movies...
Alice is a daydreaming young girl. She finds learning poems and listening to literature boring. She prefers stories with pictures and to live inside her imagination. One day, while enduring just such a poetry reading, she spots a large white rabbit...dressed in a jacket and carrying a large watch. H β¦e scurries off, saying he's late, for a very important date. She follows him through the forest. He then disappears down a rabbit hole. Alice follows, leading her to all manner of discoveries, characters and adventures. (Read More)
Subgenre: | 2d animationfairy talecult film |
Themes: | angermagicsurrealism |
Locations: | oceanenglandseaforestbeach |
Characters: | sister sister relationshipgirlfemale protagonist |
Period: | 1860s19th century |
Story: | white rabbitrose gardendodo birdtea partyangry womanalice in wonderlandalternate dimensionred paintplaying cardanthropomorphic sungiving a toastqueen of heartsanthropomorphic flowertalking floweranthropomorphic rabbit β¦rabbit holeanimal wearing clotheshybrid animalbirthday partyanthropomorphic animaltalking animalunderwater scenecheshire cattalking catit was all a dreamcharacter shaped holepied piperlewis carrollgrowing in sizeno narrationsudden change in sizechanging sizemispronounciationmad hattersmoke ringbird's nestenlargementgiantessfalling into a holelift skirtdodobloomersteacupdoorknobwonderlandjamsentenced to deathrocking horsebad temperspiderwebteapothookahharemustardstarfishwalrusflamingocroquetpaintbrushdimensionmalletshorewhitekeyholesneezeoystershrinkingangrytitle appears in songhedgehogdaydreamingminiaturizationcaterpillarlabyrinthsecret passagesugardoorparallel universecalendarcardfantasy worldlobstercarrotaltered version of studio logocarpenterreading a bookmatchredpipemushroompocket watchcookietoastjuryharmonicacrownlizardbottlevictorian erainvisibilityirreverencecanebutterflyrosesunchild's point of viewsandimaginationeaten aliveanthropomorphismrealityladderblockbusterhammermousehatcakeeggteasistermoonqueenfireworkstwinflowergardenunderwaterflowersrabbitumbrellakeytreesmokingtransformationcreaturekinganimalbirdtrialjudgefishbirthdaytearsfalling from heightcatdreamcryingfirethree word titlechasepartysingingtitle spoken by charactercharacter name in titlebased on noveldog (See All) |
Alice, an unpretentious and individual 19-year-old, is betrothed to a dunce of an English nobleman. At her engagement party, she escapes the crowd to consider whether to go through with the marriage and falls down a hole in the garden after spotting an unusual rabbit. Arriving in a strange and surre β¦al place called "Underland," she finds herself in a world that resembles the nightmares she had as a child, filled with talking animals, villainous queens and knights, and frumious bandersnatches. Alice realizes that she is there for a reason--to conquer the horrific Jabberwocky and restore the rightful queen to her throne. (Read More)
Subgenre: | fairy tale |
Themes: | angermagicsurrealism |
Locations: | forest |
Characters: | female protagonist |
Period: | 19th century |
Story: | white rabbitrose gardentea partyalice in wonderlandplaying cardqueen of heartsanthropomorphic flowertalking flowerrabbit holeanimal wearing clothesanthropomorphic animaltalking animalcheshire cattalking catlewis carroll β¦growing in sizesudden change in sizechanging sizemad hatterfalling into a holedodowonderlandsentenced to deathrocking horseteapotharehookahflamingokeyholeshrinkinghedgehogcaterpillarfantasy worldmushroompocket watchcrownvictorian erainvisibilitybutterflyroseimaginationanthropomorphismblockbustermousehatcakesisterqueentwingardenflowersrabbitkeyanimalbirdfishcatdreamfirepartycharacter name in titlebased on noveldog (See All) |
Alice returns to the magical world of Underland, only to find the Hatter in a horrible state. With the help of her friends, Alice must travel through time to save the Mad Hatter and Underland's fate from the evil clutches of the Red Queen and a clock like creature, known as Time.
Subgenre: | fairy tale |
Themes: | surrealism |
Locations: | sea |
Characters: | sister sister relationshipfemale protagonist |
Story: | talking animalcheshire catgrowing in sizesudden change in sizechanging sizemad hatterfantasy worldcrowninvisibilitybutterflyanthropomorphismblockbusterhatsisterqueen β¦rabbitcreatureanimalfalling from heightcatfirecharacter name in titledog (See All) |
In Victorian London, England, a little mouse girl's toymaker father is abducted by a peglegged bat. She enlists the aid of Basil of Baker Street, the rodent world's answer to Sherlock Holmes. The case expands as Basil uncovers the crime's link to a plot against the Crown itself.
Subgenre: | 2d animation |
Themes: | angersurrealism |
Period: | 19th century |
Story: | anthropomorphic animaltalking animalbad temperangryredcrownlizardvictorian eraeaten aliveanthropomorphismmousehatqueenkingtears β¦catcryingsingingtitle spoken by characterbased on noveldog (See All) |
In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w β¦ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)
Subgenre: | 2d animationfairy tale |
Themes: | angermagicsurrealism |
Locations: | oceanseabeach |
Characters: | sister sister relationshipfemale protagonist |
Period: | 19th century |
Story: | anthropomorphic animaltalking animalgiantessstarfishflamingomalletpipeanthropomorphismblockbusterfireworksunderwatertransformationkingfishbirthday β¦firethree word titlesingingtitle spoken by characterdog (See All) |
Arthur (aka Wart) is a young boy who aspires to be a knight's squire. On a hunting trip he falls in on Merlin, a powerful but amnesiac wizard who has plans for Wart beyond mere squiredom. He starts by trying to give Wart an education (whatever that is), believing that once one has an education, one β¦can go anywhere. Needless to say, it doesn't quite work out that way. (Read More)
Subgenre: | 2d animation |
Themes: | magicsurrealism |
Locations: | englandforest |
Story: | talking animalunderwater scenegiantesswalrustitle appears in songminiaturizationcrownblockbustermouserabbittreetransformationbirdfishcat β¦title spoken by characterbased on noveldog (See All) |
In 1944 falangist Spain, a girl, fascinated with fairy-tales, is sent along with her pregnant mother to live with her new stepfather, a ruthless captain of the Spanish army. During the night, she meets a fairy who takes her to an old faun in the center of the labyrinth. He tells her she's a princess β¦, but must prove her royalty by surviving three gruesome tasks. If she fails, she will never prove herself to be the the true princess and will never see her real father, the king, again. (Read More)
Subgenre: | fairy talecult film |
Themes: | magicsurrealism |
Locations: | forest |
Characters: | girlfemale protagonist |
Story: | alice in wonderlandalternate dimensionlabyrinthsecret passageparallel universefantasy worldpocket watchrosechild's point of viewimaginationhammerqueenflowerrabbitumbrella β¦keytreetransformationcreaturekingchasesingingcharacter name in title (See All) |
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. β¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
Subgenre: | cult film |
Themes: | angersurrealism |
Locations: | forest |
Characters: | girlfemale protagonist |
Story: | talking animaltalking catspiderwebsecret passagedoorfantasy worldcanerealitymousecaketeagardenflowerskeytears β¦catdreamcryingsingingtitle spoken by charactercharacter name in titlebased on noveldog (See All) |
The beautiful and kindhearted princess Snow White charms every creature in the kingdom except one - her jealous stepmother, the Queen. When the Magic Mirror proclaims Snow White the fairest one of all, she must flee into the forest, where she befriends the lovable seven dwarfs - Doc, Sneezy, Grumpy, β¦ Happy, Bashful, Sleepy, and Dopey. But when the Queen tricks Snow White with an enchanted apple, only the magic of true love's kiss can save her. (Read More)
Subgenre: | 2d animationfairy tale |
Themes: | magic |
Locations: | forest |
Characters: | female protagonist |
Period: | 19th century |
Story: | anthropomorphic animalwhitesneezecrownanthropomorphismqueenrabbittransformationcreaturefalling from heightchasesingingcharacter name in title |
Aladdin is a poor street urchin who spends his time stealing food from the marketplace in the city of Agrabah. His adventures begin when he meets a young girl who happens to be Princess Jasmine, who is forced to be married by her wacky yet estranged father. Aladdin's luck suddenly changes when he re β¦trieves a magical lamp from the Cave of Wonders. What he unwittingly gets is a fun-loving genie who only wishes to have his freedom. Little do they know is that the Sultan's sinister advisor Jafar has his own plans for both Aladdin and the lamp. (Read More)
Subgenre: | 2d animation |
Themes: | magic |
Characters: | girl |
Story: | anthropomorphic animaltalking animalunderwater scenehookahflamingotitle appears in songanthropomorphismblockbusterfireworksgardensmokingtransformationbirdfishfire β¦chasesingingtitle spoken by charactercharacter name in titlebased on noveldog (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | fairy talecult film |
Themes: | magicsurrealism |
Locations: | forest |
Characters: | sister sister relationshipgirl |
Period: | 19th century |
Story: | rocking horsefantasy worldcrownhatqueenfireworksrabbittreetransformationcreaturekinganimaltrialfalling from heightcat β¦firethree word titletitle spoken by charactercharacter name in titledog (See All) |
After a beautiful princess, Aurora, is born in to royalty everyone gathers to exchange gifts. Everything is perfectly fine until an unwanted guest appears, Maleficent. Magnificent casts a spell on the young princess and announces that she will die by pricking her finger on the spindle of a spinning β¦wheel on the evening of her 16th birthday. Fortunately, one of the good fairies, Merryweather, changes the spell so Aurora will fall asleep, and that the only way to wake her up were the tears from her true love. Finally the day comes. Will she be left to sleep forever? (Read More)
Subgenre: | 2d animationfairy tale |
Themes: | magicsurrealism |
Locations: | forest |
Characters: | female protagonist |
Story: | birthday partycrownblockbustercakeeggqueenflowerrabbitkingfishbirthdaytearscryingfiresinging |
The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear β¦ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)
Subgenre: | cult film |
Themes: | angermagicsurrealism |
Locations: | forest |
Characters: | girl |
Story: | alice in wonderlandlabyrinthfantasy worldladdersistergardentransformationcreaturekingtearscatdreamcryingfiresinging β¦title spoken by characterdog (See All) |
A young boy named Max has an active imagination, and he will throw fits if others don't go along with what he wants. Max - following an incident with Claire (his sister) and her friends, and following a tantrum which he throws as a result of his Mother paying more attention to her boyfriend than to β¦him - runs away from home. Wearing his wolf costume at the time, Max not only runs away physically, but runs toward a world in his imagination. This world, an ocean away, is inhabited by large wild beasts, including one named Carol who is much like Max himself in temperament. Instead of eating Max like they normally would with creatures of his type, the wild things befriend Max after he proclaims himself a king who can magically solve all their problems. (Read More)
Themes: | anger |
Locations: | oceanforestbeach |
Story: | fantasy worldaltered version of studio logocrownsunsandimaginationsisterflowertreecreaturekingfiredog |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | fairy tale |
Themes: | magicsurrealism |
Locations: | forest |
Characters: | girlfemale protagonist |
Story: | talking animalteacupteapotaltered version of studio logoroseanthropomorphismblockbusterqueengardentransformationcreaturekingbirdfalling from heightfire β¦chasepartysingingtitle spoken by charactercharacter name in titledog (See All) |
Having lived a life in selfishness, a young prince is cursed by a mysterious enchantress to having the appearance of a monstrous beast. His only hope is to learn to love a young woman and earn her love in return in order to redeem himself. Years later, his chance shows itself when a young maiden nam β¦ed Belle offers to take her ill father's place as his prisoner. With help from the castle's enchanted staff, Belle learns to appreciate her captor and immediately falls in love with him. Back in the village however, an unscrupulous hunter has his own plans for Belle. (Read More)
Subgenre: | 2d animationfairy talecult film |
Themes: | magicsurrealism |
Locations: | forest |
Characters: | female protagonist |
Story: | teacupteapotsneezetitle appears in songroseanthropomorphismblockbustereggteatransformationanimaltearsfalling from heightcryingfire β¦character name in titledog (See All) |
The animated story of Bambi, a young deer hailed as the 'Prince of the Forest' at his birth. As Bambi grows, he makes friends with the other animals of the forest, learns the skills needed to survive, and even finds love. One day, however, the hunters come, and Bambi must learn to be as brave as his β¦ father if he is to lead the other deer to safety. (Read More)
Subgenre: | 2d animation |
Locations: | forest |
Story: | anthropomorphic animaltalking animalno narrationaltered version of studio logobutterflyblockbustertwinflowerrabbitanimalbirdfiretitle spoken by charactercharacter name in titlebased on novel β¦dog (See All) |
Inventor Gepetto creates a wooden marionette called Pinocchio. His wish that Pinocchio be a real boy is unexpectedly granted by a fairy. The fairy assigns Jiminy Cricket to act as Pinocchio's "conscience" and keep him out of trouble. Jiminy is not too successful in this endeavor and most of the film β¦ is spent with Pinocchio deep in trouble. (Read More)
Subgenre: | 2d animationfairy tale |
Themes: | magic |
Locations: | sea |
Period: | 19th century |
Story: | underwater scenealtered version of studio logoanthropomorphismblockbusterumbrellatransformationfishcatcryingfiresingingtitle spoken by charactercharacter name in titlebased on novel |
The son of a sailor, 5-year old Sosuke lives a quiet life on an oceanside cliff with his mother Lisa. One fateful day, he finds a beautiful goldfish trapped in a bottle on the beach and upon rescuing her, names her Ponyo. But she is no ordinary goldfish. The daughter of a masterful wizard and a sea β¦goddess, Ponyo uses her father's magic to transform herself into a young girl and quickly falls in love with Sosuke, but the use of such powerful sorcery causes a dangerous imbalance in the world. As the moon steadily draws nearer to the earth and Ponyo's father sends the ocean's mighty waves to find his daughter, the two children embark on an adventure of a lifetime to save the world and fulfill Ponyo's dreams of becoming human. (Read More)
Themes: | magic |
Locations: | oceanseabeach |
Characters: | sister sister relationshipgirl |
Story: | underwater scenebottleblockbustermoontransformationfishcharacter name in title |
The fantastic tale of an 18th century aristocrat, his talented henchmen and a little girl in their efforts to save a town from defeat by the Turks. Being swallowed by a giant sea-monster, a trip to the moon, a dance with Venus and an escape from the Grim Reaper are only some of the improbable advent β¦ures. (Read More)
Subgenre: | cult film |
Themes: | angersurrealism |
Locations: | seabeach |
Characters: | girl |
Story: | underwater scenesneezesunroseimaginationanthropomorphismmousemoonqueenkeykingbirdfalling from heightsingingcharacter name in title β¦based on noveldog (See All) |
The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma β¦iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)
Subgenre: | cult film |
Themes: | magicsurrealism |
Locations: | forestbeach |
Story: | underwater scenecrowninvisibilitymousemoonqueenflowertransformationkingbirdbirthdayfalling from heightfirechasetitle spoken by character β¦based on novel (See All) |
Disney animators set pictures to Western classical music as Leopold Stokowski conducts the Philadelphia Orchestra. "The Sorcerer's Apprentice" features Mickey Mouse as an aspiring magician who oversteps his limits. "The Rite of Spring" tells the story of evolution, from single-celled animals to the β¦death of the dinosaurs. "Dance of the Hours" is a comic ballet performed by ostriches, hippos, elephants, and alligators. "Night on Bald Mountain" and "Ave Maria" set the forces of darkness and light against each other as a devilish revel is interrupted by the coming of a new day. (Read More)
Subgenre: | cult film |
Themes: | magicsurrealism |
Locations: | oceanforest |
Story: | spiderwebmushroombutterflysunanthropomorphismhammermousehatmoonflowergardenunderwatertreetransformationfish β¦falling from heightfirepartytitle spoken by character (See All) |
An imaginative Disney version of the Robin Hood legend. Fun and romance abound as the swashbuckling hero of Sherwood Forest and his valiant sidekick plot one daring adventure after another to outwit the greedy prince and his partner as they put the tax squeeze on the poor.
Subgenre: | 2d animation |
Locations: | englandforest |
Story: | anthropomorphic rabbitanthropomorphic animaltalking animalimaginationanthropomorphismblockbustermouserabbitcatfirechasetitle spoken by charactercharacter name in titledog |
When a bottle containing a plea for help from a little girl named Penny makes its way to the Rescue Aid Society, a mouse organization in the basement of the United Nations building dedicated to the rescue and well-being of anyone in need, it is up to the brave mouse Miss Bianca and her chosen partne β¦r, the shy janitor Bernard, to rescue the girl. Searching for clues at Penny's home at Morningside Orphanage in New York City, the two mice discover that the girl has been kidnapped by the evil pawn shop owner Madame Medusa and her companion Mr. Snoops. On the back of Orville the albatross, Miss Bianca and Bernard travel to the terrifyingly gloomy Devil's Bayou where they learn the shocking truth: the innocent young girl is being forced down into a dangerous, dark underground pirate's cave where she must find the Devil's Eye, the world's largest diamond and Madame Medusa's greatest obsession. Before returning safely home, Miss Bianca, Bernard, and Penny will have to combat Madame Medusa's two ferocious pet alligators Brutus and Nero with the help of Ellie Mae and Evinrude the dragonfly, as well as survive the raging tides inside the horrible pirate's cave. (Read More)
Subgenre: | 2d animation |
Themes: | anger |
Characters: | girlfemale protagonist |
Story: | anthropomorphic animaltalking animalspiderwebcookiebottlecaneanthropomorphismblockbustermousehatunderwaterrabbitumbrellafalling from heightcat β¦cryingchasedog (See All) |
Surrounded by the immense and furious ocean, a shipwrecked mariner battles all alone for his life with the relentless towering waves. Right on the brink of his demise, the man set adrift by the raging tempest washes ashore on a small and deserted tropical island of sandy beaches, timid animal inhabi β¦tants and a slender but graceful swaying bamboo forest. Alone, famished, yet, determined to break free from his Eden-like prison, after foraging for food and fresh water and encouraged by the dense forest, the stranded sailor builds a raft and sets off to the wide sea, however, an indistinguishable adversary prevents him from escaping. Each day, the exhausted man never giving up hope will attempt to make a new, more improved raft, but the sea is vast with wonderful and mysterious creatures and the island's only red turtle won't let the weary survivor escape that easily. Is this the heartless enemy? (Read More)
Themes: | angersurrealism |
Locations: | oceanseaforestbeach |
Story: | underwater sceneangryaltered version of studio logoredtransformationanimalfishfalling from heightfire |
It was no ordinary life for a young girl: living among scholars in the hallowed halls of Jordan College and tearing unsupervised through Oxford's motley streets on mad quests for adventure. But Lyra's greatest adventure would begin closer to home, the day she heard hushed talk of an extraordinary pa β¦rticle. Microscopic in size, the magical dust--discovered in the vast Arctic expanse of the North--was rumored to possess profound properties that could unite whole universes. But there were those who feared the particle and would stop at nothing to destroy it. Catapulted into the heart of a terrible struggle, Lyra was forced to seek aid from clans, 'gyptians, and formidable armored bears. And as she journeyed into unbelievable danger, she had not the faintest clue that she alone was destined to win, or to lose, this more-than-mortal battle... (Read More)
Themes: | surrealism |
Locations: | seaforest |
Characters: | girlfemale protagonist |
Story: | talking animaltalking catparallel universefantasy worldchild's point of viewblockbustermouserabbittransformationkinganimalbirdcatfirechase β¦based on noveldog (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget β¦her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
Themes: | angermagic |
Locations: | forest |
Characters: | girl |
Story: | fantasy worldcrownchild's point of viewimaginationrealityqueenkeykingbirthdaytearsthree word titlesingingbased on noveldog |
James' happy life at the English seaside is rudely ended when his parents are killed by a rhinoceros and he goes to live with his two horrid aunts. Daringly saving the life of a spider he comes into possession of magic boiled crocodile tongues, after which an enormous peach starts to grow in the gar β¦den. Venturing inside he meets not only the spider but a number of new friends including a ladybug and a centipede who help him with his plan to try and get to New York. (Read More)
Subgenre: | cult film |
Themes: | magicsurrealism |
Locations: | englandsea |
Story: | anthropomorphic animalcalendarchild's point of viewgardentreetransformationbirthdayfalling from heightdreamcharacter name in titlebased on novel |
This is the story of a young witch, named Kiki who is now thirteen years old. But she is still a little green and plenty headstrong, but also resourceful, imaginative, and determined. With her trusty wisp of a talking cat named Jiji by her side she's ready to take on the world, or at least the quain β¦tly European seaside village she's chosen as her new home. (Read More)
Subgenre: | 2d animationcult film |
Themes: | magicsurrealism |
Locations: | seaforest |
Characters: | female protagonist |
Story: | talking animaltalking catbirdfalling from heightcatthree word titlecharacter name in titledog |
Arthur is a spirited ten-year old whose parents are away looking for work, whose eccentric grandfather has been missing for several years, and who lives with his grandmother in a country house that, in two days, will be repossessed, torn down, and turned into a block of flats unless Arthur's grandfa β¦ther returns to sign some papers and pay off the family debt. Arthur discovers that the key to success lies in his own descent into the land of the Minimoys, creatures no larger than a tooth, whom his grandfather helped relocate to their garden. Somewhere among them is hidden a pile of rubies, too. Can Arthur be of stout heart and save the day? Romance beckons as well, and a villain lurks. (Read More)
Themes: | magic |
Story: | sudden change in sizechanging sizeminiaturizationfantasy worldinvisibilitychild's point of viewimaginationmouseflowergardenkeykingbirthdaychasecharacter name in title β¦based on noveldog (See All) |
Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)
Subgenre: | 2d animation |
Themes: | surrealism |
Story: | anthropomorphic animaltalking animaltalking catanthropomorphismmousehatumbrellabirdcatsingingtitle spoken by characterdog |
Two young girls, Satsuki and her younger sister Mei, move into a house in the country with their father to be closer to their hospitalized mother. Satsuki and Mei discover that the nearby forest is inhabited by magical creatures called Totoros (pronounced toe-toe-ro). They soon befriend these Totoro β¦s, and have several magical adventures. (Read More)
Subgenre: | 2d animationfairy talecult film |
Locations: | forest |
Characters: | sister sister relationshipgirlfemale protagonist |
Story: | secret passagesisterumbrellatreecatthree word titlecharacter name in title |
An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.
Subgenre: | 2d animation |
Themes: | angermagicsurrealism |
Locations: | englandsea |
Characters: | girl |
Story: | fantasy worldaltered version of studio logoblockbusterrabbitumbrelladreamtitle spoken by charactercharacter name in titlebased on noveldog |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
Themes: | angermagic |
Locations: | oceanenglandbeach |
Characters: | girl |
Story: | talking animalshrinkingmousehatcakefireworkstransformationbirthdaytearscatcryingsingingbased on novel |
Young Mary Katherine (M.K.) returns to her eccentric scientist father's home, but his all-consuming quest to discover a tiny civilization in the neighboring forest drives them apart. However, M.K. soon finds herself shrunken down by Queen Tara of that forest who was mortally wounded by the putrefyin β¦g Boggans, and charged to deliver a pod bearing the new Queen to safety. Together with a veteran Leafman warrior, two goofy mollusks and a young maverick, M.K. agrees to help. As the villainous Boggan leader, Mandrake closes in, M.K. and her new friends must draw on the best of themselves together and discover what they have to save their world. (Read More)
Themes: | magic |
Locations: | forest |
Characters: | female protagonist |
Story: | talking animalsudden change in sizeminiaturizationfantasy worldmousemoonqueentreebirdchasedog |
Bastian is a young boy who lives a dreary life being tormented by school bullies. On one such occasion he escapes into a book shop where the old proprieter reveals an ancient story-book to him, which he is warned can be dangerous. Shortly after, he "borrows" the book and begins to read it in the sch β¦ool attic where he is drawn into the mythical land of Fantasia, which desperately needs a hero to save it from destruction. (Read More)
Subgenre: | fairy talecult film |
Themes: | angermagic |
Characters: | girl |
Story: | talking animalsneezefantasy worldsandimaginationanthropomorphismrealitykeycreaturethree word titlechasetitle spoken by characterbased on novel |
A girl named Ella (Cinderella) has the purest heart living in a cruel world filled with evil stepsisters and an evil stepmother out to ruin Ella's life. Ella comes one with her pure heart when she meets the prince and dances her way to a better life with glass shoes, and a little help from her fairy β¦ godmother, of course. (Read More)
Subgenre: | fairy tale |
Themes: | magic |
Locations: | forest |
Characters: | sister sister relationshipgirlfemale protagonist |
Story: | lizardmousegardentransformationkingcatpartysingingtitle spoken by charactercharacter name in titledog |
The tale of three unlikely heroes - a misfit mouse who prefers reading books to eating them, an unhappy rat who schemes to leave the darkness of the dungeon, and a bumbling servant girl with cauliflower ears - whose fates are intertwined with that of the castle's princess.
Subgenre: | fairy tale |
Characters: | girl |
Story: | anthropomorphic animaltalking animalcrownsunanthropomorphismmousekingcatdreamcharacter name in titlebased on novel |
Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en β¦ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)
Subgenre: | fairy talecult film |
Themes: | surrealism |
Characters: | girl |
Story: | alice in wonderlandrabbit holetalking animalunderwater scenewonderlandfantasy worldimaginationrabbittreefalling from heightdreamfiresingingbased on novel |
Abandoned after an accident, baby Mowgli is taken and raised by a family of wolves. As the boy grows older, the wise panther Bagheera realizes he must be returned to his own kind in the nearby man-village. Baloo the bear however thinks differently taking the young Mowgli under his wing and teaching β¦that living in the jungle is the best life there is. Bagheera realizes that Mowgli is in danger, particularly from Shere Khan the tiger who hates all people. When Baloo finally comes around, Mowgli runs off into the jungle where he survives a second encounter with Kaa the snake and finally, with Shere Khan. It's the sight of a pretty girl however that gets Mowgli to go the nearby man-village. (Read More)
Subgenre: | 2d animation |
Themes: | surrealism |
Characters: | girl |
Period: | 19th century |
Story: | anthropomorphic animaltalking animalanthropomorphismblockbustertreekinganimalfirethree word titlesingingtitle spoken by characterbased on noveldog |
Pongo and Perdita have a litter of 15 puppies. Cruella De Vil takes a fancy to the pups, and wants to get hold of them, as well as more pups, to make herself a lovely dalmatian skin coat... Cruella hires some thugs to kidnap the pups and hold them at her mansion. Will Pongo and Perdita find them in β¦time ? (Read More)
Subgenre: | 2d animation |
Themes: | angersurrealism |
Locations: | england |
Story: | talking animaltalking catbad temperpipebottleblockbustersmokingcatcryingchasebased on noveldog |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Subgenre: | fairy tale |
Themes: | angermagicsurrealism |
Locations: | oceanforest |
Story: | anthropomorphic animalflamingobottlebutterflyanthropomorphismmouseunderwaterrabbitumbrellatreefishtearsfalling from heightcatcrying β¦firechasedog (See All) |
In a Manhattan apartment building, Max's life as a favorite pet is turned upside-down, when his owner brings home sloppy mongrel Duke. They must put their quarrels aside when they learn that adorable white bunny Snowball is building an army of lost pets determined to wreak revenge.
Story: | anthropomorphic animaltalking animalunderwater scenewhitelizardcakerabbitanimalbirdfishcatpartydog |
Living in India, Mary Lennox, a young, privileged girl, is left orphaned when her parents are killed in an earthquake. She is sent back to England where she goes to live on her uncle's estate. It is a fairly isolated existence and she has to find things to keep herself occupied. She finds a sickly y β¦oung boy...and a secret garden. (Read More)
Themes: | magic |
Characters: | girl |
Period: | 19th century |
Story: | victorian erarosechild's point of viewgardenkeydreamcryingfiretitle spoken by characterbased on noveldog |
Fievel is a young Russian mouse separated from his parents on the way to America, a land they think is without cats. When he arrives alone in the New World, he keeps up hope, searching for his family, making new friends, and running and dodging the cats he thought he'd be rid off.
Themes: | anger |
Period: | 19th century |
Story: | anthropomorphic animaltalking animalbad temperangryimaginationanthropomorphismmousecatcryingfirethree word title |
'Slow West' follows a 16-year-old boy on a journey across 19th Century frontier America in search of the woman he loves, while accompanied by mysterious traveler Silas.
Locations: | forestbeach |
Characters: | girl |
Period: | 19th century |
Story: |
When her father enlists to fight for the British in WWI, young Sara Crewe goes to New York to attend the same boarding school her late mother attended. She soon clashes with the severe headmistress, Miss Minchin, who attempts to stifle Sara's creativity and sense of self-worth. Sara's belief that "e β¦very girl's a princess" is tested to the limit, however, when word comes that her father was killed in action and his estate has been seized by the British government. (Read More)
Themes: | magic |
Characters: | sister sister relationshipgirlfemale protagonist |
Story: | birthday partybad temperrosechild's point of viewimaginationrealitymouseflowerbirthdaycryingthree word titlebased on novel |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet β¦er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
Subgenre: | cult film |
Themes: | magic |
Locations: | england |
Characters: | girl |
Story: | anthropomorphic flowerminiaturizationfantasy worldchild's point of viewanthropomorphismblockbustertearscryingtitle spoken by charactercharacter name in titlebased on noveldog |
Cody, a boy from Mugwomp Flats responds to a distress call about a trapped giant Golden Eagle called Marahute. Freeing her, he gains a close friendship with the bird. However, Cody is soon abducted by the murderous poacher, Percival McLeach, who is after that bird which is of a highly endangered spe β¦cies and therefore an extremely profitable quarry. In a panic, a mouse Cody freed from one of McLeach's traps sends a desperate call for help to the Rescue Aid Society in New York City who assigns their top agents, Miss Bianca and Bernard, to the task. With transportation provided by the goofy albatross, Wilbur, the agents arrive in Australia and link up with the RAS' local field operative, Jake the Kangaroo Rat. Together, the trio must race against time to find Cody, stop McLeach, and save Marahute. (Read More)
Subgenre: | 2d animationcult film |
Characters: | female protagonist |
Story: | anthropomorphic animaltalking animallizardcaneanthropomorphismmouseeggkeybirdfalling from heightchase |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn β¦that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
Subgenre: | fairy talecult film |
Themes: | anger |
Locations: | forest |
Characters: | sister sister relationshipfemale protagonist |
Story: | white rabbitaltered version of studio logoredsistermoontreecreatureanimaldreamfirethree word titlechasepartycharacter name in title |