Best popular movies like Alligator:

Do you need specific genre & keyword selection to find films similar to Alligator?
<< FIND THEM HERE! >>

Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Alligator (1980)

Ramon the alligator is flushed down the toilet as a baby and grows into a gargantuan monster by eating the corpses of laboratory animals who have undergone dubious hormone experiments, thus providing all the ecological and social subtext that one could possibly wish for, even if one doesn't normally β€¦ go for films about giant alligators eating people left, right, and center--which is the inevitable and tragic result of Ramon's decision that the outside world looks rather more interesting than the sewers.... (Read More)

Subgenre:
creature featuretragedycult filmindependent film
Themes:
monsterdeath
Mood:
nightnightmare
Locations:
police helicopterboat explosionsewerchicago illinoislakecitypolice carpolice stationurban settingswimming poolhospital
Characters:
younger version of charactermayornative americanpolicemannursepolice
Story:
flushing toiletanswering the telephonefilm cameramale underweartelephone callpolice radiochild killed by animalman versus beastkilled by an animalkilled in an explosionfake bombplainclothes officernature run amokhuman versus animalmissing man β€¦chewing tobacconewsmannewswomanknocking on a windowtalking in a carchild eatenwoman killedexplosivessaying thank youbomb explosioncash registerdiving boardman in bedmanholewild animallooking in a windowpet shopcharacter says i'm sorrywoman driverclipboardreptilehard hatlooking at pictureshaking handsannouncerthreatened with a gunthreat to killblond manpagerchild killedbridesmaidtrolleytalking while drivinggiant animalfade to blackblack coptoxic wastewaking upeuphemismhospital bedmicroscopelying on bedmoustachealligatorsuicide bombermotorboatredheaded womanblack manurban legendlockertimebombsaving a lifechauffeursevered legbriefsmutationbarbecueslaughterpollutiontaking a picturecrushed to deathremote controltrappedgas maskanimal attackdriving a cartorchpress conferencewristwatchscene during opening creditsbeardhunterwoman with glassesfemale stockinged legsapplauseblack americangraffitisevered armratpolicewomandisappearancefirst of seriesmicrophonebinocularslimousinepolice officer killedold womanpantyhosevanunderwater scenesearchman with glassesmaptoiletmansionambulancenewspaperf wordreporterscientisttelephonecar crashbookcamerablondeunderwearpistolsurprise endingpartytitle spoken by characterphotographbare chested maleone word titleinterviewflashbackdogviolence (See All)

The Host (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Host (2006)

The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit β€¦e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)

Subgenre:
creature featuretragedycult filmindependent filmblack comedysuspenseasian horror
Themes:
monsterdeathmurderrevengesuicidekidnappingbetrayalfeardrunkennessescapefuneraldeceptionmilitaryangerdeath of father β€¦dysfunctional familygriefabductionpanicunemploymenthomelessnessenvironmentself sacrificenear death experience (See All)
Mood:
goresatirerain
Locations:
sewerpolice carhospitalsnowboatwatertaxielevatortrucktunnel
Characters:
nursepolicefamily relationshipsfather son relationshipfather daughter relationshipteenagerdoctorchildrenbrother brother relationshipbrother sister relationshipteenage girlsoldierpolice officerphotographerhostage β€¦little girllittle boydaughteramericanamerican abroadsingle fatherfishermangrandfather granddaughter relationshiphomeless man (See All)
Period:
2000syear 2000year 2006
Story:
child eatengiant animaltoxic wastemutationpollutioncrushed to deathremote controlgas maskanimal attackvansearchmapambulancescientistcamera β€¦pistolsurprise endingtitle spoken by characterphotographone word titleviolencebloodtwo word titleexplosionchasefirecryingcell phoneblood splatterurinationshotgunrescueslow motion scenewatching tvshowdownrifleheld at gunpointbeertearsislandriversurvivalfoot chaseorphanflashlightgangambushdisguisebridgearmyimpalementfishfishingchild in perildouble crosscreaturenews reportlatex glovesflash forwarddangerprologueprotestpoisonrace against timecover updeath of childdeath of brotherinjectiontragic eventgovernmentsleepingsacrificesingle parenteavesdroppingsabotagesyringebow and arrowathleteburned alivehypodermic needleheavy rainmutantvirusdemonstrationmorguenosebleedgiantdesperationjumping from heightskullparking garageeaten aliverampagepump action shotgunbraverymourningpower outagehungerevacuationheadphonesescape attemptdead childinfectiongasolineburned to deathsirenmedia coverageparking lottext messagingfinal showdownmolotov cocktailkoreagiant monstersuit and tiedead childrenshot with an arrowarcherymedalchangeshot in the eyewetting pantsmegaphoneteenage daughtertentaclesouth koreashot through the mouthquarantinearcherhomeless personrecreational vehiclecoughing bloodcheckpointpsychotronic filmimprovised weaponanimal killingmortuarygrindhouse filmstarvinglootingdustflaming arrowrescue attemptkaijujumping off a bridgesquidhazmat suitflash driveboneshuman skulltarget shootingmealblood samplebiohazardvomiting bloodchild in dangersocial criticismreference to robin hoodlong tongueseoulbeer cancollege graduatetoxicurinating in fearman eating monsterboy eatenpaddle boathypodermicbio hazardkiller fishman versus naturedemonstratorformaldehydelazyworld health organizationjumping from a bridgemounted animal headeaten by animalman versus monstersnack barbullseyecell phone tracedropkickirresponsible fatherriot squadchild killed by an animalbronze medalworld cinema (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Scanners (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scanners (1981)

Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β€¦'t, and converts him to their cause - to destroy the underground movement. (Read More)

Subgenre:
tragedycult filmindependent filmsuspenseconspiracyparanormal phenomenabody horror
Themes:
deathmurdersurrealismsuicidepregnancytortureescapeinvestigationdeceptionpsychopathbrutalitysupernatural powerterrorismsurveillancehome invasion β€¦exploitationregret (See All)
Mood:
nightgorecar chase
Locations:
trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire
Characters:
doctorbrother brother relationshipartisthitmansecurity guardprofessorself mutilationhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer
Period:
1980s
Story:
telephone callknocking on a windowlooking at pictureshaking handsthreatened with a gunthreat to killfade to blacklying on bedcrushed to deathdriving a carpress conferenceman with glassesscientisttelephonecar crash β€¦pistolsurprise endingtitle spoken by characterphotographbare chested maleone word titleflashbackviolencebloodcigarette smokingexplosionchasefirecorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapshot in the headshotguncomputerwritten by directorfalling from heightshowdownheld at gunpointinterrogationhallucinationrevolvershot in the backsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologycigar smokingshot in the legshot in the foreheadon the runduelscreamingperson on firefactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upevil manshot in the shoulderinjectionexploding bodyautomobileshot in the armcult directorpsychictraitorfalling down stairssabotagedestructionburned aliverevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothvisitgrindhouseladdermind controlart galleryreverse footagesurveillance camerablood on facegash in the faceshopping mallsculptureblack and white sceneexploding headlaughterthrown through a windowopening a doormeetingburned to deathtelekinesisholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womancrashing through a windowwoman kills a manshot in the handseizurebullet woundsuper powerburnt bodypsychic powershot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gundriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonemegacorporationwaiting roomextrasensory perceptiontranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemdrill in the headcomputer programpharmaceuticalsbus crashdart gunscannerside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpsehypodermicexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All)

The Bay (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Bay (2012)

This "found-footage" film is set in 2009 in the town of Claridge, Maryland on the Chesapeake Bay. During the town's annual 4th of July Crab Festival, townspeople become sick, exhibiting a variety of symptoms, which leads local news reporters to suspect something has infected the water there. No one  β€¦is sure what it is or how it's transmitted, but as people start to behave strangely, and others turning up dead, fear spawns into panic. The town is shut down as government authorities confiscate video footage from every media or personal source they find, in an effort to cover-up the incident. But one local reporter who witnessed the epidemic, was able to document, assemble, and hide this film in hopes that one day, the horrible truth would be revealed . . . (Read More)

Subgenre:
tragedymockumentaryfound footage
Themes:
deathmurdersuicidedrinkingfearinvestigationbrutalityillnesscrueltypanicenvironmentmadnessmysterious death
Mood:
nightmaregore
Locations:
police carhospitalbeachcarsmall townboatwaterseaoceantown
Characters:
mayorpolicemanpolicehusband wife relationshipdoctorpolice officerbabykillerterrorfemale scientistout of control
Period:
2000s
Story:
telephone callpolice radiomotorboatsevered legpollutionwoman with glassesmicrophoneunderwater sceneman with glassesambulancereporterscientisttelephonecar crashcamera β€¦title spoken by characterinterviewflashbackviolencebloodguncell phonecorpseshot to deathblood splatterfoodcar accidentshot in the chestshot in the headcomputerdrinkbikinisecretshootingvomitinglietelevisionsubjective camerajournalistvideo camerabridgeeatingweaponinternetaccidentfishnonlinear timelineradionews reportlooking at the cameratalking to the camerapaindangerscreamingfactorycover upscreamscene during end creditsamerican flagtragic eventsplit screenthreatunderwaterchickenfreeze framedisastertv newsrevelationdressinjurytouristdiseasemutilationsecurity camerapatientyoutubedesperationswimsuitaudiencefestivaldead womanhomicideeaten alivedivingecologychaosanxietyinfectionseasidehandheld cameradead mancellphonepierfemale reportersurgeontank topcrowdplantt shirtharbortruthtourismdark secretshortscar drivingwebsitewebcamnight visioncameramanhospital roomradio stationmarried couplesicknessdeputypoisoningamputationinternet videoindustryemergency roomshirtcrabmaggotfrightparasitemenacetv interviewdead birdfourth of julyriskanguishmedical doctorportscaretelevision reporteroutbreakwater fountainloss of controlfemale journalistsmartphonecatastrophecontaminationmass mediawaiting roomdigital cameramarylandskypedesolationinterviewercreekhidden truthdead fishblousesevered tongueperilseashoreintoxicationgooglebayenvironmental disastermass deathshorehomeland securityblood vomitingcomputer screenreportindependence dayseaside townjeopardytoxinblistercautionary talerashwater pollutioncontaminated watermass hysteriatight pants24 hourslarvalesioncamera operatorecological disasterwashed ashorewater contaminationbig buttfemale patientpoisoned foodboilpoisoned waterfemale tv reporteroceanographerchesapeake bayenvironmental contaminationpolluted environmentcrustaceanfestivitycontaminated foodscientific investigationwikipediaenvironmental pollutionirritationmass panicskin rashcenter for disease control (See All)

Piranha 3d (2010) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Piranha 3d (2010)

Lake Victoria's annual Spring party by 50,000 young revelers is about to turn into a feeding frenzy with prehistoric hunger-pains. With knee-trembler's above the waves and tremors below, released from their dormant sleep, thousands upon thousands of flesh-eating nippers are released into the lake wi β€¦th whetted appetites and razor-sharp teeth. With a motley crew of strangers thrown together to defend these shores, it is now up to them to prevent the largest eat-out in human, and piranha, history. (Read More)

Themes:
monsterdeathdrunkennessvoyeurismexploitationpanicself sacrifice
Mood:
gorehigh schoolhorror movie remake
Locations:
lakebeachmotorcyclesmall townboatcavewater gun
Characters:
mother son relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipsingle mothersheriff
Story:
male underweartelephone callpet shopmotorboatsevered legslaughtercrushed to deathanimal attackscene during opening creditssevered armpolice officer killedf wordscientistblondepistol β€¦surprise endingpartytitle spoken by characterbare chested maleviolencefemale nuditynuditynumber in titlebloodmale nuditybare breastsfemale frontal nuditymale rear nudityfemale rear nudityfemale full frontal nuditylesbian kissleg spreadingpantiestopless female nuditycell phonecorpsedigit in titleblood splatterremakeshotgunrescuearrestbikinisex in bedbare buttfalling from heightvomitinganimal in titlehandcuffsvoyeuralcoholdecapitationcleavageflashlightold manmassacrevideo cameracocainefishwhite pantiessevered headscantily clad femalefishingchild in perilskinny dippingelectrocutionmini skirtchampagnefemale removes her clothescheerleaderexploding bodystagefirst partunderwaterdismembermentropepornographydestructionkilling an animalno pantiesnipples visible through clothingeggtouristwalkie talkiedesperationsevered handskullcoituscgieaten alivecameoflood3 dimensionalgash in the faceporn starrowboatensemble castaquariumexploding headdisembowelmentarizonaparachuteeye gougingraised middle fingerpiertank topcopulationlyingfast motion scenetorso cut in halftracking devicefemale female kissdjnude swimmingtaserscene before opening creditsfemale removes her dressnudelegsfish tankflarenude girldeputybitten in the neckdripping bloodeyeballcrushed headman in swimsuitscuba divingteethfemale police officerspeedboatwoman in a bikinitequilacut into piecescocaine snortingmurder of a nude woman3d in titlesevered footdiverspeedoteenage herox rayed skeletonexploitation filmexploding boatfemale in swimsuitjet skistun gunfossilsliced in twobitten handface ripped off3 ddebaucherypiranhamass killingbody torn apartexposed breastwater skiingbitten on the armbinge drinkingpartyingsevered penisporn directorscalpingsevered faceexpertwatching pornographytorn in halffish in titlescuba diverinternet pornographybitten in the facebeer kegfinger bitten offhole in chestsplit in twokilled by a propellerpenis bitten offstranded on an islandwhirlpoolman eating monsterwet t shirt contestsinking boatporn actor in mainstream moviekiller animalfemale sheriffthrown from a boatbitten on the legunderwater cavecamera manloss of limbbuxom womancaught watching pornographycliff divingkiller fishskin torn offboat crashman in a swimsuitleg bitten offwhen animals attackpropanebloody waterpara sailingschool of fishseismologisthand bitten offloss of penisbitten by a fishexplicit female nuditycamera focus on female chestlake havasumaelstromwoman sheriff (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lake Placid (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lake Placid (1999)

What happens when a man-eating crocodile begins picking off tourists in beautiful Lake Placid? What if the crocodile wants to make it his home?

Subgenre:
creature featurecult filmblack comedyfish out of water
Themes:
monsterdeathinfidelityvoyeurismnaturecampingwilderness
Mood:
gore
Locations:
lakehospitalnew york cityforesthelicoptersmall townboatwaterwoodsrural settingcampfiremuseumnew englandsea monster
Characters:
policeboyfriend girlfriend relationshipsheriffbabe scientist
Period:
1990s
Story:
giant animalmicroscopeanimal attackpolicewomanbinocularsunderwater sceneambulancescientistblondesurprise endingbloodhorseurinationshot in the headrifle β€¦voyeurrevolverswimmingdecapitationcleavagewidowsevered headscantily clad femalecreaturetentlaptophandgunbearcowmorgueeccentriceaten alivedivingboston massachusettsmillionaireplaneswampexploding headcanoecrocodilehuntdeputymaineanimal killingstupid victimdivertoothremotetranquilizer dartbaittorn in halfbased on cult favoritebear attackpaleontologistamphibiangiant crocodilesevered toetorso bit in half (See All)

Christine (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Christine (1983)

In 1957, in Detroit, a red Plymouth Fury is built and is the cause of two accidents, one of them fatal, still in the assembly line. Twenty-one years later, the outcast and bullied nerd Arnold "Arnie" Cunningham is getting a ride with his best and only friend Dennis Guilder and he sees the wrecked ca β€¦r for sale in a garden. Arnie immediately falls in love with the car. The car was given the name Christine by its first owner. He brings the car to a repair shop of the despicable Will Darnell and works hard to restore the classic car. While he works in the restoration, he changes his personality to a cocky teenager and he dates the most beautiful girl in the high-school, Leigh Cabot. Soon Arnie becomes selfish and jealous of the supernatural Christine that kills everyone that is a threat to them. (Read More)

Subgenre:
cult filmsuspensesupernaturalparanormalpsychological dramaamerican horror
Themes:
deathrevengechristmasghostangerpsychopathobsessiondysfunctional familymadness
Mood:
nightrainhigh schooldarkness
Locations:
hospitalcarsmall towntruckcar on fireold carkiller carkissing in a car
Characters:
father son relationshipmother son relationshipteenagerbullykillervillain
Period:
1970s1950syear 1979year 1978
Story:
answering the telephonefade to blackhospital bedlying on bedlockersaving a lifecrushed to deathdriving a carwristwatchman with glassesf wordtelephoneblondetitle spoken by characterone word title β€¦violencecharacter name in titlebased on novelshotgungood versus evilcaliforniadeath of friendbrunetteapologypossessionstalkingautomobilethreatprofanitykillinggarageelectronic music scoregothicsociopathragevisitgrindhousenew year's evechokingrampagereverse footageswitchbladedead manfriendship between boysbody countcharacters killed one by onevillain played by lead actormadmancrutchesevil spirittelling someone to shut uplooking out a windowlibrarian17 year oldwhistleclimbing through a windowboy with glassesbare chested boytitle same as bookcar radiobloody violencebulldozersong during end creditsimmolationfinding a dead bodygrindhouse filmfootball gamedrive insouthern californiamusic score composed by directorsexual euphemismscreaming in painfamous songdrive in classicscreaming manhonking a car horncorpse with eyes openfriendship between teensyear 1957drive in theateryear 1958exploding gasoline stationopening a windowheimlich maneuveroverprotective parenttwo friendsvandalizing a carsmart carpetrol stationblowing a whistlecar parktelephone call in bedanimate cargarage door openerlocked in a carcrashing into a car (See All)

Slither (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Slither (2006)

In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman,  β€¦will try to stop him and the plague of worms generated by the creature. (Read More)

Subgenre:
creature featurecult filmblack comedyb movie
Themes:
monstermurderdrunkennesscannibalismmurder of a police officer
Mood:
gorehigh school
Locations:
police stationswimming poolbarforestsmall town
Characters:
mayorpolicemanhusband wife relationshipteenagerzombiealiencountry singer
Period:
year 2005
Story:
mutationanimal attackpolicewomanmapcar crashpistolpartyphotographbare chested maleone word titleflashbackviolencesexbloodmale rear nudity β€¦explosioncorpseshot to deathblood splattershot in the chestshot in the headshotgunwritten by directorrifleclassroomdecapitationfoot chasebandimpalementstabbed to deathstabbed in the chestsevered headchild in perilhit by a cartransformationshot in the foreheadcharacter repeating someone else's dialoguedomestic violenceexploding bodybasementcharacter says i love youdirectorial debuttwincowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controleaten alivealien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Dead Zone (1983) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
tragedycult filmindependent filmsuspensesupernaturalparanormalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror
Themes:
deathmurderlovesurrealismsuiciderapechristmasfearinvestigationdeceptionpsychopathsupernatural powerdeath of motherparanoiablackmail β€¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All)
Mood:
neo noirslasher
Locations:
police carhospitalschoolchurchsnowwheelchairtrucktunnelschool teacherfire truck
Characters:
nursehusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerserial killerphotographerbabylittle boyvillainpsychiatrist β€¦snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All)
Period:
world war two1980s1970swinterseeing the future
Story:
child killedslaughterpress conferencepolice officer killedunderwater sceneman with glassesmansionambulancef wordreportertelephonecar crashpistolsurprise endingtitle spoken by character β€¦photographflashbackfemale nuditybased on novelbloodkissexplosionchasefireshootoutdreamcorpseshot to deathblood splattercar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointhandcuffsrevolvergood versus evilflashlightpoliticianstabbed in the chestassassinationchild in perilnews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomamutilationexploding buildingloss of wifesevered handgrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatedental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

The Blob (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Blob (1988)

Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com β€¦plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)

Subgenre:
creature featurecult filmindependent filmblack comedysuspensestop motion animationteen romancebody horror
Themes:
monsterdeathmurderfriendshipfeardrunkennessescapedeceptionmilitaryparanoiaredemptionpaniccourageself sacrificenear death experience β€¦unlikely hero (See All)
Mood:
gorehigh schoolpoetic justiceone nighthorror movie remake
Locations:
sewerpolice carpolice stationhospitalchurchforestcarhelicoptersnowmotorcyclecemeterysmall townwoodskitchenouter space β€¦car motorcycle chasemotorcycle chasetruck accident (See All)
Characters:
nursepolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girlteenage boy β€¦soldierpriesttough guywaitressvillainbiblesheriffself mutilationhomeless manbiologistalcoholic drink (See All)
Period:
1980s
Story:
child eatenmanholeurban legendmutationcrushed to deathsevered armratpolice officer killedvanmapambulancescientistpistolsurprise endingdog β€¦violencebloodguncigarette smokingexplosionchasefirecorpseblood splattermachine guncar accidentremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverdecapitationsurvivalorphanflashlightambushaxedeath of friendbridgefootballdinerexploding carfalse accusationsevered headanti herodisarming someonechild in perilhit by a carcreaturenecklacetransformationdangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderfilm within a filmexploding bodydatedismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachersocial commentarybikereaten alivefemale warriormechanicrampagereverse footageexplosivebraveryu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiumjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage lovefirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemexperiment gone wrongmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stuntjumping from a carhazmat suitmotorcycle crashprojectionistyo yosinkmass deathbiohazardjarpart stop motionfreeze to deathbiological warfaregeiger counterblobtown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikecrash siteevil preachertoilet plungerteen heroteen couple eaten (See All)

Piranha 3dd (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Piranha 3dd (2012)

Having awoken from their spring break extravaganza at Lake Victoria, the swarm heads upstream where they look to make a meal out of Big Wet, a local water park where when it comes to fun, nobody does it wetter! Though they came to get wet, get loaded and get some, the staff and patrons get more than β€¦ they bargained for when they must face the fiercest, most bloodthirsty piranhas yet. Lead by the strong-willed, studious Maddy and her friends, Barry and Kyle, the trio must dive in and take on these man-eating creatures using every ounce of their being but can they be stopped? (Read More)

Subgenre:
creature featureindependent filmblack comedysuspenseabsurdismteen moviesurvival horrormonster movie
Themes:
deathfriendshipfearescapevoyeurismseductionparanoiaunrequited loveexploitationpaniccouragemurder of a police officernear death experienceghost townfear of water
Mood:
nightmaregorepoetic justice
Locations:
lakepolice carswimming poolhospitalbathtubwaterwheelchairmotelsex in a carcar in waterwater pistolwater wellsex in vansex in a van
Characters:
teenagerboyfriend girlfriend relationshipteenage girlpolice officerlove triangleinterracial relationshipsheriffex boyfriend ex girlfriend relationshipself mutilationstepfather stepdaughter relationship
Period:
2010ssummer
Story:
telephone callchild killed by animalsevered leganimal attacksevered armpolice officer killedvanunderwater sceneambulancef wordscientistblondesurprise endingpartybare chested male β€¦violencefemale nuditynuditynumber in titlebloodmale nuditybare breastssequelthreesomefemale frontal nuditymale rear nuditykissfemale rear nudityfemale full frontal nudityexplosionknifeleg spreadingchaseerectionpantiestopless female nuditycell phonecorpsedigit in titleblood splatterurinationshotgunrescueslow motion scenepunched in the facecondomundressingbikinisex in bedbare buttsunglassessecond partanimal in titlehandcuffsvoyeurstrippersubjective cameradecapitationcleavagesurvivalgay slurflashlightmassacredeath of friendmontageimpalementfishsevered headno opening creditsscantily clad femalechild in perilhit by a carnews reportdrowningskinny dippingvirgindangerkeyattackdeath of childcollege studentskeletonscene during end creditsfarmerpremarital sexunderwaterprofanityfireworkscowcorrupt copsingle parentgirl in pantiespickup truckactor playing himselfkilling an animalno pantiesloss of virginityeggwalkie talkieloss of loved oneeccentricyoutubeflatulencecovered in bloodfroggrindhousecoituscgiinterracial friendshipeaten aliverampageredneckdivingreverse footagecameofloodsevered fingerbravery3 dimensionalevacuationescape attemptblack and white scenecigarette lighterswamp3dsexploitationaccidental killingaerial shotarizonatitle at the endcastrationpierdeath of loved onetan linecopulationblack bra and pantiesfast motion scenemarijuana jointblood on camera lensbriberybloopers during creditsvomitdead animalblue pantiesnudecrutchesstepfatherautographvulgarityamputeewhistlefish tanknude girlhead bashed indeputywoman in bra and pantiesman in swimsuitdeath of boyfriendsole black character dies clicheextreme violencewet t shirtgraphic violencewoman in a bikinilifeguardcamera phonebloody violencetongue in cheeksong during end credits3d in titleanimal killingstupid victimkeyboardgas explosionfemale in swimsuitexcrementsexual innuendodouble entendresurprise during end creditsmascotwoman punches a manfemale explicit nudityfossilface ripped offpiranhanumber 3 in titleloss of boyfriendsevered penismass deathgory violencesequel to remakewater slidefish in titlehandcuffed to a pipebitten in the facetridentpenis bitten offpainful sexcorrupt sheriffwater parkbeheadeddead cowkiller animalmarine biologistmarine biologybitten on the legdecapitated childgiant fishhead bitten offaquaphobiakiller fishman vs naturecrying for helpleg bitten offbitten in the armcinder blocktv advertbitten in the legfictional placebitten by a fishshark costumetitaniumcelebacyunderground lake (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Flatliners (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Flatliners (1990)

Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β€¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)

Subgenre:
tragedycult filmblack comedysuspensemedicalpsychological thrillerpsychological horror
Themes:
deathrevengesurrealismsuicidebetrayalfearescapememorydeath of fathersupernatural powerparanoiaredemptionguiltbullyingcruelty β€¦panicchildhoodtraumavengeancedrug addictionforgivenessnear death experienceafterliferegretchildhood traumasuicide of father (See All)
Mood:
nightmareneo noir
Locations:
chicago illinoisurban settinghospitaltrainschoolforestsnowcemeterywoodsapartmenttruckmuseumlaboratory
Characters:
nursefather daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorchildrenboygirlsoldierlittle girlbullywaitresslittle boyfiance fiancee relationshipsuicide by gunshot β€¦self surgerystudent nurse (See All)
Period:
1990s
Story:
telephone calltaking a picturecrushed to deathwoman with glassesman with glassesmansionf wordtelephonepistolsurprise endingpartytitle spoken by characterphotographbare chested maleone word title β€¦flashbackdogsexbloodbare breastskisscigarette smokinginterracial sexknifechasetopless female nuditycryingbeatingcorpseshot in the headrescueslow motion scenepunched in the facewatching tvfalling from heightbedbathroomhallucinationsciencesubjective camerahalloweenfoot chaseflashlightmountainvideo cameramontageimpalementdinersubwayapologygraveyardcigar smokingmarriage proposaltreedrug addictbeaten to deathdangerscreamingpay phonecharacter's point of view camera shotrace against timestatuedeath of childbaseball batcollege studentuniversityhalloween costumelong takemanipulationscaramerican flaginjectiontragic eventdeath of husbandloss of fatherpremarital sexcharacter says i love youheroinfreeze framesurgeryhugginganswering machinesyringerevelationelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorcaketape recordergroup of friendsvideotapeaccidental deathphone boothwomanizerback from the deadreverse footagehaunted by the pastvisionplaygroundattempted suicidepower outagegash in the facepunched in the stomachresurrectionconvenience storejunkiefalling to deathkicked in the crotchblack and white scenepunched in the chestengagementautopsyaccidental killingaerial shotswingfemale doctorinsultlooking at self in mirrordead boyfieldloss of husbandsurgeonhalloween partymoral dilemmachildhood memorypromiscuityatheistfast motion scenehit with a baseball batclose up of eyesintestinesreference to elvis presleyvietnam veteranalleyspit in the faceremorsename callingbully comeuppanceyoung version of characterclimbing through a windowbroken mirrorteasingscalpelgreenhousemedical studentbiologyfrankensteinexperiment gone wronghome videocamcorderoperationmenacehuman experimentheroin addicthoodieswingingbrain damageanimal killingscience runs amoktrenchcoatmedical professionmedical experimentrenovationanswering machine messageel trainfall to deathjumping roperepressed memorycadavercprmedical schoolred lightdefibrillationdefibrillatorvideotaped sexdying womanhit with a rockskeleton costumeremadepickaxefalling from a treescience experimentdissectionhockey stickout of body experienceneondumped by girlfriendsecret laboratorybelief in the afterlifehorror movie remadeadrenalinebullet holeconfettichildhood flashbacksplit lipswing setinside the mindvirtualitythrowing a rockmullet haircutescalationhopscotchtambourinegrade schoolnitrous oxidepathologybreaking up with boyfriendplaying godtrailer narrated by don lafontainepickup linesecret filmingwelcome home partyblue lightmedical examurban gothicbrain deadfighting with selfsweatshirtwounded dogred hoodpicture of jesusstitching one's own woundreligious imagery (See All)

King Kong (1933) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Kong (1933)

Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find β€¦ out. Living on this hidden island is a giant gorilla and this beast now has Ann in it's grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. (Read More)

Subgenre:
creature featurecult filmstop motion animationmonster movie
Themes:
monsterdeathlovekidnappingmoneyfearescapedancefilmmakingpovertyabductiontheatreexploitationgreedpanic β€¦dyingunemployment (See All)
Locations:
lakenew york citybeachtrainhotelmotorcycleairplaneboatvillageshiprooftopcavejunglecampfireairplane accident β€¦sea monstertrain driver (See All)
Characters:
policemanpolicedanceractorphotographerbabyhostageactressfilm directorchinesefiance fiancee relationshipship captaindeath of herowitch doctor
Period:
1930s
Story:
film cameratelephone callgiant animalcrushed to deathanimal attacktorchbinocularsunderwater scenesearchmapreportercamerablondeviolencecharacter name in title β€¦based on novelbloodtwo word titlegunkissfightdancingexplosionknifechaseshot to deathmachine guncar accidentrescueundressingfalling from heightriflebombrunningbedhandcuffsislandrevolvermanhattan new york citysubjective cameraswimmingstrangulationmountainstabbingwomanbridgedinersnakebirdradioritualkingjourneypilotscreamingcharacter's point of view camera shotmissionscreamflowerspursuitneck breakingsadnesstied upsacrificemonkeydisasterspearwoundfaintingfamelifting someone into the aircookblockbustergiantbrideladderfemale tied uppart animationappleeaten aliverampagedamsel in distressshopliftinghungerfalling to deathtitle appears in writingtheatre audienceswampfogclifftribesailortuxedorescue missionpipe smokinganimal name in titledrumsceremonyexpeditiongatecanoemovie producergiant monsterhuman sacrificegorillaplane crashwallraftfalling into waterbeasttheatre productionhand over mouthgreat depressionwhistlingmeat cleaversense of smellclimbing a treetitle in titlebroadway manhattan new york citymarriage engagementtyrannosaurus rexprehistoric timesorchestral music scoreapeair raiddeath of title charactermotorcycle copradio newsaltarchainsanimal killingbiplanefamous linestarvingflash camerafleeinglogvulturewoman in dangerchrysler building manhattan new york cityfootprintlifting female in airgiant spiderretreatshacklesscreaming in fearel trainkaijulong island new yorkair strikevineempire state building manhattan new york cityalliterative titlesoutheast asiagiant creaturelifting an adult into the airremadetriceratopstheatrical agentnew york city skylineends with deathscreen testtrain wreckanimal deathsource musicdestruction of propertylarge format cameranative tribepterodactylfalling treesitting in a treegongking kongsimian fictionravinechasmman eating monsterexotic localetrain derailmentsteamshipwoman as objectfilm extralost civilizationbegins with a quotestegosaurustheatre marqueebogbroken jawcontemporary settinglost worldmonster as victimsymphonic music scorebrontosaurusdisaster in new yorkfeathersanimal fightdirector actor relationshipgiant apeclimbing up a buildingwater canteengiant crabescaped animalstomped to deathleitmotifship's crewbleeding mouthpeeling potatoesmortal woundmouth forced openreference to beauty and the beastbitten to deathbomb throwinggorilla costumeoutrigger canoegrass skirtfruit vendorgas bombpartially lost film (See All)

Cursed (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cursed (2005)

Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji β€¦mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)

Subgenre:
creature featurecult filmindependent filmblack comedysuspenseabsurdismteen movieteen horrormonster movielgbt horror
Themes:
monsterdeathmurderrevengesurrealismjealousyfeardrunkennessescapeseductionsupernatural powerparanoiawrestlingrivalryhome invasion
Mood:
nightnightmaresatirehigh school
Locations:
police carbarlos angeles californianightclubelevatorofficemuseumfire truck
Characters:
policehomosexualteenagerboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature
Period:
2000s
Story:
animal attackscene during opening creditslimousineambulancecar crashpistolsurprise endingpartytitle spoken by characterphotographbare chested maleone word titledogviolencenudity β€¦bloodmale nuditymale rear nuditykissfemale rear nudityfightknifechasecell phonebeatingcorpseshot to deathfistfightcar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the faceswordbrawlbare buttfalling from heightshowdowndead bodybathroomdecapitationfoot chasegay slurorphanambushcaliforniamassacrestabbed to deathdinerstabbed in the chestinternetsevered headhit by a carcreaturenews reporttransformationshot in the foreheadpublic nuditycursecoming outelectrocutionattackproduct placementknocked outkicked in the faceshot in the shoulderscargymhigh school studentcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzawerewolfactor playing himselfwolflooking at oneself in a mirrorcatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivaleaten alivefull moonrampagecameoblood on facestabbed in the throatpower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowbody landing on a carcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hosthuman becoming an animalcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalahowlingwoman hits a mangay jokesilvertroubled productiongay athletepublicistlycanthropypalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationlycanthropeburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Critters (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Critters (1986)

A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.

Subgenre:
creature featurecult filmindependent filmblack comedysuspenseb moviesurvival horrormonster movie
Themes:
monsterdeathmurderlovesurrealismkidnappingfeardrunkennessescapedeceptionsupernatural powerparanoiahome invasionpaniccourage β€¦near death experiencespace travel (See All)
Mood:
nightsatire
Locations:
police carpolice stationbarchurchhelicoptersmall townbicyclekitchenfarmrooftopouter spacebicycle accident
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralienpriesthostagelittle boy β€¦alcoholicsheriffalien monster (See All)
Period:
1980s
Story:
mutationscene during opening creditsfirst of seriespolice officer killedtoilettelephonecar crashsurprise endingtitle spoken by characterphotographone word titleviolencebloodcigarette smokingexplosion β€¦knifefirecorpseshot to deathblood splattercar accidentshot in the chestshotgunrescueslow motion scenewatching tvcatrifleheld at gunpointbombrevolveralcoholsubjective camerasurvivalbedroomflashlightambushaxeimpalementradiochild in perilspaceshipcreaturenews reportbartendertreedangerprologuescreamingelectrocutionpay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batlightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggbarnjail cellspacecrafteccentricphone boothlasersocial commentarybroken legeaten alivemechanicredneckwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boylaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All)

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β€¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
cult filmindependent filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
deathmurderfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion β€¦exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
goreraincar chaseambiguous ending
Locations:
lakehospitalforestbathtubbicyclewaterwoodsfarmtruckcavegas stationcampfirebackwoodsshed
Characters:
policefather son relationshipafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog
Period:
2000s
Story:
severed legslaughteranimal attacktorchhunterblack americansevered armbinocularsambulancef wordblondepistolsurprise endingpartyphotograph β€¦bare chested maleflashbackdogviolencefemale nuditybloodfemale frontal nuditymasturbationsex scenefemale rear nuditycigarette smokingfingeringknifechasepantiesshowerfirecell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backswimmingdecapitationcleavagesurvivalfoot chasegay slurambushaxemassacredeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt coppickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseaseviruseccentriccovered in bloodgrindhousepeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistdeerdisfigurementranchcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Dead Calm (1989) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dead Calm (1989)

An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.

Subgenre:
cult filmsuspense
Themes:
deathmurderkidnappingrapeadulterytortureseductionpsychopathbrutalityobsessiondrug useinsanitygrief
Mood:
nightnightmarerain
Locations:
police carhospitaltrainaustraliaseashipoceanyachtstorm at seaship on fire
Characters:
policemanpolicehusband wife relationshipdoctorserial killerdancerphotographerhostageaustralianterroraustralian abroaddeath of killer
Story:
looking at picturelying on bedtrappedwristwatchmicrophonebinocularsunderwater scenephotographbare chested maleviolenceflashbackdogsexfemale nuditybased on novel β€¦bloodmale nudityfemale frontal nuditymale rear nuditytwo word titlekissfemale rear nudityfightcigarette smokingdancingknifechaseshowerfirecryingsongbeatingcorpsefoodcar accidentshotgunrescuebare buttheld at gunpointtearssunglassesdead bodysubjective cameraswimmingflashlightsubwayapologyradiodrowningduelkeyevil mandeath of childdeath of sonisolationsuspicionmurdererdie hard scenariomaniacsociopathsurvivorcaptivestrangerhome movierailway stationblack humorpassportwoman in jeopardydivingphoto shootpillsloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticpsycho killerminimal castalonesailboatsailingraftdegradationmarried coupleflareunconsciousnessdruggedswimming underwaterman in swimsuitstabbed in the shouldershot through the mouthtitle same as bookpsychological torturesole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodbathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dawn Of The Dead (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dawn Of The Dead (1978)

Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the β€¦mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)

Subgenre:
creature featurecult filmindependent filmblack comedydark comedyb moviepost apocalypseabsurdismdystopiasurvival horrorzombie apocalypseamerican horrorindependent horroritalian horrorzombie outbreak
Themes:
monsterdeathmurderrevengesuicidekidnappingmoneypregnancyfearescapemilitaryrobberybrutalityparanoiasadism β€¦executionexploitationpanicapocalypsecannibalismpolice brutalityhuntingmurder of a police officernear death experience (See All)
Mood:
goresatirepoetic justicemurder of a boy
Locations:
restaurantcarhelicoptermotorcycleairplaneboatelevatorapartmentfarmtruckrooftoppennsylvaniafire truck
Characters:
policemanpoliceafrican americanboyfriend girlfriend relationshipdoctorzombiesoldierpolice officerpriesthostagetough guywarriorsecurity guardvillainprofessor β€¦sniperpolice shootoutsexistpolice doghispanic americanhunting partymurder of a girl (See All)
Period:
1970s
Story:
moustachesevered legmutationslaughtergas maskscene during opening creditsbeardhuntersevered armbinocularspolice officer killedvantoiletambulancescientist β€¦camerapistolsurprise endingphotographbare chested maleviolencedogbloodsequelguncigarette smokingexplosionknifechasefireshootoutbeatingcorpsearcade gameshot to deathblood splatterfoodmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewatching tvwritten by directorbattleswordgunfightfalling from heightvomitingrifleheld at gunpointsunglassessecond partbedlow budget filmrevolvertelevisioncombatkung fushot in the backsubjective cameradecapitationgood versus evilsurvivalgangambushaxemassacrebasketballdeath of frienddrug dealerwomanmontagebridgefootballstabbed to deathstabbed in the chestexploding carsevered headnunradiohit by a carcontroversycreaturenews reportcigar smokingshot in the legshot in the foreheadracial slurtrainingone against manypilotcharacter repeating someone else's dialoguedangerstabbed in the backscreamingprotestsuburbperson on fireattackcharacter's point of view camera shotmoaningknocked outkicked in the facedeath of childtough girlbaseball batopening action scenebankscene during end creditsscarbasementdie hard scenariothreatened with a knifeshot in the armhandguncult directordismembermentundeadchild murderstylized violencehenchmanrioteyeglassesdisasterhand grenadecard gamesupermarketgrenadebow and arrowburned alivehead buttelectronic music scoremass murderlooking at oneself in a mirrormachetesociopathhelmetdiseaseviruscowboy hatsecurity camerawalkie talkieloss of loved onehammerkicked in the stomachswat teamsevered handcovered in bloodgrindhouseend of the worldburialgun fuinterracial friendshipsocial commentarybikercannoneaten alivefemale warriorthugredneckstealing a cartarget practiceu.s. armycrossbowdual wielditalian americancannibalmercilessnesspower outagechaosstabbed in the neckshot in the faceshopping mallm 16butcherpsychotronicescape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestice skatingdisembowelmentoutlawghettoinfectionaerial shotblood on shirtracisttough copdisfigurementknife throwingsiegegasolinephiladelphia pennsylvaniapolice raideye patchbody countdead boyethnic slurdeath of loved oneburned to deathmoral dilemmamannequinmedia coveragefirefighterhit with a baseball batleather jacketdead girlbanditmexican americanblood on camera lensintestinesbad guyhysteriasidekickcandyliving deadhiding in a closetvomithead blown offepidemicspiral staircasegolf clubquick drawstolen moneyplaguebroken windowmallstabbed in the armclimbing through a windowgang violencefalling into waterflaskflaredepartment storeshot in the eyeanarchyhit by a trucksawed off shotgunhillbillymercy killingoffscreen killingbitten in the neckpiecheesen wordfriends who live togetherconsumerismdeath of boyfriendperfumecar set on firedirector also cinematographerextreme violencemeteorflesh eating zombiegraphic violencemotorcycle gangrepeated linewalking deadairfieldoutlaw gangcrowbarpuerto ricanradio newsbloody violencehit with a hammerzombie violencevending machinesledgehammertommy gunbiker gangshot through a doorgang leaderhedonismshopping cartcalendardreadlockselevator shaftfamous linekicking in a doorgrindhouse filmsocial decayberetoutbreaktechno musiczombie attackmotorcycle with a sidecarbitten in the throatlootingvinylice rinkhardware storejewelry storebandanabloody body of a childhelicopter pilotmacewrencharm ripped offrookie copdoomsdaynewscasterdecomposing bodysurprise during end creditsreanimationwheelbarrowbarricadedocksdinner dateharley davidsonheadbandsecret passagewayvideo arcadezombie childmartial lawjamaicancircular sawblowtorchphoto boothflesh eatinghangarpolice vigilantismblockadehousing projectgas grenadegolf ballham radioloss of boyfriendmidnight moviescalpingremadeabsurd violencenational guarddrive in classictire irongun storeanthropophagusmass deathtennis racketcontemplating suicideentrailsgory violencehorror movie remadezombificationsombrerotennis ballair ventbaseball glovehare krishnadumb policenewsroomhell on earthmorning sicknessleg ripped offderringergrowlingclaustrophobichordedeadly diseaseamateur radiogun shopstabbed in the eardouble child murderend of civilizationtelevision stationcomplainingevil nuncontemporary settingemergency broadcast systemright hand manfirearm pointed at the cameragang that lives togethermilitary jeepracist copbiker chickdereliction of dutysidecarpie fightscally capthompson gungroaningracket ballpropanebikersbitten in the armmorning starshort wave radioshot at the camerabattle cryshooting a childbitten in the leggearing uphelicopter landing padlooternewsboy capbiker womenknit capmass panicmilitary jacketabandoned shopping mallbald zombiebiker babelong haired bikermuzak (See All)

The Lawnmower Man (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lawnmower Man (1992)

A scientist performs experiments involving intelligence enhancing drugs and virtual reality on a simple-minded gardener. He puts the gardener on an extensive schedule of learning, and quickly he becomes brilliant. But at this point the gardener has a few ideas of his own on how the research should c β€¦ontinue, and the scientist begins losing control of his experiments. (Read More)

Subgenre:
tragedycult filmindependent filmb moviecyberpunk
Themes:
deathmurderfriendshiprevengesurrealismfearescapepsychopathsupernatural powerparanoiainsanitysurveillanceabusecrueltymurder of a police officer β€¦artificial intelligence (See All)
Mood:
nightmare
Locations:
churchhotelgas stationlaboratory
Characters:
policemanpolicehusband wife relationshipfather son relationshipmother son relationshippolice officerpriestbullysecurity guardevil priest
Period:
1990s
Story:
telephone calltimebombanimal attackmansionscientisttelephonepistolsurprise endingbare chested maleviolenceflashbackfemale nuditymale rear nuditygunsex scene β€¦kissfemale rear nuditycigarette smokingexplosionshowerfiretopless female nuditydreamshot to deathmachine gunshot in the headshotgunrescuecomputershowdownbombhallucinationreference to jesus christprayerrevolverbedroomstrangulationdinerinternetchild abusechild in perilnews reporttrainingperson on firebased on short storyrace against timeinjectionexploding bodybasementpremarital sexmercenarysilencerwhippingpsychicmonkeywashington d.c.uzianswering machineburned alivekilling an animallooking at oneself in a mirrorcomic booksecurity cameracrucifixexploding buildingbuttocksirishvirtual realitymind controlpart animationcgischizophreniabald manmechanicwatching televisionrampageexplosiveinsectdelusiongasolinechairabusive fatherburned to deathabusive husbandtelekinesistelepathycrucifixionabuse of powercomputer crackerworld dominationmental retardationintelligencebeebully comeuppancemegalomaniacforeplaypsychic powerchimpanzeebeltpart computer animationanimal experimentationcut into piecesmind readingscience runs amokevil corporation555 phone numberscientific researchmegacorporationcomputer viruslawn mowerwife abusesweatinglemonadechalkboardmentally handicappedbuilding on firecyberspacecd playeranimate objectevil businessmangod complexbeating with a beltreference to the book of jobinsane womanlandscapingbody suitapple macintosh computergas pumpchristian crossbug spraykilled with a lawnmowerbrain capacitycomic book collectormind uploadingobject floats in the aircomic book collectionenhanced intelligence (See All)

Frankenweenie (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Frankenweenie (2012)

When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β€¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)

Subgenre:
stop motion animationpuppet animation
Themes:
monsterdeathfeargrief
Mood:
rain
Locations:
sewerpolice carswimming poolcemeterysmall townbicyclebaseball
Characters:
mayorhusband wife relationshipfather son relationshipmother son relationshipteacherstudentbabylittle girllittle boy
Story:
torchapplauseratmicrophonesearchambulancephotographone word titledogexplosionsingingfirecryingcorpserescue β€¦watching tvcatsecrettearsrunningneighborclassroomscienceflashlightcandlecoffindrawinghit by a carcreaturegravesuburbumbrelladollbaseball batlightningscreamspeechstagenewspaper headlinerecord playerexperimentballoonwatching a moviespiderlifelossphone boothfrogaudiencehome moviecarnivalfull moonpromisethunderpet dog3 dimensionalshovelaquariumturtlechainuncleposterbatfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairpet catslimearm slinghorror for childrenhunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpiregrave robbingscreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Creep (2004) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Creep (2004)

Heading home late one night after a party, Kate falls asleep while waiting for her train. She awakens to find herself trapped in the London underground, with all the doors locked for the evening. While being attacked by a co-worker who has followed her, a mysterious unseen creature drags him away an β€¦d kills him. This begins a terrifying ordeal, as Kate and a young homeless couple are stalked through the dark tunnels by something dangerous with payback on its mind. (Read More)

Subgenre:
british horror
Themes:
monstermurderrapetortureescapepsychopathinsanityillnesscannibalismabortionfear of sex
Mood:
nightgoreslasher
Locations:
sewertrainlondon englandenglandtunneltrain tunnel
Characters:
female protagonistserial killersecurity guardself mutilationacquaintance
Story:
hospital bedcrushed to deathtrappedratdisappearanceblondesurprise endingpartyphotographbare chested maleone word titleviolencedogbloodfight β€¦cigarette smokingknifechasebeatingcorpsepunched in the facefalling from heightflashlightstrangulationthroat slittingimpalementstabbed to deathsubwaydrug addictbeaten to deathknocked outattempted rapestalkingneck breakingtrapthreatened with a knifedismembermentsurgeryundergroundbreaking and enteringcagesurvivorsecurity cameracovered in bloodfaked deathpuzzlepresumed deadredneckgash in the facepunched in the stomachstabbed in the headhit on the headautopsyeye gougingstabbed in the eyebruisesodomycellarserial murdervideo surveillancehead woundhuman monstersubway stationescalatorunited kingdomhead bashed inheld captivelocked doorcrushed headhallwaybleeding to deathsole black character dies clichedisfigured facehomeless persondeformitystrangled to deathchainsdragging a bodypeep holestupid victimgrindhouse filmsheltercandlelightno endingtrail of bloodsubway trainpower failurepretending to be deadsliced in twonight watchmanintoxicationmidnight movierape attemptstabbed in the crotchwalking caneabortion clinicrubber glovesvagrantlondon undergroundunderground tunnelthrown from a trainreference to george clooneysubway tunnelfingernail cut offcrawling through an air shaftblood drainingskin torn offfetus in a jarcut headventbreaking someone's neckhorror moviethe unknown (See All)

Chernobyl Diaries (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Chernobyl Diaries (2012)

Americans Chris, his girlfriend Natalie and their friend Amanda travel to Europe on vacation. They meet up with Chris' brother Paul living in Kiev, Ukraine. Chris wants to travel to Moscow to propose to Natalie, but Paul convinces the group to first visit Chernobyl with an extreme tourism guide. The β€¦y meet the guide Uri and another couple who are also going on the tour. Uri explains that because of the radiation levels he can only take them to Pripyat, a deserted city very near Chernobyl. They travel by van, but are stopped by a military checkpoint that makes them turn back. Not giving up, Uri finds an alternative route to the town. The group spends the day taking photographs and exploring abandoned buildings. Uri becomes nervous and decides it's time to head home. However, the van won't start and they discover the engine was sabotaged. Soon they discover that they are stranded, no one knows they are there and that they are definitely not alone. (Read More)

Themes:
deathmurderfearbrutalityphotographycrueltypanicradiationghost town
Mood:
nightdarkness
Locations:
cityforestparis francebuslondon england
Characters:
boyfriend girlfriend relationshipbrother brother relationshipsoldieramerican abroadex military
Story:
toxic wasteurban legendpollutiongas maskanimal attackdisappearancevanmapcamerapistolsurprise endingphotographdogviolenceblood β€¦corpseshot to deathshot in the chestplace name in titleriverfoot chaseflashlightvideo cameradeath of friendfishstalkerdangerscreamingvacationscreamcity name in titlestalkingdarktrapbearkillingtouristrome italymutantgroup of friendswalkie talkiedesperationapartment buildingeaten aliveescape attemptshadowlens flaretripengagement ringdead dogukraineexplorationabandoned buildingconfusionstrandedabandoned househallwaytour guidefrightroadcheckpointscaredog attackcorridortrail of bloodcontaminationno survivorshung upside downnuclear power planthazmat suitabandoned carobscuritycity in ruinssingle locationnuclear reactorgeiger counterradiation sicknesschernobyl ukrainemysterious personkiev ukraineabandoned citycontaminated waterdisorientationdiversioneuropean tourbitten on the legmysterious individualoff screen deathfallout shelterchernobyl disasterdeadlynuclear radiationwild dogdeserted cityradiation suithiking boots (See All)

House Of 1000 Corpses (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

House Of 1000 Corpses (2003)

In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that  β€¦await. (Read More)

Subgenre:
creature featurecult filmindependent filmdark comedyslasher flicksadistic horror
Themes:
monsterdeathmurdersurrealismkidnappingrapejealousyfeartorturefuneralseductiontheftdeath of fatherinsanitymental illness β€¦sadismtheatrecannibalismmadnessmurder of a police officer (See All)
Mood:
nightmaregorerainslasher
Locations:
police carcemeteryroad tripcavegas stationmuseumtunnelshedcave in
Characters:
family relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor
Period:
1970syear 1977
Story:
urban legendcrushed to deathgas maskdisappearancesearchman with glassesmappistolsurprise endingphotographbare chested maleflashbackviolencenumber in titleblood β€¦dancingknifechasefirebeatingdreamcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousetied to a chairsevered headcoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikermasked manduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark househuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lat Den Ratte Komma In (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lat Den Ratte Komma In (2008)

Oskar, a bullied 12-year old, dreams of revenge. He falls in love with Eli, a peculiar girl. She can't stand the sun or food and to come into a room she needs to be invited. Eli gives Oskar the strength to hit back but when he realizes that Eli needs to drink other people's blood to live he's faced  β€¦with a choice. How much can love forgive? Set in the Stockholm suburb of Blackeberg in 1982. (Read More)

Subgenre:
creature featurecult filmcoming of age
Themes:
deathmurderfriendshiprevengesuicidedrinkingfeardivorcebrutalitybullyingcrueltychildhoodfalling in lovecourage
Mood:
nightgore
Locations:
lakepolice carswimming poolhospitalbartrainschoolforestsnowbathtubtaxiwoodsapartmentschool bullyblood on snow
Characters:
policemanpolicefather son relationshipmother son relationshipfriendboyfriend girlfriend relationshipchildrenboyteachergirlserial killervampirebullysingle motheralcoholic β€¦ex husband ex wife relationshipdeath of girlfriendvampire girl (See All)
Period:
1980swinter
Story:
telephone calllooking in a windowgas maskanimal attacksevered armunderwater scenenewspaperbookunderwearbare chested maledogfemale nuditybased on novelnudityblood β€¦female frontal nuditykisscigarette smokingknifefirecorpsefoodmirrorurinationcatdrinkarrestundressingfalling from heightvomitingliebeerdead bodybathroomneighborclassroomswimmingdecapitationflashlightgangthroat slittingbridgeeatingfemale pubic hairsubwaydinnersevered headradiodrowningattempted murdertreesuburblocker roomperson on fireliarreadingringneck breakingtied upthreatened with a knifeclasswhippingnewspaper headlinesingle parentrecord playerchainsaweavesdroppinghuggingfalling down stairsburned aliveaddictiongothiclooking at oneself in a mirrorlistening to musictape recorderrecordingloss of friendswimsuitcovered in bloodmilkbarefootswitchbladechild's point of viewattempted suicidewhipchild protagonistgash in the facehit on the headdark heroice skatinginfectionice hockeyblood on shirtmurder of a childsnowinggasolinedead boycellarnewspaper clippingvodka12 year oldcandyhit in the faceimperative in titlepubertyreading alouddead childrenlooking out a windowacidbully comeuppancedisposing of a dead bodyweightliftingclimbing through a windowfemale vampiresolitudemisfitcowboy bootslistening to a radiobitten in the neckdeath penaltydripping bloodscandinaviasense of smellbleedingurinalgurneykiller childdisfigured facegame playingsnowmobilepencilglowing eyesstarvingstockholm swedenhead ripped offbitten in the throatandrogynybloody body of a childblond boyhung upside downsledmultiple murdersscreenplay adapted by authorfrozen bodyrubik's cubefrozen lakepuzzle solvingraincoatsunlightfinger cutfield tripcold the temperaturevampire bitemorse codedragging a dead bodyband aidearvampire human lovemelting facestampsitting in a treeboys' bathroomclimbing up a walldivorced coupleear bleedingbleeding from eyesolder brotherweather reportcry for helpdangerous friendunderpasshandprintchild vampiretransistor radiobrushing one's teethcat loverdecapitated childtape deckthrown out a windowfunnelsleeping in a bathtubblood drainingwet hairdaughter murders fathergolden eggblindsclimbing up a buildingmislaid truststamp collectionwet pantssneaking intriple child murdercat attacksledgefrench poodlecutting one's handscare involving catbursting into flamesclass tripowning many catscutting the palm of one's handviaductdrained of bloodphysical education classphysical education teacheranimal senses evilbeating with a stickburning womanlistening through the wall (See All)

The Collection (2012) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collection (2012)

Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed β€¦ to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)

Subgenre:
martial artssurvival horrorsadistic horrorhorror b movie
Themes:
deathmurderrevengekidnappingtortureescapetrauma
Mood:
gore
Locations:
hospitalnightclub
Characters:
younger version of characterhusband wife relationshipfather daughter relationshipbrother sister relationshipserial killerfatherself mutilationmysterious villainserial murdererkiller dog
Story:
severed legslaughtercrushed to deathtrappedsevered armcar crashpistolsurprise endingpartytitle spoken by characterbare chested maleviolenceflashbackfemale nudityblood β€¦sequeltwo word titledancingexplosionknifelesbian kisschasecorpseshot to deathblood splatterfistfightshot in the chestshotgunslow motion scenepunched in the facesubjective cameramassacredeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headanti herochild in perilnews reportcharacter repeating someone else's dialoguestabbed in the backperson on firecharacter's point of view camera shotkicked in the faceskeletonexploding bodytrapcharacter says i love youmercenaryex convictobscene finger gesturedismembermentsyringegrenadeburned alivekilling an animalwarehousemass murdertied to a bedstabbed in the stomachspiderswat teamskullmexican standoffbroken legmasked mancamera shot of feetswitchbladesevered fingerteamgash in the facejunkietitle appears in writingexploding headthrown through a windowassault riflebooby trapknife fighttitle at the endbody landing on a carraised middle fingerlens flarebroken armrescue missionmasked killerfirefightertorso cut in halfimpersonating a police officerserial murdercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkcrashing through a windowheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personcut into piecesclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowsevered tonguegiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonstabbed through the chinlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All)

Arachnophobia (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Arachnophobia (1990)

A large spider from the jungles of South America is accidently transported in a crate with a dead body to America where it mates with a local spider. Soon after, the residents of a small California town disappear as the result of spider bites from the deadly spider offspring. It's up to a couple of  β€¦doctors with the help of an insect exterminator to annihilate these eight legged freaks before they take over the entire town. (Read More)

Subgenre:
creature featurecult filmindependent filmsuspense
Themes:
deathfearfuneralinvestigationparanoiapaniccouragenear death experienceunlikely hero
Locations:
police carhelicoptercemeterysmall townrural settingjunglesan francisco californiarain forest
Characters:
native americanhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboybrother sister relationshippolice officerphotographerlittle girllittle boyprofessorsheriff β€¦coroner (See All)
Story:
microscopemotorboatanimal attacktoiletscientistcameraunderwearsurprise endingpartyone word titledogshowerfirecorpsecat β€¦undressingshowdownneighborriversubjective camerasurvivalwineimpalementfalse accusationbirdcoffintrainingdangerlocker roompoisonrace against timetentgymdeath of husbandsuspiciondirectorial debutwaterfallheart attackrecord playercoachburned alivekilling an animalbarnmorgueamerican footballspidereccentricculture clashearthquakewatching televisionbraveryboxer shortsmedical examinationautopsydead boycellarburned to deathsirensouthern accentenglishman abroadexpeditionhomagebugundertakerpopcornfish tankstretcherassistanthearsesouth americadead birdguidestupid victimmortuarypet cattreadmillvenezuelatoy carmorticianfalling through the flooranimal in cast creditsfootball coachcanteencricketphonograph recordnail gunnestexhumationwine cellarblowtorchexterminatorgarden partypesticideequipmentencampmentdumb policeinfestationcocoonsinkholespiderwebtoxinremote controlled toy cararachnophobiaspecimenspider bitehuman versus spiderspider featurejungle expeditionkilling a bug (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Scream 2 (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 2 (1997)

Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list  β€¦of suspects goes down. (Read More)

Subgenre:
cult filmblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof
Themes:
deathmurderloverevengebetrayalfeardrunkennessescapeinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism β€¦theatremurder of a police officernear death experience (See All)
Mood:
goresatireslasher
Locations:
police carpolice stationhospitalbicyclefire truck
Characters:
policeteenagerboyfriend girlfriend relationshipfemale protagonistpolice officerserial killerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential
Period:
1990s
Story:
crushed to deathpress conferencemicrophonepolice officer killedvanambulancef wordreportertelephonecar crashpistolsurprise endingpartybare chested maleinterview β€¦violencef ratednumber in titlebloodsequelkisscigarette smokingsingingknifechasecell phonebeatingcorpsedigit in titleshot to deathblood splattercar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcollegehallucinationvoyeurtelevisiongood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo camerastabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crossnews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalstrong female leadinterracial friendshipsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplaycharacters killed one by oneethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
cult filmindependent filmsuspensepsycho thrilleramerican horrorpsychological horror
Themes:
deathmurdermarriagemoneyfearfuneraldeceptionvoyeurismdivorcetheftpsychopathguiltinsanitydatingmental illness β€¦unrequited lovemadness (See All)
Mood:
rainslasherdarknessbreaking the fourth wall
Locations:
police carchurchhotelsmall townbathtubdesertrural settingmotelcar in water
Characters:
policemanfamily relationshipsmother son relationshipfriendserial killersister sister relationshipthiefkillervillainpsychiatristsecretarysheriffterrorslasher killerserial murderer
Period:
1960syear 1960
Story:
telephone calllooking in a windowthreat to killfade to blackdriving a carfemale stockinged legsfirst of seriesold womantoiletnewspaperunderwearsurprise endingphotographbare chested maleone word title β€¦interviewviolenceflashbackbased on novelbloodshowervoice over narrationcorpsearrestundressingsecretbathroomjailhallucinationvoyeursubjective cameragood versus evilbracaliforniadisguisestabbingwomanwidowstabbed to deathstabbed in the chestbirdbathstalkerwidowercharacter's point of view camera shotmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnessbasementtrapmurdererfirst partthreatened with a knifecross dressingkillingmaniacprivate detectiveeyeglassesfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airmutilationblockbusterimpersonationphone boothpsychogrindhousevictimskullpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatbutcherblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathpsychoticpsycho killerfemale stockinged feetimpotenceserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationhomicidal maniacdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderbloody violencefemale victimreclusesadistic psychopathmurder of a nude womanmurder spreesilhouettepeep holedisturbed individualbutcherygrindhouse filmcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendweirdotaxidermystabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

The Taking Of Deborah Logan (2014) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Taking Of Deborah Logan (2014)

What starts as a poignant medical documentary about Deborah Logan's descent into Alzheimer's disease and her daughter's struggles as caregiver degenerates into a maddening portrayal of dementia at its most frightening, as hair-raising events begin to plague the family and crew and an unspeakable mal β€¦evolence threatens to tear the very fabric of sanity from them all. (Read More)

Subgenre:
mockumentarymedicalfound footagefake documentary
Themes:
deathmurderkidnappingdrinkingfearinvestigationmemoryangersupernatural powerparanoiaillnessevilphotographypanicmysterious death
Mood:
nightgoredarkness
Locations:
police carhospitalforestcarwoodskitchencavetunnelbackwoods
Characters:
policemanpolicemother daughter relationshipfrienddoctorpolice officerserial killerpriestsherifffilmmakerself destructivenessself destructionthe familyout of controlself injury β€¦lesbian daughter (See All)
Story:
telephone calltalking while drivinghospital beddriving a carpolicewomanold womanman with glassesreportertelephonecameraphotographviolenceflashbackfemale nuditynudity β€¦bloodgunfemale rear nudityknifefirecryingcell phonecorpseshot to deathfoodmirrorshotguncomputerdrinksecretshootingpaintingvomitingbirthdaybedbathroomneighborpianorevolversubjective camerabedroomflashlightcookingvideo cameraeatingwidowsuicide attempthouseinternetsnakebirthday partyrituallooking at the cameratalking to the camerajeansconfessiontreeargumentpossessionmissing personinjectionbasementgardensacrificemaniactv newsmedicinedresshypodermic needleinjurydiseasedesperationladderhomehomiciderampagesufferingsurveillance cameraattempted suicideshovelmedicationstairsdead childsurpriseattichandheld camerahealingalzheimer's diseasecellphoneh.p. lovecraftfemale doctorminedark pastopening a doorfemale reporternervous breakdownliving roomroomdead girlpsychopathic killerconfusionmysterious mangardeningdark secretmoney problemspaintfilm crewstaircasetelevision newsdiggingtv reporterx raycameramanhospital roomwhisperingsicknessjacketworminternet videomedical studenthallwayvirginiauniversity studentshirtfemale police officerdecadencemysterious womannervousnessriteholeanguishenigmamedical doctorwindowtelevision reportercaverndisturbed individualquestionbiteloss of controlsmartphonecorridorloss of memorybitingfemale studentdigital camerasenilityhostilityserpentblouseevil powerdiagnosisobscuritythesiscancer patientnightiehummingtrousersporchbloody handevil forcetelephone operatorcomputer screenfurystaringtroubled pastdistorted voicepediatriciansackforces of evilmysterious noisemedical testpantsspadedark powerburnt corpsecamera operatordark forcehospital patientmedical examhuman remainsdegenerative diseasedisturbed personrecuperationspinal tapclosed doorfemale patientpagan ritualforce of evilswitchboardburning corpsemysterious behaviortrowelradiographybewildermentswitchboard operatoraspsinister forcechild with leukemiamurmuringsenile dementia (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Rec (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rec (2007)

'REC' turns on a young TV reporter and her cameraman who cover the night shift at the local fire station. Receiving a call from an old lady trapped in her house, they reach her building to hear horrifying screams -- which begin a long nightmare and a uniquely dramatic TV report.

Subgenre:
cult filmmockumentaryb moviefound footagemock documentaryspanish horror
Themes:
deathmurderfearracismparanoiapaniccannibalismtraumaself sacrificemurder of a police officer
Mood:
nightnightmaregoredarknessambiguous endingone night
Locations:
police carhelicopterspainfire truckfire station
Characters:
policemother daughter relationshipzombiepolice officerreligious icon
Story:
trappedgas maskmicrophoneambulancereporterpistolsurprise endingone word titleinterviewviolencebloodchasepantiescorpseshot to death β€¦blood splattershot in the chestface slapwatching tvfalling from heightshootingheld at gunpointhandcuffssubjective cameravideo camerabasketballthroat slittingno opening creditslooking at the cameratalking to the cameralatex glovesgunshotbeaten to deathdangerscreamingcharacter's point of view camera shotscreamactor shares first name with characterdarkisolationneck breakingfirst parthandgunfalling down stairsrevelationhypodermic needletape recorderrageloss of friendsalivacovered in bloodladderapartment buildingeaten alivecamera shot of feetspanishgash in the facespecial forcesinfectionfallblood on shirthandheld camerasiegedemonic possessionsirenfiremanblood on camera lensconfusionhysteriahit in the facebandageepidemicspiral staircasenight visionno title at beginningsecurityroadblockbitten in the neckbleedingkiller childshockquarantinegraphic violenceopen endedfrightscarebreaking through a doortelevision reporterbludgeoningloudspeakerstairwellbitetrail of bloodemergencybarricadebasketball courtzombie childemaciationtelevision broadcastfire engineflesh eatingremadeobscuritynight shiftscreaming in horrorsledge hammeranthropophagusfire hosemallethorror movie remadehandcuffed to a pipebitten in the facefire departmentpossessed girlflesh eating zombiesinfectious diseasebiting someonerewindpolice tapespeaker phonecontamination suithealth inspectorno background scorevideographerill childmedical internsick animaltv news crewlocked in an attichand over camera lens (See All)

Night Of The Living Dead (1968)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night Of The Living Dead (1968)

Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β€¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)

Subgenre:
creature featuretragedycult filmindependent filmsuspenseallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak
Themes:
deathmurderrevengemarriagefearescapemilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality β€¦near death experienceradiation (See All)
Mood:
nightgoredarknessone night
Locations:
forestcarhelicoptercemeterywoodsrural settingkitchenfarmtruckpennsylvania
Characters:
policehusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother sister relationshipzombieprofessorsheriffterrorpolice dog
Period:
1960syear 1968year 1967
Story:
fade to blackblack manmutationtorchsevered armfirst of serieslimousinepantyhoseman with glassesscientistpistolsurprise endingviolencedogfemale nudity β€¦bloodbare breastsfemale frontal nuditygunfemale rear nudityfightcigarette smokingexplosionknifechasefiretopless female nudityhigh heelsbeatingcorpseshot to deathblood splatterfistfightfoodcar accidentshot in the chestface slapshot in the headshotgunrescuepunched in the facewatching tvbrawlbare buttrifleheld at gunpointrunninglow budget filmrevolvertelevisionshot in the backsurvivalfoot chaseaxemassacrestabbingwomanbridgearmystabbed to deathstabbed in the chesthouseexploding carcultradiocontroversycreaturegraveyardnews reporttransformationshot in the foreheadgravetreebeaten to deathdangerscreamingperson on fireattackactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutgeneralhandgunvigilantecult directorundeadwashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicmutantdiseasevirusbarnloss of loved onehammerimpersonationsevered handgrindhouseskullend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectionbroken glassinsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinecellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesliving deadmolotov cocktailcremationgerman shepherdpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manpsychotronic filmimprovised weaponfamous lineghoulgrindhouse filmheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarentrailshorror movie remadezombificationhunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All)

Paranormal Activity (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Paranormal Activity (2007)

After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.

Subgenre:
independent filmmockumentaryfound footagefake documentary
Themes:
murderfearsupernatural powerpanic
Mood:
nightnightmaredarkness
Locations:
swimming poolkitchen
Characters:
boyfriend girlfriend relationshipself mutilationself absorption
Period:
2000syear 2006
Story:
male underwearsevered armfirst of seriesmicrophonef wordcamerasurprise endingphotographbare chested maleinterviewbloodtwo word titleknifefirecomputer β€¦written by directorlow budget filmdemonguitarsubjective camerabedroomvideo camerahouseno opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguescreamingsuburbcollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst parthaunted houseobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladderbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Get Out (2017) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Get Out (2017)

Chris and his girlfriend Rose go upstate to visit her parent's for the weekend. At first, Chris reads the family's overly accommodating behavior as nervous attempts to deal with their daughter's interracial relationship, but as the weekend progresses, a series of increasingly disturbing discoveries  β€¦lead him to a truth that he never could have imagined. (Read More)

Subgenre:
independent filmdark comedypsychological thrillersupernatural horrorpsychological horror
Themes:
deathmurderfriendshiprevengesurrealismsuicidekidnappingbetrayaljealousydrinkingfeardrunkennessracismpsychopathparanoia β€¦abductionblindnesswildernesschildhood trauma (See All)
Mood:
nightmaregoresatireraindarkness
Locations:
lakenew york cityforestairportelevatorwoodsrural settingwheelchair
Characters:
younger version of characterpolicemanpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboybrother sister relationship β€¦detectivephotographerbest friendreference to godinterracial relationshipvillainpsychiatristmaidolder woman younger man relationshipgrandfather granddaughter relationshipsuicide by gunshotjapanese americansuicide by shooting (See All)
Story:
telephone calltalking in a carscene during opening creditsblack americandisappearancef wordtelephonecar crashcamerasurprise endingpartytitle spoken by characterphotographbare chested maleflashback β€¦dogviolencebloodtwo word titlegunkissfightcigarette smokinginterracial sexcell phoneblood splattercar accidentmirrorwatching tvcomputerdrinkshootingrifletearsrunningdead bodywinecandlestrangulationaxestabbingapologycultflash forwardprologuesuburbmissing personevil manmanipulationdie hard scenarioloss of mothermaniacsurgeryeyeglasseshuggingshavingteafireplacekilling an animaladdictionreference to adolf hitlerlooking at oneself in a mirrorrace relationsshot in the stomachexercisebisexual girlcrying womanservantbrooklyn new york citycrying mannicknamestabbed in the throatimmortalityhypnosisstabbed in the leghit on the headlaughterracistdeercellphonestabbed in the eyeblind mandead motherbrushing teethbenchsports carbrainreference to barack obamaauctionmale objectificationhit and runearphonesstabbed in the handbrainwashingparalysisstereotypehuman monstersex slavesarcasmname callinglooking out a windowsecret societyfemale psychopathself defenseknocking on a doorinterracial kissmale protagonistfemale villainseizurecrazinessevil womanawkward situationgenetics11 year oldracial discriminationhoodiepsychotronic filmhouse firegrindhouse filmpolice sireneyesflash camerapackingintercomtrancestory tellingbingochopping woodloss of memorylawnmowerbrain surgerybritish actor playing american characterart dealercar keysburning houseafrican american protagonistreference to 9 11bloody mouthroadkillgazebobody switchingtransplantwhite supremacistdead body in car trunkairport securityblack heroimplied incestdragging a dead bodystuffed animal toyjump scareolder woman younger maninside the mindsocial criticupstate new yorkisolated housestrange behaviorwhite supremacyattacked from behindbolt upright after nightmareneurosurgeonkicking someonehooded sweatshirtquitting smokingfootstepssedationhuman brainobjectificationreference to jeffrey dahmertranshumanismgroundskeeperbrain transplantdog foodfloating in spacevagina slurfighting backreference to tiger woods26 year oldfalling to the groundidletter openerhypnotic tranceracial hatredkilling a deermissing friendtesticles slurhit on the head with a balltelephone hangupukeleleblack maidsneak attackstomped to deathb wordreference to jesse owenstransplantationdog sittinglong consweatpantshouse in the woodsstrapped to a chairtattletalebilliard ballromance subplotshot in the gutfellatio slurfoosball tablehead scarmedical operationmounted deer headstepford wives plottransportation security administrationbreaking a dishreference to greecestabbed with a letter openerbroken car headlightevil familylosing consciousnessrunning upstairssearching for missing friendthwarted ambitionwalking alone at night (See All)

The Crazies (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Crazies (2010)

As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.

Subgenre:
cult filmsurvival horrordisaster film
Themes:
deathmurderfriendshiprevengepregnancyescapemilitarydeath of fatherinsanityexecutionself sacrificehuntingmurder of a police officermurder of familyghost town
Mood:
gorehigh schoolambiguous endinghorror movie remake
Locations:
lakepolice carpolice stationswimming poolhelicoptersmall townboatbusdesertrural settingfarmtruckgas stationschool buscar explosion β€¦fire truckhumveetruck accidentcountry doctorcity on fire (See All)
Characters:
mayorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipdoctorzombiesoldiersecretarysheriff
Story:
lockermutationgas maskhunterambulancef wordpistolsurprise endingbare chested maleviolencebloodfightexplosionknifefire β€¦cell phoneshootoutcorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapremakeshot in the headshotgunrescuepunched in the facecomputerrifleheld at gunpointrevolvershot in the backsurvivalbound and gaggedstrangulationmassacredeath of friendarmyimpalementstabbed to deathdinerstabbed in the chesttied to a chairexploding carno opening creditschild in perilcoffeeshot in the foreheadon the runperson on firefugitivecover uptankscene during end creditsfarmerdeath of husbandhandgunarsonchild murderriotdiseasevirusbarnjail cellwalkie talkiemorguenosebleedgenocidepump action shotgunu.s. armystabbed in the throatchaosgash in the facepolice officer shotcigarette lighterswampassault rifleconcentration campinfectionautopsyparachuteblood on shirtbulletproof vestgasolinefemale doctorburned to deathflat tirefirefightersatelliteshot through a windowdementiastabbed in the handhiding in a closetepidemicpolice officer shot in the chesthomicidal maniacplane crashdouble barreled shotguncar washcornfielddeputyhand over mouthwhistlingroadblockbaseball gamedeath of boyfriendstabbed in the shoulderquarantinefuneral homeopen endedoverturning carpitchforkiowanuclear explosionhouse on firebaseball fieldmortuarytrancekeystruck stopmushroom cloudcar wreckflame throwerbiological weaponset on firebottled waterhazmat suitcircular sawhigh school principalburning cargovernment coveruphanged womanlaundry drying on clothes lineno cellphone signalcatatoniamarshamerican midwestchain link fenceweird behaviorinfectious diseasemouth sewn shutcatatonic statemaniacombine harvestergift shopcontamination suiteyes sewn shutatomic explosionsemiautomatic riflestabbed with a pitchforkharvesterdead pilotknife through handfemale physicianpull the plugsatellite imageshadowy figureexposure to radiationfugitive herowheel bootwooden match (See All)

The Fly (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fly (1986)

Seth Brundle ('Jeff Goldblum' (qv)), a brilliant but eccentric scientist attempts to woo investigative journalist Veronica Quaife ('Geena Davis' (qv)) by offering her a scoop on his latest research in the field of matter transportation, which against all the expectations of the scientific establishm β€¦ent have proved successful. Up to a point. Brundle thinks he has ironed out the last problem when he successfully transports a living creature, but when he attempts to teleport himself a fly enters one of the transmission booths, and Brundle finds he is a changed man. This Science-Gone-Mad film is the source of the quotable quote "Be afraid. Be very afraid." (Read More)

Subgenre:
creature featuretragedycult filmcyberpunkallegorybody horror
Themes:
monstersuicidejealousypregnancyparanoiaabortionfalling in love
Mood:
nightmaregore
Locations:
hospitallaboratory
Characters:
love triangledeath wish
Period:
1980s
Story:
male underwearbriefsmutationreporterscientistbare chested maleinterviewviolencemale nuditymale rear nuditysex scenedreamremakeshotgunslow motion scene β€¦computeranimal in titlesciencelatex glovesstalkingfirst partcult directorexperimentlifting someone into the airmutantmad scientistmagazinescissorsexploding headteleportationintestinesmedical masksurgical masksuper strengthex boyfriendeditordental maskgenetic engineeringmetamorphosisteethwoman wearing only a man's shirtexperiment gone wrongorchestral music scoresuperhuman strengthtragic loveanimal experimentationarm wrestlingex loverpsychotronic filmfamous lineassisted suicidescience runs amokweepingarm ripped offphysicistmoral ambiguitylifting a female into the airlifting an adult into the airsteakpleadingremake of cult filmearbaboondefenestrationdoomed romancestrange behaviorgrand guignoljaw ripped offmedicine cabinettrailer narrated by hal douglasstockingfingernailmonster as victimloft apartmentblurred boundariescountdown timergenetic alterationwall climbingwoman takes off stockingremoving a fingernailvoice recognition (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Ring (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Ring (2002)

Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own  β€¦life. (Read More)

Subgenre:
paranormal phenomenasupernatural horror
Themes:
deathmurderrevengesurrealismsuicideghostfearfuneralinvestigationvoyeurismsupernatural powerphotographyadoptiondyingmysterious death
Mood:
nightmarerainhorror movie remake
Locations:
citybathtubwaterelevatorwheelchair
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlserial killerstudent β€¦writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All)
Story:
telephone callurban legendunderwater scenenewspaperreportertelephonecamerablondesurprise endingtitle spoken by characterphotographflashbackf ratedbased on novelblood β€¦cigarette smokingpantiesshowercell phonedreamhorsemirrorface slapremakewatching tvcomputerfalling from heighthallucinationvoyeurislandclassroomgood versus evilcleavagejournalistaxewomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationtreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secretwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All)

Day Of The Dead (1985) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Day Of The Dead (1985)

Zombies rule the world, except for a small group of scientists and military personnel who reside in an underground bunker in Florida. The scientists are using the undead in gruesome experiments; much to the chagrin of the military. Finally the military finds that their men have been used in the scie β€¦ntists' experiments, and banish the scientists to the caves that house the Living Dead. Unfortunately, the zombies from above ground have made their way into the bunker. (Read More)

Subgenre:
creature featurecult filmindependent filmblack comedyb moviepost apocalypsedystopiasurvival horrorzombie apocalypseamerican horrorzombie outbreak
Themes:
deathmurderrevengesuicidebetrayalfearescapedeceptionmilitaryracismbrutalityparanoiaredemptioninsanitysadism β€¦exploitationhopeapocalypsecannibalismself sacrificeclaustrophobiaghost town (See All)
Mood:
nightmaregoresatireblood and goresequel to cult horror
Locations:
beachhelicopterboatelevatorcavelaboratory
Characters:
african americanboyfriend girlfriend relationshipzombiesoldierreference to godbullylatinoalcoholicmilitary officerbabe scientistsexisthispanic americanzombie soldier
Period:
1980s
Story:
microscopemoustachesevered legtorchscene during opening creditsbeardsevered armman with glassesf wordscientisttelephonebookpistolsurprise endingviolence β€¦bloodsequelfightcigarette smokingchasecryingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headrescuebrawlshootingshowdownheld at gunpointsunglassesrunninglow budget filmislandrevolvershot in the backdecapitationsurvivalgay slurmassacredeath of friendwomanimpalementsevered headdream sequenceradiothird partcigar smokingshot in the legshot in the foreheadlatex glovesracial slurtrainingone against manypilotscreamingclownattackmoaningevil mantough girlskeletonbankshot in the shoulderinjectionglassesisolationtrapshot in the armcult directornewspaper headlinedismembermentpowersurgerymachismoexperimentuzishavingcaptainsabotageelectronic music scorehypodermic needletape recordersociopathvirusmad scientistcaucasianfloridadesperationcovered in bloodgrindhouseirishend of the worldburialaction heroinemexican standoffsocial commentaryeaten alivefemale warriorrampagereverse footagetensionu.s. armyresearchcynicismfight to the deathitalian americancannibalironydeath threatm 16psychotronicdespaircigarette lighterdead childdisembowelmentautopsyaccidental killingaerial shotblood on shirtracisteye gougingsiegegasolinetrailerethnic slursequel to cult favoritebrainpipe smokingtorso cut in halfintestinesyellingliving deadfemale fightercrocodilebunkertrailer homeshoutingbillboardflaskmercy killingbaseball capfemale herorazoramputationbitten in the neckeyeballcrushed headpalm treefriends who live togetherdeath of boyfrienddisembodied headfight the systemshot through the mouthextreme violenceflesh eating zombietwo way mirrorhit with a shovelrepeated linecurenervousnessdistrustsubterraneanbloody violencemorphinezombie violencepsychotronic filmcalendarfamous lineanti heroinefinger gungrindhouse filmarmoryevil clownwalkmanoutbreaktechno musictoothbrushx rayed skeletonzombie attackhead ripped offpower strugglebitten in the throatfedorabandanahelicopter pilotmoney falling through the airthroat rippingbanishmentdoomsdayface ripped offbrandyprivatezombie childbodily dismembermentjamaicangoonreference to frankensteinabandoned carbitten on the armchorusham radiosedativemultiple cameosdrive in classicsaluteanthropophagusirishmanwoman with a gunbullhornhorror movie remadezombificationeating human fleshco pilotballadeercuban americandune buggyhell on earthsplit headchild shot in the headsobbingheadless corpseabandoned citydeadly diseaseamateur radioabandoned theatersinger offscreenr&bloose cannonright hand mandereliction of dutystabbed through the mouthmissile siloscally capradio operatorgroaningwhiningscary clowncursingwhimperingzombie clowndesolate cityshovel through headnewsboy capcauterymilitary jacketmurmuringtalking zombiebald zombiemaniacal laughshovel through throat (See All)

An American Werewolf In London (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An American Werewolf In London (1981)

Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β€¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)

Subgenre:
creature featuretragedycult filmblack comedysuspensesupernaturalpunkfish out of watermonster movie
Themes:
monsterdeathmurderfriendshiprevengesurrealismfearescapevoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness β€¦murder of a police officermurder of family (See All)
Mood:
nightmaregoresatiremurder of a boy
Locations:
police carhospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentenglandtrucktaxi driver β€¦laboratorysex in shower (See All)
Characters:
nursepolicedoctorzombiepolice officerjewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β€¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All)
Period:
1980s
Story:
child killed by animaltrappedanimal attackvanambulancef wordtelephonecar crashblondesurprise endingbare chested maledogviolencesexfemale nudity β€¦nuditybloodmale nuditybare breastsfemale frontal nuditymale frontal nuditymale rear nuditysex scenefemale rear nuditycigarette smokingknifechaseshowertopless female nuditydreamcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedvoyeursubjective cameradecapitationcleavagegay slurdeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carnews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikerhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokelondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

P2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

P2 (2007)

The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.

Subgenre:
independent filmblack comedysuspensepsycho thrillerslasher flickpsychological thrillerholiday horrorchristmas horror
Themes:
deathmurderrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinesspsychopathobsession β€¦paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All)
Mood:
goreneo noircar chaseslasherdarknessone night
Locations:
citypolice carurban settingnew york citycarsnowwatertaxielevatoroffice
Characters:
policemanpolicefemale protagonistpolice officerhostagesecurity guardpolice detectiveslasher killermysterious villain
Period:
winter
Story:
telephone callcrushed to deathtrappedanimal attackambulancenewspaperf wordcar crashsurprise endingpartyone word titledogviolencenumber in titleblood β€¦fightexplosionknifechasefirecryingcell phonehigh heelsbeatingcorpsedigit in titleblood splatterfistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunninghandcuffsvoyeurmanhattan new york citysubjective cameracleavagesurvivalfoot chaseflashlightbound and gaggedwinestrangulationaxevideo camerastabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a carbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All)

Split (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
tragedyblack comedysuspensesuperheropsycho thrillersurvival horrorteen horrorpsychological thrilleramerican horror
Themes:
monsterdeathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneraldeceptionvoyeurismpsychopathdeath of father β€¦brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
goreneo noirslasher
Locations:
police cartrainforesttaxiwoodskitchenapartmenttaxi drivermuseumtunneltrain stationart museum
Characters:
father daughter relationshipteenagerafrican americandoctorteenage girlpolice officerserial killerhostagekillersecurity guardvillainpsychiatristterroruncle niece relationshipslasher killer β€¦serial murdererpolice dog (See All)
Period:
2010s
Story:
fade to blacklockercrushed to deathgas maskhunterold womanman with glassesambulancesurprise endingpartytitle spoken by characterbare chested maleone word titleviolencedog β€¦flashbackbloodsequeldancingknifechasepantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightdeath of frienddinernonlinear timelinechild abuseanimaldisarming someonedrawingdouble crossbirthday partynews reportnecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingmaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiecaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipeaten aliverampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournalhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapedisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Odd Thomas (2013) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Odd Thomas (2013)

Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t β€¦rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)

Subgenre:
independent filmblack comedyconspiracysupernaturalparanormal phenomena
Themes:
deathmurderrevengesurrealismkidnappingghostfearescapeheroinvestigationdeceptionmemorysupernatural powerterrorismparanoia β€¦redemptionsurveillancehome invasionpanicpolice brutalitynear death experienceafterlifeunlikely hero (See All)
Mood:
nightmareneo noirdarknesspoetic justice
Locations:
police carswimming poolhospitalrestaurantchurchsmall townbathtubdesertwheelchairapartmentmotelsinging in a carcar bombdesert town
Characters:
policemannursepolicehusband wife relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctortattooprostitutepolice officerhostagetough guywarriorsingle motherwaitress β€¦security guardsheriffpolice shootoutdeath of girlfriend (See All)
Period:
seeing the future
Story:
timebombbarbecueanimal attacksevered armlimousinepolice officer killedvancar crashpistolsurprise endingpartytitle spoken by characterphotographflashbackdog β€¦violencecharacter name in titlebased on novelbloodtwo word titlekissfightcigarette smokingexplosionknifechasefirevoice over narrationcell phoneshootoutbeatingdreamcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headrescueslow motion scenepunched in the facecomputerwritten by directorarrestgunfightbrawlsecretshowdownheld at gunpointbombdemonhandcuffsrevolvershot in the backgood versus evilfoot chasebound and gaggedcaliforniaterroristmassacremontagedinerexploding carfalse accusationsevered headcultno opening creditsbirddisarming someoneone man armychild in perilhit by a cardouble crosscreatureattempted murdercursedangerscreamingperson on fireuniformproduct placementrace against timecover upknocked outbaseball batopening action sceneshot in the shouldermanipulationexploding bodymanagercharacter says i love youshot in the armlas vegas nevadasilencerpsychiccorrupt copfreeze framesingle parenttwenty somethingprivate detectiveeavesdroppingburned aliverevelationeggslow motionsociopathice creamcooksecurity cameraloss of loved onespiderskullcarnivalfatepicnicmasked mancrime scenedamsel in distressstealing a carvisionexplosivesevered fingershot in the faceshopping mallm 16police officer shotescape attemptframe uptime lapse photographybutterflyassault riflewisecrack humorblood on shirtbulletproof vestrefrigeratordemonic possessionterrorist plotfortune tellerkilling spreedeath of loved oneburned to deathowlnewspaper clippingframed for murdershot multiple timesprivate investigatorbullet timehit with a baseball batshot through a windownarrated by characterinvisibilitymysterious manterrorist grouppickpocketfountainold dark housecockroachevil spiritpolice chiefportaldisposing of a dead bodyyoung version of charactermalltrailer homescootercheering crowdhearing voiceselvis presleyflybody in a trunkhit by a truckdeputybowling alleypremonitionman kills a womanoffscreen killingpool partyshot point blankbullet woundmeteorbomberpart computer animationtragic lovehiding under a bedexploding housewoman in a bikinitragic endingcarouselanimal killingvillain not really dead clichelocketinnocent person killedclairvoyantgas explosionpoltergeistwater fountainpancaketoothmusic storetime bombice cream conefingerdecomposing bodyrunning for your liferescue attemptchild killerloss of girlfriendjumping from a carcamel toerottweilersatanic culttiredevil worshipgas chamberblowing a kissclairvoyancestartledable to see the deadbirdcagechased by a dogdomestic terrorismfictional townmilkshakesatanicseeing dead peoplewalking on waterdead body in a bathtubice cream parlorstorm drainpushed into a swimming poolexploding trailerhouse explosioncoitus interruptuscontemporary settingbarbecue grillsevered toesweethearthomemade explosiveseeing ghostscamera shot of a woman's legshotwiringshort order cookabandoned prisonice packwoman wearing a little black dressbody in a car trunkbreak door incar truck crashbluetoothdevil worshiperfalling into swimming poolvehicular accidentchurch towerdriver shotdriving licensevan explosionreloading a gunfortune telling machinehorse rideshot in facetruck car collisionabandoned restaurantsupernatural ability (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
cult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror
Themes:
deathmurderrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of motherinsanity β€¦evilabductiontraumafear of water (See All)
Mood:
nightmaregorerainhigh schoolslasherbreaking the fourth wallblood and gore
Locations:
lakepolice stationforestcemeterysmall townschool nurse
Characters:
father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β€¦serial murderer (See All)
Period:
2000s
Story:
child killedlockerslaughtercrushed to deathsevered armvanunderwater scenecar crashpistolsurprise endingpartyphotographflashbackviolencecharacter name in title β€¦bloodsequelexplosionshowerfirevoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskdemondecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perildrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabindismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer campevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Scream 3 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 3 (2000)

A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.

Subgenre:
independent filmmartial artsblack comedypost modernhorror spoof
Themes:
deathmurderrevengekidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheftbrutality β€¦paranoiacelebrityhome invasioncourage (See All)
Mood:
nightmaregoresatireslasher
Locations:
police carpolice stationswimming poolbarhelicopterlos angeles californiaapartment
Characters:
policefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officerserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm directorex boyfriend ex girlfriend relationship β€¦death of girlfriendself referentialpregnant from rape (See All)
Period:
1990s2000s
Story:
wristwatchtoiletmansionambulancef wordreportercar crashpistolsurprise endingpartyphotographbare chested maledogviolencef rated β€¦number in titlebloodsequelfightcigarette smokingknifechaseshowercell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretfalling from heightmaskshowdownheld at gunpointsunglassesbirthdayhallucinationhandcuffsvoyeurrevolvershot in the backsurvivalfoot chaseflashlightjournalistbound and gaggedambushstrangulationthroat slittingstabbed to deathstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingrace against timecover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapejumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All)

It Follows (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It Follows (2014)

For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends β€¦ must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)

Subgenre:
cult filmsupernaturalsupernatural horrorcult horror
Themes:
deathmurderfriendshipghostfearinvestigationvoyeurismsupernatural powerparanoiaevilpanicsupernatural beingsupernatural rape
Mood:
rainhigh schoolambiguous ending
Locations:
lakepolice carswimming poolhospitalbeachschoolforestcarboatbicyclewaterwheelchairsex in carsex in hospital
Characters:
teenagerfriendteenage girlprostituteteenage boyfemale protagonistsister sister relationshipneighbor neighbor relationshipsex with a strangersupernatural killer
Story:
hospital bedold womanunderwater scenesearchf wordcar crashbookpistolphotographbare chested maleviolencesexbloodbare breastsfemale frontal nudity β€¦male frontal nuditymale rear nuditytwo word titlesex scenekissfemale rear nuditymale full frontal nuditychasepantiestopless female nuditycorpseshot to deathblood splatterurinationshot in the headwatching tvwritten by directorbikinilow budget filmcafebathroomneighbordemonvoyeurclassroommale pubic hairsubjective camerafoot chasebedroomflashlightbanddeath of friendhousetied to a chairwhite pantiesshot in the legpublic nuditycursedangersuburbelectrocutionknocked outcollege studentlightningstalkingautomobilethreatdatelove interestteenage sexcard gamegameelectronic music scorelooking at oneself in a mirrorsexual attractiongroup of friendsmovie theaterpooldesperationflatulenceswimsuitstrangervictimteenage protagonistpeeping tombroken leggirl with glassesvisiontarget practiceplaygroundthunderstormboyfriendswingtied feetlooking at self in mirrorbroken armliving roomneighborhoodchloroformbeing followedabandoned buildingsuffocationgirl in bra and pantiesinvisibilityporn magazineapparitionshot in the neckhead wounddetroit michiganreading aloudabandoned housebroken windowswimming underwaterbreaking a windowhallwaycowgirl sex positionshot in the handfrightmenaceshape shiftertied up while barefoottalking about sexpsychotronic filmscaregrindhouse filmyoung adultoverhead shotsexual intercoursehit with a chairrunning for your lifefalse nameentityhead bandageloss of innocencetarget shootinggirl next doorsexually transmitted diseasemidnight movieporchnipple sliparm castindoor swimming poolwashing a carincest subtextconsequenceshape shiftingmotor boatsleep overmysterious personcollateral damagefootstepsguessing gamebare breastnear drowninghigh school yearbookneo 80schevrolet impalaopening creditstimelessnessdemonic presencesex horrordead woman on a beachdemonic entityelectric typewriterhorror movielounging on a beachtied to a wheelchair (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wrong Turn (2003) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
cult filmindependent filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller
Themes:
deathmurderfriendshiprevengekidnappingfeartortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism β€¦couragehuntingmurder of a police officerwildernessnear death experience (See All)
Mood:
goreslasher
Locations:
police carforestbathtubwoodstruckcavegas station
Characters:
teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer
Period:
2000s
Story:
severed legtorchsevered armfirst of seriespolice officer killedmaptoiletcar crashpistolsurprise endingviolencesexblood β€¦cigarette smokingexplosionknifechasefirecryingcell phonebeatingcorpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflemarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendstabbed to deathstabbed in the chestexploding carsevered headdisarming someonehit by a carshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firedollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heightbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdercharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

In The Mouth Of Madness (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Mouth Of Madness (1994)

With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends  β€¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)

Subgenre:
cult filmindependent filmblack comedysuspensesupernaturalparanormal phenomena
Themes:
monsterdeathmurdersurrealismsuicidefearescapeinvestigationdeceptionparanoiainsanityapocalypseself sacrificepolice brutalityghost town β€¦end of mankind (See All)
Mood:
nightmareneo noir
Locations:
new york citybarchurchhotelcarsmall townbusbicycleelevatormoteltunneltownnew england
Characters:
policedoctorpolice officerwriterlawyerpsychiatristsecretaryhomeless manself referentialinsurance agentevil monster
Period:
1990s
Story:
mutationanimal attacktorchsevered armdisappearanceambulancecar crashbooksurprise endingtitle spoken by characterflashbackdogviolencebloodgun β€¦cigarette smokingchasebeatingcorpseshot to deathblood splattercar accidentshot in the chestshot in the headshotgunarrestpaintingriflebathroomdemonhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilfoot chaseaxebridgedinerweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonecharacter's point of view camera shotmissing personlightningcrossfilm within a filmbasementsuspicionmurderercinemacult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudend of the worldschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murderasylumriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguninsane asylumcornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All)

The Wolfman (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wolfman (2010)

Lawrence Talbot's childhood ended the night his mother died. His father sent him from the sleepy Victorian hamlet of Blackmoor to an insane asylum, then he goes to America. When his brother's fiancee, Gwen Conliffe, tracks him down to help find her missing love, Talbot returns to his father's estate β€¦ to learn that his brother's mauled body has been found. Reunited with his estranged father, Lawrence sets out to find his brother's killer... and discovers a horrifying destiny for himself. Someone or something with brute strength and insatiable blood lust has been killing the villagers, and a suspicious Scotland Yard inspector named Aberline comes to investigate. (Read More)

Subgenre:
cult filmgothic horror
Themes:
deathmurdersuicidetorturefuneraldeath of motherinsanityevilmurder of a police officer
Mood:
nightnightmaregorerainhorror movie remake
Locations:
lakelondon englandwheelchairrooftoprunning in the forest
Characters:
father son relationshipdoctoractorpriestvillainevil father
Period:
1890s
Story:
severed legcrushed to deathanimal attacktorchsevered armdisappearancemansionnewspaperpistolsurprise endingflashbackdogbloodtwo word titlefire β€¦corpseblood splattermirrorshot in the chestremakeletterrifleheld at gunpointanimal in titlehallucinationdecapitationfoot chasethroat slittingimpalementtied to a chairsevered headno opening creditsdream sequencecoffinchild in periltransformationcursecharacter repeating someone else's dialogueperson on fireelectrocutionstatuemissing persontentshot in the shoulderscardeath of brotherinjectionhorse ridingtrapwaterfallbearreference to william shakespearenewspaper headlinesubtitled scenestrong female characterwerewolfsyringefireplaceburned alivelooking at oneself in a mirrorloss of loved oneservantstrong female leadart galleryfull moonmental institutionrampagegypsytelescopeattempted suicidegash in the facebutcherdelusionjumping through a windowthrown through a windowcanelanternpassionate kissasylumtorso cut in halfvictorian eramental patientsubtitlespiano playinghindudouble barreled shotguntavernstrait jacketrazorbitten in the neckhearsecarnagepsychotherapyreference to shakespeare's hamletantiquebreaking through a doorhouse on firehusband murders wifeimmolationbreaking a mirrorglowing eyesknocked out with a gun butthead ripped offstraight razorcryptcandlelightsikhpreachingarm ripped offhorse drawn carriagemedallionthroat rippingbegins with textfuneral processionhuman becoming an animalstagecoachantique shoppassenger trainelectroshock therapyvicarwalking stickbody torn apartextreme closeuphowlingdrink thrown into someone's facegrand pianoreference to jack the ripperomenreference to shakespeare's macbethromeo and julietson murders fathersanitariumlycanthropysplit lipsilver bulletstabbed through the chinfinger bitten offtower bridge londonreflection in eyefalling off a horsestage actorloading a gunhowlgypsy campice bathlondon bridgelycanthropefather murders sonreference to danielromantic subplotdark foresthorse drawn wagonreference to shakespeare's richard iiirunning across a roofyear 1891topiaryescape from a mental institutionreference to the prodigal sonscotland yard inspectorstone bridgeupward camera shotmonster in mirrorskipping stonechased in the woodsfather versus sontower bridgeskipping stones on water (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Descent (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Descent (2005)

A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.

Subgenre:
creature featurecult filmsurvival horrorbritish horror
Themes:
monsterdeathmurderfriendshiprevengeinfidelitybetrayalghostdrinkingfearescapebrutalityguiltgriefpanic β€¦cannibalismblindnessmurder of familyclaustrophobia (See All)
Mood:
nightmaregore
Locations:
hospitalforestcarwoodscavecave in
Characters:
husband wife relationshipfriendfemale protagonistbest friendlittle girl
Story:
trappeddriving a cartorchunderwater scenebookblondesurprise endingphotographviolencef ratedbloodtwo word titleknifecryingbeating β€¦corpseblood splattercar accidentfalling from heightvomitingliehallucinationsurvivalflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestcreaturenecklacesmokingbeaten to deathdolldarkisolationneck breakingfirst partunderwatercabinwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airgroup of friendsvictimskullcheating husbandbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All)

Underworld: Awakening (2012) is one of the best movies like Alligator (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld: Awakening (2012)

Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β€¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)

Subgenre:
martial artsconspiracydystopiafish out of watercyberpunkdark fantasy
Themes:
monsterdeathmurderrevengekidnappingescapeinvestigationsupernatural powersurveillancehome invasionpolice brutality
Mood:
goredarknesspoetic justice
Locations:
sewerpolice stationhelicopterelevatorrooftop
Characters:
policefather son relationshipmother daughter relationshipdoctorfemale protagonistdetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughterself mutilation
Period:
future2010s
Story:
mutationcrushed to deathanimal attacksevered armunderwater scenesearchscientistcar crashpistolsurprise endingphotographbare chested maleviolencebloodsequel β€¦two word titleexplosionknifechasefireshootoutbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescuepunched in the facebattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombhandcuffsrevolvercombatkung fushot in the backsubjective cameradecapitationgood versus evilsurvivalflashlightstrangulationaxemassacrethroat slittingimpalementstabbed to deathcolon in titlemixed martial artsstabbed in the chestsevered headno opening creditsanti herochild in perilhit by a carfictional warcreaturenews reportshot in the legtransformationshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderinjectionexploding bodyneck breakingmercenaryshot in the armhenchmanexperimentwerewolfhand grenadekilling an animalhypodermic needlegothicsecurity camerakicked in the stomachfourth partgiantjumping from heightparking garageaction heroinegun fusocial commentaryback from the deadfemale warriorstealing a carexplosivestabbed in the throatwhippartner3 dimensionalresurrectionshot in the facestabbed in the headstabbed in the leg3dpunched in the chestjumping through a windowthrown through a windowbody landing on a carknife throwingstabbed in the eyeflamethrowertelepathytorso cut in halfdesert eaglesuper strengthstabbed in the armshot in the eyescalpelgenetic engineeringdamman kills a womanscene of the crimebitten in the neckepiloguestabbed in the shouldershot in the throatopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
deathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruptionpsychopath β€¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
nightgoreslasherdarkness
Locations:
citypolice carpolice stationhospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchair β€¦australiaitalytruck (See All)
Characters:
policemanpolicehomosexualfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killermusicianactress β€¦killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All)
Period:
1970s
Story:
telephone callslaughterdriving a carold womansearchnewspaperreportertelephonebookcamerasurprise endingphotographflashbackviolenceblood β€¦two word titlegunkisscigarette smokingsingingknifechasefiresongshootoutbeatingcorpseblood splattermirrorface slapwatching tvdrinksecretshootingpaintingvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisionsubjective cameradecapitationsurvivalgay slurbedroomflashlightjournalistbandold manstrangulationaxestabbingimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a cargraveyardnecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousehomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingdisfigurementdark pastbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Alligator?
<< FIND THEM HERE! >>