Please wait - finding best movies...
A struggling songwriter named Dave Seville finds success when he comes across a trio of singing chipmunks: mischievous leader Alvin, brainy Simon, and chubby, impressionable Theodore.
Subgenre: | live action and animationpunk |
Themes: | hollywoodexploitationdysfunctional familyangerdancemoneychristmaslovefriendship |
Mood: | hip hopnightrain |
Locations: | swimming poollos angeles californiarooftopelevatorwaterparis francemotorcyclecarforestnew york city |
Characters: | single fatherfrenchmaidsecurity guardjapanesehostagedetectivebrother brother relationshipfather son relationship |
Period: | winter2000s |
Story: | remote controlled toy helicoptertoy helicopterpop startoy robothelium balloonshaving creamdrinking champagneanimal exploitationfull moonhollywood signsitting on a rooftopcandlelight dinnerconcert touracoustic guitarelectric guitar β¦dodge the carvolvo carchristmas giftsinging triosinging animalchristmas treetelephone callmusic writermusic tourreference to justin timberlakelive action adaptationcomputer generated imageryremote control helicopterelectronic keyboardfroot loops cerealcadillac escaladefamily issuesrecord studiobasketball hoophelium inhalationred sweaterapple macbooktennis shoesenergy barplay dohtoyota mr2ford crown victoriatoyota celicahummer h2barefoot cartoon animalapproachford motor companynational basketball associationair hornpaper clipbongo drumseeing eye doghalf dressed cartoon animaldrum kitdrug referencedodge viperchipmunkrecord labelanimal protagonistsheet musiccincinnati ohiotennis ballceiling fanpaper airplanerecord companystage frighthula hoopcompact discpoprecord producerapple computerpart computer animationtennis courtrich mancrime investigationwhipped creamshopping cartlive actionmusic industryfart jokereference to youtubelip synchingmercedes benzvacuum cleanerstuffed animalcartoon on tvbarking doglaptop computert shirtposterfemale doctorchairrefrigeratorsongwritersurpriseanthropomorphic animalconfrontationspanishgrocery storecouchremote controlanthropomorphismclockmilkladderskateboardpoolblockbustersanta clausmagazinescene during opening creditstoyvandalismragetape recordertalking animalcagecakeballoonfireplaceshavingrockiceeyeglasseschainsawsingle parentmoonhatelas vegas nevadafirst partwildlifeglassesautomobilescene during end creditsconvertibledollsuitcasechampagnefired from the jobargumentlimousinecoffeedinnermansioncaliforniaconcertcandlewinetelephonetelevisionguitarbedliebattlecameracell phoneknifesinging (See All) |
Pop sensations Alvin, Simon and Theodore end up in the care of Dave Seville's twenty-something nephew Toby. The boys must put aside music super stardom to return to school, and are tasked with saving the school's music program by winning the $25,000 prize in a battle of the bands. But the Chipmunks β¦unexpectedly meet their match in three singing chipmunks known as The Chipettes - Brittany, Eleanor and Jeanette. Romantic and musical sparks are ignited when the Chipmunks and Chipettes square off. (Read More)
Subgenre: | live action and animation |
Themes: | christmas |
Locations: | los angeles californiaparis france |
Period: | 2000s |
Story: | remote controlled toy helicoptertoy helicopterhollywood signacoustic guitarelectric guitarchristmas giftsinging animaltelephone callcomputer generated imageryremote control helicopterrecord studiored sweaterapple macbookbarefoot cartoon animalbongo drum β¦half dressed cartoon animaldrum kitchipmunkrecord labelanimal protagonistapple computerreference to youtubemercedes benzchairrefrigeratorsongwriteranthropomorphic animalcouchremote controlskateboardtoytalking animalcageglassesautomobilescene during end creditssuitcasechampagnelimousinecaliforniatelephonetelevisionguitarbedbattlecell phonesinging (See All) |
Harry Sanborn is an aged music industry exec with a fondness for younger women like Marin, his latest trophy girlfriend. Things get a little awkward when Harry suffers a heart attack at the home of Marin's mother Erica. Left in the care of Erica and his doctor, a love triangle starts to take shape.
Themes: | friendshiplove |
Mood: | hip hoprain |
Locations: | los angeles californiaparis francenew york city |
Characters: | french |
Story: | telephone callrecord labelrecord companymusic industrylaptop computergrocery storemagazineballooneyeglasseschampagnefired from the joblimousinedinnercandlewine β¦bedcell phoneknife (See All) |
Kevin McCallister is back. But this time he's in New York City with enough cash and credit cards to turn the Big Apple into his very own playground. But Kevin won't be alone for long. The notorious Wet Bandits, Harry and Marv, still smarting from their last encounter with Kevin, are bound for New Yo β¦rk too, plotting a huge holiday heist! Kevin's ready to welcome them with more battery of booby traps the bumbling bandits will never forget! (Read More)
Themes: | christmasfriendship |
Mood: | nightrain |
Locations: | swimming poolrooftopelevatornew york city |
Characters: | maidbrother brother relationship |
Period: | winter |
Story: | christmas giftchristmas treetelephone callvacuum cleanercartoon on tvremote controlladderblockbustertoytape recorderlimousineconcerttelephonetelevision |
Aspiring actress serves lattes to movie stars in between auditions and jazz musician Sebastian scrapes by playing cocktail-party gigs in dingy bars. But as success mounts, they are faced with decisions that fray the fragile fabric of their love affair, and the dreams they worked so hard to maintain β¦in each other threaten to rip them apart. (Read More)
Themes: | hollywooddancechristmaslove |
Locations: | swimming poollos angeles californiaelevatorparis france |
Period: | winter |
Story: | concert tourchristmas treetelephone callhula hooplip synchingsurprisevandalismconvertiblechampagnefired from the jobcoffeeconcertwinetelephonecamera β¦cell phonesinging (See All) |
Sexy, romantic comedy about a girl in her early 20s named Violet Sanford going to NYC to pursue a dream of becoming a songwriter. Violet gets a "day" job as a bar maid at a nightclub called Coyote Ugly. Coyote Ugly is the city's newest hot spot where the employees are a team of sexy, resourceful wom β¦en that provoke the clientele and press with their mischief. (Read More)
Themes: | dancefriendship |
Mood: | night |
Locations: | rooftopnew york city |
Characters: | single fathermaid |
Period: | 2000s |
Story: | acoustic guitarrecord labelstage frightapple computermusic industrysongwriterfired from the jobargumentguitarsinging |
Down and out rock star Dewey Finn gets fired from his band, and he faces a mountain of debts and depression. He takes a job as a 4th grade substitute teacher at an uptight private school where his attitude and hijinx have a powerful effect on his students. He also meets Zack, a 10-year-old guitar pr β¦odigy, who could help Dewey win a "battle of the bands" competition, which would solve his financial problems and put him back in the spotlight. (Read More)
Themes: | angerfriendship |
Locations: | los angeles california |
Period: | 2000s |
Story: | electric guitartelephone callposterscene during opening creditsrockeyeglassesscene during end creditsfired from the jobguitarliebattlesinging |
A chance encounter between a travelling salesman and a lonely hitman triggers a strangely profound relationship which provokes each to act in ways neither would have imagined possible. Fate steps in to form a friendship between two men from irreconcilable worlds that will alter the lives of both for β¦ever. (Read More)
Themes: | moneychristmasfriendship |
Mood: | rain |
Locations: | swimming poolrooftopcar |
Characters: | security guardfather son relationship |
Story: | helium balloonchristmas treetelephone callladderballoonfireplaceeyeglasseslas vegas nevadaglassessuitcasecoffeecandleliecell phoneknife |
It is Christmas time and the McCallister family is preparing for a vacation in Paris, France. But the youngest in the family named Kevin got into a scuffle with his older brother Buzz and was sent to his room which is on the third floor of his house. Then, the next morning, while the rest of the fam β¦ily was in a rush to make it to the airport on time, they completely forgot about Kevin who now has the house all to himself. Being home alone was fun for Kevin, having a pizza all to himself, jumping on his parents' bed, and making a mess. Then, Kevin discovers about two burglars, Harry and Marv, about to rob his house on Christmas Eve. Kevin acts quickly by wiring his own house with makeshift booby traps to stop the burglars and to bring them to justice. (Read More)
Themes: | dysfunctional familyangerchristmasfriendship |
Mood: | night |
Locations: | waterparis francecar |
Characters: | brother brother relationship |
Story: | christmas treetelephone callshopping cartcartoon on tvremote controlclockblockbustertoyfirst partautomobileargumenttelephonetelevisionbedsinging |
William Miller is a 15-year-old kid hired by Rolling Stone magazine to tour with and write about Stillwater, an up and coming rock band. This wonderfully witty coming-of-age film follows William as he falls face first to confront life, love, and lingo.
Themes: | angerdancemoneyfriendshiplove |
Locations: | swimming poollos angeles californiaelevatorcarnew york city |
Story: | telephone callmusic industryt shirtmagazinerocksingle parentcaliforniaconcerttelephoneguitarcamerasinging |
Following the death of his father in Mexico, Stephane Miroux, a shy insecure young man, agrees to come to Paris to draw closer to his widowed mother Christine. He lands a boring job at a calendar-making firm and falls in love with his charming neighbor Stephanie. But conquering her is no bed of rose β¦s for the young man and the only solution he finds to put up with the difficulties he is going through is escape into a dream world... (Read More)
Themes: | lovefriendship |
Locations: | rooftopparis france |
Characters: | single fatherfrenchfather son relationship |
Story: | acoustic guitartelephone callpaper airplaneshopping cartfart jokeremote controltape recordershavingeyeglassesmoondinnerconcerttelephonetelevisionguitar β¦bedliesinging (See All) |
A take on the classic tale 'The Boy Who Cried Wolf', this is the story of a 14-year-old boy named Jason Shephard who lies for the fun of it. He loses an important story assignment entitled 'Big Fat Liar' in movie producer Marty Wolf's limo, which Wolf then turns into a film. When Jason sees a movie β¦preview of his story, he and his best friend Kaylee go to Los Angeles to make Wolf confess to using his story, to clear his name, and to get him out of having to attend summer school. The teen liar then has to match wits with Wolf, who also turns out to be a big liar. (Read More)
Themes: | hollywood |
Locations: | swimming poolrooftop |
Characters: | maidsecurity guardfather son relationship |
Story: | hollywood signtelephone callstuffed animalskateboardpoolconvertibledolllimousinecaliforniatelephonetelevisioncell phone |
Marisa Ventura is a single mother born and bred in the boroughs of New York City, who works as a maid in a first-class Manhattan hotel. By a twist of fate and mistaken identity, Marisa meets Christopher Marshall, a handsome heir to a political dynasty, who believes that she is a guest at the hotel. β¦Fate steps in and throws the unlikely pair together for one night. When Marisa's true identity is revealed, the two find that they are worlds apart, even though the distance separating them is just a subway ride between Manhattan and the Bronx. (Read More)
Themes: | christmaslovefriendship |
Mood: | night |
Locations: | elevatornew york city |
Characters: | frenchmaid |
Story: | christmas treepaper clipstage frightvacuum cleanerconfrontationspanishsanta claussingle parentfired from the joblimousinetelephoneliecamerasinging |
Themes: | dancelove |
Characters: | single fathersecurity guard |
Story: | pop staracoustic guitarsingle parentscene during end creditsargumentlimousinedinnerconcertliecameracell phonesinging |
In New York, the simple and naive just-graduated in journalism Andrea Sachs is hired to work as the second assistant of the powerful and sophisticated Miranda Priestly, the ruthless and merciless executive of the Runway fashion magazine. Andrea dreams to become a journalist and faces the opportunity β¦ as a temporary professional challenge. The first assistant Emily advises Andrea about the behavior and preferences of their cruel boss, and the stylist Nigel helps Andrea to dress more adequately for the environment. Andrea changes her attitude and behavior, affecting her private life and the relationship with her boyfriend Nate, her family and friends. In the end, Andrea learns that life is made of choices. (Read More)
Themes: | angerfriendship |
Locations: | elevatorparis francenew york city |
Period: | 2000s |
Story: | telephone callconfrontationblockbustermagazineeyeglasseschampagnefired from the joblimousinecoffeedinnercandlewinecameracell phone |
Brennan Huff and Dale Doback are both about 40 when Brennan's mom and Dale's dad marry. The sons still live with the parents so they must now share a room. Initial antipathy threatens the household's peace and the parents' relationship. Dad lays down the law: both slackers have a week to find a job. β¦ Out of the job search and their love of music comes a pact that leads to friendship but more domestic disarray compounded by the boys' sleepwalking. Hovering nearby are Brennan's successful brother and his lonely wife: the brother wants to help sell his step-father's house, the wife wants Dale's attention, and the newlyweds want to retire and sail the seven seas. Can harmony come from the discord? (Read More)
Themes: | moneychristmasfriendshiplove |
Characters: | brother brother relationshipfather son relationship |
Story: | christmas treeseeing eye dogdrum kitstage frightwhipped creamfart jokelip synchingremote controlscene during opening creditsvandalismscene during end creditswineguitarcell phonesinging |
Inspired by a true story, Al Pacino stars as aging 1970s rocker Danny Collins, who can't give up his hard-living ways. But when his manager (Christopher Plummer) uncovers a 40 year-old undelivered letter written to him by John Lennon, he decides to change course and embarks on a heartfelt journey to β¦ rediscover his family, find true love and begin a second act. (Read More)
Themes: | angerlove |
Locations: | swimming poollos angeles californiaelevatornew york city |
Characters: | father son relationship |
Story: | telephone callscene during opening creditstape recordereyeglassesscene during end creditsconcerttelephonecameracell phonesinging |
We like Florence: she's considerate, sweet, pretty, and terrific with kids and dogs. She's twenty-five, personal assistant to an L.A. family that's off on vacation. Her boss's brother comes in from New York City, fresh from a stay at an asylum, to take care of the house. He's Roger, a forty-year-old β¦ carpenter, gone from L.A. for fifteen years. He arrives, doesn't drive, and needs Florence's help, especially with the family's dog. He's also connecting with former band-mates - two men and one woman with whom he has a history. He over-analyzes, has a short fuse, and doesn't laugh at himself easily. As he navigates past and present, he's his own saboteur. And what of Florence? is Roger one more responsibility for her or something else? (Read More)
Themes: | angerfriendship |
Mood: | rain |
Locations: | swimming poollos angeles californianew york city |
Characters: | brother brother relationshipfather son relationship |
Story: | telephone callapple computersongwritergrocery storecouchtoyeyeglassessuitcasechampagnecaliforniacandleguitarbedcell phonesinging |
Set against the backdrop of 1977 Los Angeles, The Nice Guys opens when single father and licensed PI Holland March (Gosling) is hired to investigate the apparent suicide of famous porn star Misty Mountains. As the trail leads him to track down a girl named Amelia (Qualley), he encounters less licens β¦ed and less hands-off private eye Jackson Healey (Russell Crowe) and his brass knuckles, both hired by the young hippie. However, the situation takes a turn for the worse when Amelia vanishes and it becomes apparent that March wasn't the only party interested. As both men are forced to team up, they'll have to take on a world filled with eccentric goons, strippers dressed as mermaids and even a possible government conspiracy. (Read More)
Themes: | dysfunctional familymoneychristmasfriendship |
Locations: | swimming poollos angeles californiaelevatormotorcycleforest |
Characters: | single fatherhostagedetective |
Story: | hollywood signchristmas treemercedes benzscene during opening creditsshavingsingle parentautomobilesuitcaselimousinecoffeemansioncaliforniatelephoneknife |
The story of the Buckman family and friends, attempting to bring up their children. They suffer/enjoy all the events that occur: estranged relatives, the "black sheep" of the family, the eccentrics, the skeletons in the closet, and the rebellious teenagers.
Themes: | dysfunctional family |
Locations: | car |
Characters: | brother brother relationshipfather son relationship |
Story: | helium balloontelephone callhelium inhalationblockbusterballooneyeglassessingle parentdinnerbedliecamerasinging |
In Victorian London, England, a little mouse girl's toymaker father is abducted by a peglegged bat. She enlists the aid of Basil of Baker Street, the rodent world's answer to Sherlock Holmes. The case expands as Basil uncovers the crime's link to a plot against the Crown itself.
Themes: | anger |
Mood: | nightrain |
Characters: | detective |
Story: | singing animalpart computer animationanthropomorphic animalanthropomorphismclocktalking animalballoonwinebattlesinging |
It's the last day of school, and Max wants to catch the eye of Roxanne, one of the more attractive girls in school. But how can you be cool when your dad's Goofy? Stage an impromptu concert at the final assembly, that's how! Or at least it sounded good until Principal Mazer found out. Goofy finds ou β¦t about his son's antics (sort of), and decides a fishing trip, like his dad took him on, is the solution. Of course, he doesn't know that Max finally lands a date with Roxanne for a party thrown by the class valedictorian. Through the movie, Goofy tries to bring Max out of his shell, while Max resents being taken away, and lying to Roxanne about the trip (he tells her he & his dad will be appearing on TV at the PowerLine concert in LA). Will Max sink or swim? Will Goofy goof up his son's first shot at romance? Will Bigfoot step back? And what about those nuns? (Read More)
Themes: | angerlove |
Locations: | los angeles californiawatercar |
Characters: | single fatherfather son relationship |
Story: | singing animalvacuum cleaneranthropomorphic animalanthropomorphismsingle parentfirst partargumentcaliforniaconcerttelephonetelevisionbedliesinging |
The Beatles--the world's most famous rock and roll band--travel from their home town of Liverpool to London to perform in a television broadcast. Along the way they must rescue Paul's unconventional grandfather from various misadventures and drummer Ringo goes missing just before the crucial concert β¦. (Read More)
Mood: | night |
Story: | shaving creamacoustic guitarelectric guitardrum kitsongwritershavingrockconcerttelevisioncamera |
Left on the doorstep of an orphanage run by nuns at birth, three friends Moe, Larry and Curly spend their time eye poking and slapping each other all the day long. But when their orphanage suddenly goes bankrupt, the three Stooges set out to save it by journeying into the world to find a way to rais β¦e the money required. But their quest brings them into being used in a murder scheme and landing them into a popular reality show. (Read More)
Themes: | moneyfriendship |
Locations: | swimming poolrooftop |
Characters: | security guard |
Story: | helium balloontennis courtfart jokecartoon on tvladderskateboardballoonchainsawscene during end creditsmansioncell phone |
Chris Brander has always been friends with Jamie Palamino, but now decides it is time to take his relationship to the next step. The problem is that Jamie still wants to be 'Just Friends'. When he runs away and moves to L.A., he becomes an attractive music manager, whom everyone wants. When his jet β¦catches fire and is forced to land, when flying to Paris with his newest singing sensation, Samantha James, he ends up back home. To his surprise, he encounters Jamie again, and sets out to be more than 'Just Friends' this time. (Read More)
Themes: | christmasfriendshiplove |
Locations: | los angeles california |
Characters: | brother brother relationship |
Period: | 2000s |
Story: | pop starchristmas treelip synchingsurprisesanta clauschampagneguitarcell phonesinging |
John and Jane Smith are a normal married couple, living a normal life in a normal suburb, working normal jobs...well, if you can call secretly being assassins "normal". But neither Jane nor John knows about their spouse's secret, until they are surprised to find each other as targets! But on their q β¦uest to kill each other, they learn a lot more about each other than they ever did in five (or six) years of marriage. (Read More)
Themes: | dancemoneychristmasfriendship |
Mood: | rain |
Locations: | elevatormotorcyclenew york city |
Characters: | hostage |
Story: | telephone calllaptop computerremote controlblockbustereyeglassesdollsuitcasechampagnedinnercandlewinebedliecell phoneknife β¦singing (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Subgenre: | live action and animation |
Themes: | angerdance |
Locations: | motorcycle |
Characters: | brother brother relationship |
Story: | full moonsinging triobarefoot cartoon animalhalf dressed cartoon animalposteranthropomorphic animalanthropomorphismtoyragecandlebedbattleknifesinging |
Cheery Alex Fletcher lives comfortably in Manhattan off the residuals from his 80's pop success and reprising his hits at school reunions, theme parks, and state fairs. But those gigs are declining, so he jumps at the chance to write a song and record it with reigning teen idol Cora Corman. Trouble β¦is, he's good at melodies but needs a lyricist and has less than a week to finish. Enter Sophie Fisher, subbing for a friend who waters Alex's plants; she's a pretty good poet, quick witted, and could do it, if she'd agree. But there's some sort of shadow over her head that Alex may not be able to charm his way past. And what if they do get a song written, what then? (Read More)
Themes: | love |
Mood: | night |
Locations: | new york city |
Characters: | father son relationship |
Story: | pop staracoustic guitartelephone callpopmusic industrypostersongwriterscene during end creditsconcertcell phonesinging |
Buddy was a baby in an orphanage who stowed away in Santa's sack and ended up at the North Pole. Later, as an adult human who happened to be raised by elves, Santa allows him to go to New York City to find his birth father, Walter Hobbs. Hobbs, on Santa's naughty list for being a heartless jerk, had β¦ no idea that Buddy was even born. Buddy, meanwhile, experiences the delights of New York City (and human culture) as only an elf can. When Walter's relationship with Buddy interferes with his job, he is forced to reevaluate his priorities. (Read More)
Themes: | moneychristmaslove |
Locations: | elevatornew york city |
Characters: | brother brother relationshipfather son relationship |
Period: | winter |
Story: | christmas treetelephone callanthropomorphic animalmilkblockbustersanta claustoyfireplacecoffeebedliesinging |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Themes: | anger |
Mood: | rain |
Locations: | swimming poolrooftopelevatorwatercarforestnew york city |
Period: | winter |
Story: | sheet musicpart computer animationanthropomorphic animalanthropomorphismclockmilktoyfireplaceicedollcoffeebattleknife |
Retired madame Adelaide Bonfamille enjoys the good life in her Paris villa with even classier cat Duchess and three kittens: pianist Berlioz, painter Toulouse and sanctimonious Marie. When loyal butler Edgar overhears her will leaves everything to the cats until their death, he drugs and kidnaps the β¦m. However retired army dogs make his sidecar capsize on the country. Crafty stray cat Thomas O'Malley takes them under his wing back to Paris. Edgar tries to cover his tracks and catch them at return, but more animals turn on him, from the cart horse Frou-Frou to the tame mouse Roquefort and O'Malley's jazz friends. (Read More)
Themes: | dance |
Mood: | night |
Locations: | paris francemotorcycle |
Story: | acoustic guitarsinging animalanimal protagonistanthropomorphic animalanthropomorphismmilktalking animaldinnersinging |
In colorful, bustling modern-day Manhattan, Rafi Gardet, a beautiful 37-year-old photography producer reeling from a recent divorce, meets David Bloomberg, a handsome 23-year-old painter recently out of college. Rafi's therapist, Dr. Lisa Metzger, who is working to help Rafi overcome her fears of in β¦timacy, finds out that Rafi's new lover is--unfortunately for Lisa--her only son, David. Both David and Rafi must contend with their 14-year age gap, vastly different backgrounds and the demands of David's traditional mother. Despite their intense attraction, the charmed couple soon realizes that vastly different ages and backgrounds create much conflict. A Jewish hip-hop lover and closet painter who still lives with his grandparents, David has little in common with Rafi--a non-practicing Catholic from a wealthy, broken family who travels in the sophisticated, high-end world of fashion. (Read More)
Themes: | angerfriendship |
Mood: | hip hoprain |
Locations: | swimming poolelevatorparis francenew york city |
Characters: | father son relationship |
Story: | telephone callpostergrocery storeladderconvertibledinnercandlewinebedliecameracell phone |
Ray Ferrier (Cruise) is a divorced dockworker and less-than-perfect father. When his ex-wife and her new husband drop off his teenage son Robbie and young daughter Rachel for a rare weekend visit, a strange and powerful lightning storm suddenly touches down. What follows is the extraordinary battle β¦for the future of humankind through the eyes of one American family fighting to survive it in this contemporary retelling of H.G. Wells seminal classic sci-fi thriller. (Read More)
Mood: | rain |
Locations: | los angeles californiaparis francenew york city |
Characters: | single fatherjapanesehostagebrother brother relationshipfather son relationship |
Period: | 2000s |
Story: | telephone callcartoon on tvremote controlskateboardblockbustercagebattlecell phonesinging |
God lives in human form as a cynical writer with his young opinionated daughter in present-day Brussels, Belgium. She concludes that her dad is doing a terrible job and decides to rewrite the world, descending to earth in search of her own 6 messengers to write a brand new testament and change the s β¦tatus quo. (Read More)
Themes: | angermoneyfriendship |
Mood: | rain |
Locations: | elevator |
Characters: | father son relationship |
Story: | telephone callhula hoopvacuum cleanerrefrigeratorgrocery storemilkladderscene during opening creditscakeeyeglassesdollcandlebedcell phonesinging |
GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)
Themes: | moneyfriendship |
Locations: | swimming poolrooftopelevatormotorcycle |
Characters: | frenchmaid |
Period: | winter |
Story: | telephone calltennis courtbarking dogladdereyeglasseshatechampagnecandlewinetelephonebattleknifesinging |
Andrew Largeman is a semi-successful television actor who plays a intellectually disabled quarterback. His somewhat controlling and psychiatrist father has led Andrew ("Large") to believe that his mother's wheelchair bound life was his fault. Andrew decides to lay off the drugs that his father and h β¦is doctor made him believe that he needed, and began to see life for what it is. He began to feel the pain he had longed for, and began to have a genuine relationship with a girl who had some problems of her own. (Read More)
Themes: | dysfunctional familymoneyfriendship |
Mood: | rain |
Locations: | swimming poollos angeles californiamotorcycle |
Characters: | father son relationship |
Story: | acoustic guitarchristmas treetelephone callseeing eye dogcakefireplacemansiontelephonetelevisionguitarbedliesinging |
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. β¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
Themes: | anger |
Mood: | nightrain |
Locations: | motorcycleforest |
Story: | stuffed animallaptop computertalking animalcakefireplaceeyeglassesdollsuitcasedinnercandlecameracell phonesinging |
59 year old Ove is the block's grumpy man who several years earlier was deposed as president of the condominium association, but he could not give a damn about being deposed and therefore keeps looking over the neighborhood with an iron fist. When pregnant Parvaneh and her family moves into the terr β¦aced house opposite and accidentally backs into Ove's mailbox it turns out to be an unexpected friendship. A drama comedy about unexpected friendship, love and the importance of surrounding yourself with the proper tools. (Read More)
Themes: | angermoneyfriendshiplove |
Mood: | rain |
Locations: | swimming pool |
Characters: | frenchfather son relationship |
Story: | telephone callbarking dogladderscene during opening creditstoyeyeglassescoffeecandlewinetelephoneliecamera |
A married couple who have managed to remain blissfully happy into their autumn years, are surrounded over the course of the four seasons of one average year by friends, colleagues, and family who all seem to suffer some degree of unhappiness.
Themes: | angermoneychristmasfriendship |
Mood: | rain |
Locations: | paris francecar |
Characters: | brother brother relationshipfather son relationship |
Period: | winter |
Story: | telephone callt shirtcakesuitcasechampagnelimousinecoffeewinetelephone |
Michael Newman (Sandler) is a hard working family man, who must please his boss (Hasselhoff), in order to get promoted. Problem is he gets less time with his family, and wishes for a remote in which he can control his life. This soon comes true for Newman, when he meets Morty (Walken), a crazy sales β¦ clerk, who has the ultimate remote. A remote in which he can do anything, including muting, skipping and dubbing his life. He finds this to be the opportunity in which he can not only skip every argument, but also skip to his promotion. He sees this as a good idea, until the remote goes horribly wrong. (Read More)
Themes: | dysfunctional familychristmasfriendship |
Mood: | rain |
Locations: | swimming poolnew york city |
Characters: | japanesefather son relationship |
Period: | 2000s |
Story: | remote controlled toy helicoptertoy helicoptertelephone callcartoon on tvt shirtremote controlargumentcell phonesinging |
English rock star Aldous Snow relapses into drugs and booze after a break up and a disastrous record. In L.A., Aaron Green works for a record company stuck in recession. Aaron's boss gives him a career making task - to bring Aldous from London to L.A. for a concert in 72 hours. That day, Aaron's gir β¦lfriend Daphne tells him she wants to finish her medical residency in Seattle. Aaron's sure this ends their relationship. In London, things aren't much better: Aldous delays their departure several times, plies Aaron with vices, and alternates between bad behavior and trenchant observations. Can Aaron moderate Aldous's substance abuse and get him to the Greek? What about Daphne? (Read More)
Themes: | friendship |
Locations: | swimming poollos angeles californianew york city |
Characters: | father son relationship |
Story: | telephone calldrug referencerecord companymusic industryrocklas vegas nevadaconcertcell phone |
A family. Rose and Norah, in Albuquerque, lost their mother when they were young. Rose is responsible - a housecleaner, raising her seven-year-old son Oscar. She's also having an affair with Mac, a married cop, her high-school sweetheart. Norah can't hold a job. Their dad, Joe, is quirky. When Oscar β¦ is expelled for odd behavior, Rose wants to earn enough to send him to private school. Mac suggests she clean up after crime scenes, suicides, and deaths that go undiscovered for awhile. Rose enlists Norah, and Sunshine Cleaners is born. Norah bonds with the dead, Rose finds out that it's a regulated business, and complications arise. Can a family marked by tragedy sort things out? (Read More)
Themes: | dysfunctional familymoney |
Locations: | swimming poolelevatorcar |
Characters: | maid |
Story: | toy helicoptertelephone callvacuum cleanergrocery storeremote controlcakeautomobilefired from the jobcandlebedliecell phone |
The Rizzos, a family who doesn't share their habits, aspirations, and careers with one another, find their delicate web of lies disturbed by the arrival of a young ex-con (Strait) brought home by Vince (Garcia), the patriarch of the family, who is a corrections officer in real life, and a hopeful ac β¦tor in private. (Read More)
Themes: | anger |
Locations: | rooftopnew york city |
Characters: | father son relationship |
Story: | sitting on a rooftoptelephone callapple computerlaptop computergrocery storeremote controlladdereyeglassesconvertiblewineliecell phoneknife |
Reuben Feffer thinks he's found the love of his life but on his honeymoon he discovers her cheating on him with a scuba instructor. Reuben travels back home to get his life on track. On a night out with best pal, Sandy Lyle, Reuben discovers an old school friend, Polly Prince. Reuben feels a connect β¦ion straight away, and tries constantly to get her to like him. But it's not going to be easy for Reuben, especially when he spends his days calculating risks, and when someone unexpected turns up. (Read More)
Themes: | angerfriendshiplove |
Mood: | night |
Locations: | los angeles californiarooftopnew york city |
Characters: | frenchsecurity guardfather son relationship |
Story: | telephone calllaptop computerspanishchampagnewineliecameraknifesinging |
In 1982 legendary British heavy metal band Spinal Tap attempt an American comeback tour accompanied by a fan who is also a film-maker. The resulting documentary, interspersed with powerful performances of Tap's pivotal music and profound lyrics, candidly follows a rock group heading towards crisis, β¦culminating in the infamous affair of the eighteen-inch-high Stonehenge stage prop. (Read More)
Themes: | friendship |
Mood: | night |
Story: | concert tourelectric guitartelephone callrockscene during end creditslimousinetelephoneguitarcamerasinging |
John Clasky is a devoted dad whose skills as a chef have offered his family a very upscale life, including a summer home in Malibu and a breathtaking new Mexican housekeeper, named Flor. She and her daughter Cristina have recently emigrated to L.A. from Mexico and are trying to find a better life. W β¦hen they move in with the Claskys for the summer, Flor has to fight for her daughter's soul as she discovers that life in a new country is perilous! (Read More)
Themes: | dysfunctional familymoney |
Locations: | los angeles californiacar |
Characters: | maidfather son relationship |
Story: | telephone callcadillac escaladespanishsingle parentautomobileconvertiblecell phonesinging |
In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w β¦ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)
Themes: | angerdancelovefriendship |
Characters: | maid |
Story: | singing animalanthropomorphic animalanthropomorphismblockbusterscene during opening creditstalking animalrockfirst partdinnerconcertbedbattleknifesinging |
Rose Cooper is an uptight and by-the-book cop whose name has become a verb synonymous with screw-ups, and she's found a chance to redeem herself. She has been assigned to protect a federal witness, Daniella Riva, the vivacious and outgoing widow of a drug boss. As the two polar opposites race throug β¦h Texas, they find themselves pursues by everyone from crooked cops to murderous gunmen. However, their greatest obstacle to making this out alive may be themselves as they learn that Cooper has now been considered a fugitive fleeing with Danielle. (Read More)
Themes: | angerdancemoneyfriendshiplove |
Locations: | car |
Characters: | detective |
Story: | ford crown victoriat shirtsurpriserageconvertiblesuitcaseargumenttelevisionlie |
Four members of a high school band called Mystery do everything they can to attend a KISS concert in Detroit. In order to make it to the show they must steal, cheat, strip, deal with an anti-rock mom and generally do whatever it takes to see the band that has inspired them to be musicians.
Themes: | moneyfriendship |
Locations: | elevatorcar |
Characters: | brother brother relationshipfather son relationship |
Story: | telephone callstage frightpostervandalismrockconcertwineguitarliesinging |
Two sisters, plus a dead mother, a remarried father, and a hostile step-mother. The sisters, each in her way, have perfected the art of losing. The elder, Rose, is an attorney, responsible, lonely, with a closet full of shoes. The younger is Maggie, beautiful, selfish, and irresponsible. Her drunken β¦ behavior gets her tossed by her step-mother from her dad's house; worse behavior gets her tossed from Rose's apartment. Then, while searching in her father's desk for money to filch, Maggie finds an address; the past and the future open up to her and, with any luck, may open to her sister as well. (Read More)
Themes: | dysfunctional familymoneyfriendship |
Mood: | rain |
Locations: | swimming pool |
Characters: | japanese |
Period: | 2000s |
Story: | telephone calllaptop computergrocery storeremote controlmilkballoonlimousinewineliecell phoneknife |