Please wait - finding best movies...
In the 70's, the boy Billy is born with yellow skin due to a liver disease and his dysfunctional mother rejects him. Later he witnesses his mother and her lover killing his beloved father and burying him in the basement of their house, and he is locked in the attic alone along his childhood. When he β¦ is a teenager, he is sexually abused by his mother and she has a baby girl called Agnes. During Christmas, the deranged Billy escapes from his imprisonment, kills his mother and stepfather and blinds one eye of Agnes. He is declared insane and his sister is sent to an orphanage. In the present days, Billy escapes from the Clark Sanatorium to spend Christmas with his family. Meanwhile, his former house is the Delta Alpha Kappa sorority house in the campus of the Clement University, and the housemother and the sisters Kelli Presley, Dana, Lauren Hannon, Megan, Heather, Megan Helms, Melissa and Eve Agnew are preparing the house for Christmas party in a stormy night while Clair Crosby is in her room writing a card to bury the hatchet with her sister. When three sisters vanish, the others receive weird phone calls and believe something is wrong, but they find that they are trapped in the location. (Read More)
Subgenre: | slasher flickchristmas horrorholiday horrorteen horror |
Themes: | affaircannibalismcrueltysadismdysfunctional familypsychopathincestdrunkennessfearchristmasrevengemurder |
Mood: | slashergore |
Locations: | snowhospital |
Characters: | slasher killerchristiansister sister relationshipserial killerteenage boyteenage girl |
Period: | christmas partywinter2000s1970s |
Story: | sorority housechristmas wreathhouse fireplastic baginsane asylumbaby dollred wineobscene telephone callgreek letterimplied incestmother son incestremake of cult filmchristmas cookieschristmas cardchristmas decoration β¦christmas giftchristmas lightschristmas eveperson on firechristmas treedoor in the floorimpaled through eyeelectrical burnvisible breathgardening tooleye gougepaint thinnerhole in the floorice stormice skategas stovejaundicerolling pinreference to dick cheneyskin diseasedisturbed childhoodcandy canehidden corpsegingerbread mangarlandkilled with a hammerfountain penornamentsomnophiliadead sisternauseacrawlspaceturntablelaundry roomhelplessnesswreathcorkscrewmistletoeicicletileinbreedingvideotaped sexdecapitated bodystatutory rapefigurinedead teenagerporchplasticintoxicationmealdefibrillatorcrawlingnail polishpadlockbalisongcrutchdriver's licensewoman's neck brokensnowglobedrunken womanrocking chairdisturbed individualred herringasphyxiationsnoringpeep holeunicornsex on stairssole survivorsantaskiestrangementloss of sisterburnt bodybody bageyeballchandelierblizzardburnt facescalpelsororitystepfathersouthernersuffocationlaptop computercharacters killed one by onedead woman with eyes openbody countstabbed in the eyeasylumlonereye gougingdisfigurementatticdark humorpower outagemercilessnessconfrontationrear entry sextelescopemental institutiondead womanblack humorskullaccidental deathbuttocksmorguepornographyrecord playerobscene finger gestureneck breakingmurderercollege studentmissing persondollelectrocutionargumentnews reportsevered headinternethousestabbed to deathimpalementstabbingstrangulationwineflashlightnewspaperdecapitationtelephonevoyeurvomitingletterremakeblood splattercell phonefireshowersurprise endingcigarette smokingflashbackviolence (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | slasher flickteen horrorindependent filmcult filmamerican horror |
Themes: | psychopathfearmurderrevengedeathdeceptionsurveillanceevilmurder of a police officer |
Mood: | slashergoresatire |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | slasher killerserial killerteenage boyteenage girlnursekillersecurity guardvillainpsychiatristcoroner |
Period: | 2000s |
Story: | dead teenagerpeep holebody bagcharacters killed one by onebody countmental institutionskullmorgueobscene finger gestureneck breakingmurderercollege studentelectrocutionnews reportsevered head β¦internethousestabbed to deathimpalementstrangulationflashlightdecapitationblood splattercell phonefiresurprise endingflashbackviolencefemale nuditybloodsequeltwo word titlefightknifechasecorpsefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseaxeambulancemontagethroat slittingstabbed in the chestpolice officer killedstabbed in the backcharacter's point of view camera shotproduct placementevil mankicked in the facelightningskeletondisappearancethreatened with a knifesevered armkillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onefatebroken legmasked manrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockhanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorstupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myerslifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | slasher flickchristmas horrorholiday horrorindependent filmblack comedysuspensepsycho thrillerpsychological thriller |
Themes: | crueltypsychopathdrunkennessfearchristmasmurderrevengedeathkidnappinginfidelitybetrayalescapeinvestigationdeceptionloneliness β¦obsessionparanoiainsanitymental illnesssurveillanceabductionpanicmadnessnear death experience (See All) |
Mood: | slashergoreneo noircar chasedarknessone night |
Locations: | snownew york citycarwatertaxielevatorurban settingpolice carcityoffice |
Characters: | slasher killerpolicefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectivemysterious villain |
Period: | winter |
Story: | christmas lightschristmas eveperson on firechristmas treecharacters killed one by onebody countstabbed in the eyelonerpower outagerecord playerobscene finger gestureelectrocutionargumentstabbingstrangulation β¦wineflashlightnewspapervoyeurblood splattercell phonefiresurprise endingviolencenumber in titlebloodone word titledogfightexplosionpartyknifechasetelephone callcryinghigh heelsbeatingcorpsedigit in titlefistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasebound and gaggedaxevideo cameraambulancewomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderstalkerorganized crimestabbed in the backscreamingattackcharacter's point of view camera shotproduct placementknocked outkicked in the faceattempted rapebodyguardstalkingexploding bodyisolationdie hard scenariomaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingbusinesswomantitle appears in writingco workerescape attemptstabbed in the headsexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolineduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Subgenre: | slasher flickteen horrorindependent filmcult filmblack comedysuspensefish out of waterteen moviesurvival horrorpsychological thriller |
Themes: | cannibalismpsychopathfearrevengemurderdeathfriendshipkidnappingtortureescapebrutalityparanoiainsanityhome invasionpanic β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | slashergore |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | slasher killerteenage boyteenage girlteenagerboyfriend girlfriend relationshippolice officerhostageinterracial relationshipself mutilation |
Period: | 2000s |
Story: | person on fireinbreedingdead teenagercharacters killed one by onebody countdisfigurementmercilessnesscollege studentdollsevered headstabbed to deathflashlightdecapitationblood splattercell phone β¦firesurprise endingcigarette smokingviolencesexbloodexplosionknifechasepistolcryingbeatingcorpseshot to deathcar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backsurvivalfoot chasebound and gaggedambushaxemountaindeath of friendtoiletstabbed in the chestmapexploding cardisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingfirst of seriesscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalpolice officer shotengagementbooby trapaerial shotblood on shirtone daygasolineaxe murdersevered legarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned carwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | christmas horrorcult filmsuspenseparanormal phenomenaitalian horrorpsychological horrorcult classic |
Themes: | sadismpsychopathdrunkennesschristmasmurderdeathsurrealisminfidelityrapeghostjealousydrinkingfuneralinvestigationanger β¦corruptiondeath of fatherbrutalityparanoiablackmailinsanityillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | slashergorenightdarkness |
Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car β¦cityitalytruck (See All) |
Characters: | slasher killerserial killerhomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlpolicemanmusician β¦actresskillervillainpsychiatristmaidprofessorjewterrorgermangay friendmysterious villainserial murdererself pity (See All) |
Period: | 1970s |
Story: | house firechristmas treefigurinecrawlingburnt bodyeyeballburnt facecharacters killed one by onedead woman with eyes openbody counteye gougingdisfigurementmercilessnessdead womanrecord player β¦murdererdollsevered headhousestabbed to deathimpalementstabbingstrangulationflashlightnewspaperdecapitationtelephonevomitingblood splatterfiresurprise endingcigarette smokingflashbackviolencebloodtwo word titlegunkissphotographsingingknifechasetelephone callsongshootoutbeatingcorpsemirrorface slapwatching tvcameradrinksecretshootingpaintingbookrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisionreportersubjective camerasurvivalgay slurbedroomjournalistbandold manaxedinerjokebrunettedrivingbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeystatueskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonmaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolinfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpaststabbed in the neckmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead manslaughterdark pastfemale reportergay stereotypeliving roomkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingmessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturerblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockchildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
Subgenre: | black comedy |
Themes: | drunkennessmurderdeathfriendshipbetrayalguilt |
Mood: | slashergorehorror movie remake |
Locations: | kitchenfire truck |
Characters: | serial killerfather son relationshipboyfriend girlfriend relationshipbrother sister relationshipinterracial relationshipalcoholicmysterious killerdeath of a friend |
Story: | sorority houseperson on firesororitylaptop computercharacters killed one by onedead woman with eyes opendead womancollege studenthouseimpalementstrangulationflashlightvoyeurvomitingremake β¦blood splattercell phonefireshowersurprise endingviolencefemale nuditybloodfemale frontal nuditymale rear nuditybare chested malefemale rear nuditypartyknifechasepantiescorpsemirrorshot in the chestblondeshotgunslow motion scenepunched in the facebare buttsecretheld at gunpointlingeriecollegehallucinationhandcuffsalcoholcleavageaxeambulancedeath of friendthroat slittingstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialoguemini skirtchampagnecover upscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleedbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiesmisogynyfemale in showerlyingfirefightervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | slasher flickholiday horrorcult filmsuspensepsycho thrilleramerican horror |
Themes: | psychopathfearmurderdeathjealousytorturevoyeurismmemoryseductionbrutalityobsessionparanoiainsanityblindnesstrauma β¦madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
Mood: | slashergorenightdarkness |
Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
Characters: | slasher killerserial killerteenage girlpoliceteenagerboyfriend girlfriend relationshippolice officernursedetectivepolicemankillervillainsheriffterrorserial murderer |
Period: | 1970syear 1978 |
Story: | person on fireburnt facescalpelcharacters killed one by onedead woman with eyes openbody countstabbed in the eyeeye gougingdisfigurementmercilessnessdead womanbuttocksmurderercollege studentnews report β¦stabbed to deathstabbingstrangulationflashlightvoyeurblood splatterfirecigarette smokingviolencesexfemale nuditynuditynumber in titlebloodmale nuditybare breastssequelmale rear nuditytwo word titlekissfemale rear nuditynipplesexplosionknifechasetelephone callcryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborrevolversubjective cameragood versus evilhalloweenold manambulancethroat slittingaccidentbrunettepart of serieshit by a carbathsearchpantyhoseold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreaminguniformpoisoncharacter's point of view camera shotproduct placementscreaminjectionstalkingglasseswitnesstrapsplattermaniactv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingcaucasianpoolpsychogrindhousepsychologistbuttdriving a cartowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead manslaughterdark pastnude woman murderedlightneighborhoodbloodbathsmokemasked killerpsycho killerflat tirefemale stockinged feetdead girlserial murderpsychopathic killerbad guyconfusioncar troublemadmanmysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonehomicidal maniacsuit17 year oldearringnurse uniformslashingdental maskblood stainclinicparamedicshot in the eyestethoscopeadult actress playing teenage girlcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichebutcherygrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
Themes: | sadismpsychopathmurderdeathtorturebrutalitysupernatural powerinsanityevil |
Mood: | slashergorebreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | slasher killerserial killerteenage boyteenage girlbrother sister relationshipkillervillainterrormysterious villainserial murderermysterious killer |
Period: | 1980s |
Story: | corkscrewdisturbed individualsole survivorcharacters killed one by onebody countdisfigurementmorgueobscene finger gesturemurderersevered headstabbed to deathimpalementstrangulationdecapitationblood splatter β¦surprise endingviolencesexfemale nuditynumber in titlebloodmale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiescorpseunderwearmasklow budget filmsubjective camerachild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexcabinloss of motherkillingmaniacsexual attractionlifting someone into the airragemutilationfourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterbody landing on a carkilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichebutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | sadismpsychopathfearrevengemurderdeathlovesurrealismkidnappingmarriagemoneybetrayalpregnancyescapewedding β¦deceptionseductionrobberybrutalitysupernatural powerparanoiaredemptionunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
Mood: | slashergorecar chasepoetic justice |
Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
Characters: | serial killerteenage boyteenage girlhomosexualpoliceteenagerboyfriend girlfriend relationshiptattoopolice officerdetectivepriesthostagethiefpolice detective β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | nail polishasphyxiationburnt bodyburnt facesuffocationdead woman with eyes opendisfigurementdark humorblack humorskullobscene finger gesturedollelectrocutionargumentnews report β¦impalementstrangulationflashlighttelephoneletterblood splattercell phonefiresurprise endingcigarette smokingviolencesexcharacter name in titlebloodsequelbare chested malegunkissfightphotographknifechasepistolcryingbeatingcorpseshot to deathcar accidentmirrorshot in the chestrescueslow motion scenewatching tvbare buttshowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffsrevolverf wordorphanambushmansionmontagethroat slittingbridgestabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardmarriage proposalon the runattempted murderstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roompay phonefugitiveumbrellarace against timeknocked outbaseball batlightningskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upnewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothbirthmexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storeshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormknife throwingraised middle fingertrailertied feetsequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lensharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referencebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovendecomposing bodyabusive relationshipevil dollfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | slasher flickindependent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror |
Themes: | psychopathdrunkennessfearmurderrevengedeathsuicidekidnappingghosttorturedeath of fatherbrutalitysupernatural powerdeath of motherinsanity β¦evilabductiontraumafear of water (See All) |
Mood: | slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore |
Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
Characters: | slasher killerserial killerteenage boyteenage girlfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipzombielittle girlkillervillainsheriffterrormysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | person on firedead teenagerburnt bodyburnt facecharacters killed one by onebody counteye gougingneck breakingmurdererelectrocutionsevered headimpalementstabbingdecapitationblood splatter β¦fireshowersurprise endingviolenceflashbackcharacter name in titlebloodsequelphotographexplosionpartypistolvoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemonfoot chasedream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologuecharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingpremarital sexcabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityslaughterdemonic possessionkilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downcornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverpsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chesthockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list β¦of suspects goes down. (Read More)
Subgenre: | slasher flickteen horrorcult filmblack comedysuspenseconspiracypost modernteen moviehorror spoof |
Themes: | sadismpsychopathdrunkennessfearmurderrevengedeathlovebetrayalescapeinvestigationdeceptionvoyeurismparanoiainsanity β¦theatremurder of a police officernear death experience (See All) |
Mood: | slashergoresatire |
Locations: | hospitalbicyclepolice stationpolice carfire truck |
Characters: | serial killerpoliceteenagerboyfriend girlfriend relationshipfemale protagonistpolice officerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | sorority housered herringsororitycharacters killed one by onebody countmercilessnesscollege studentnews reportinternetstabbed to deathimpalementstabbingflashlighttelephonevoyeur β¦blood splattercell phonesurprise endingcigarette smokingviolencef ratednumber in titlebloodsequelinterviewbare chested malekisssingingpartyknifechasepistolbeatingcorpsedigit in titleshot to deathcar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegehallucinationtelevisionf wordreportergood versus evilsurvivalfoot chasegay slurbedroomjournalistambushaxevideo cameraambulancedeath of friendthroat slittingstabbed in the chestfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvanshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facelightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplayethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callreference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | teen horrorblack comedysuspensesuperherotragedypsycho thrillersurvival horrorpsychological thrilleramerican horror |
Themes: | cannibalismpsychopathfearmurderdeathfriendshipsurrealismkidnappingrapebetrayalescapefuneralmonsterdeceptionvoyeurism β¦death of fatherbrutalityparanoiainsanitymental illnesssurveillancepanichuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | slasher killerserial killerteenage girlfather daughter relationshipteenagerafrican americandoctorpolice officerhostagekillersecurity guardvillainpsychiatristterroruncle niece relationship β¦serial murdererpolice dog (See All) |
Period: | 2010s |
Story: | disturbed childhoodcrawlspacedead teenagercrawlingdisturbed individualsole survivorcharacters killed one by onebody countlonerpower outagemercilessnessmurderermissing personnews reportflashlight β¦voyeurcell phonesurprise endingflashbackviolencebloodone word titlesequeldogbare chested maledancingtitle spoken by characterpartyknifechasepantiescorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborriversubjective camerasurvivalorphanbedroomambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partyold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shottentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionkillingmaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalzooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctordark pastkilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencewhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blacksinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdisturbingcaged humankidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeepersuperhuman speedreference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | slasher flickteen horrorindependent filmteen moviesurvival horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
Themes: | fearmurderrevengedeathfriendshipsurrealismkidnappingescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic β¦self sacrificenear death experience (See All) |
Mood: | slashersatirespoofhigh schoolparodyambiguous ending |
Locations: | hospitalforestwoodssinging in a car |
Characters: | slasher killerserial killerteenage boyteenage girlhomosexualteenagermother daughter relationshipdoctortattoofemale protagonistgirlnursehostagekillermother β¦ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All) |
Period: | 1980syear 1986year 1987 |
Story: | person on firecharacters killed one by onebody countdisfigurementmercilessnessrecord playerneck breakingsevered headstabbed to deathimpalementdecapitationvoyeurvomitingcell phonefire β¦surprise endingcigarette smokingflashbackviolencetwo word titlebare chested maledancingexplosionknifechasethree word titlepantiesshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingshowdowncar crashf wordgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontagedinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaserace against timelightningprankscarhigh school studentfilm within a filmgirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazineescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogknife throwinggasolinedark pastgeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | slasher flickteen horrorindependent filmcult filmsuspensepsycho thrillerteen moviemurder mysteryamerican horror |
Themes: | crueltysadismpsychopathfearrevengemurderdeathvoyeurismcorruptionbrutalityinsanityhumiliationeviltraumamysterious death |
Mood: | slashergorenightdarknessblood and gore |
Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
Characters: | slasher killerserial killerteenage boypoliceteenagerfriendpolice officerpolicemanartistkillermothervillainsheriffterrortruck driver β¦mysterious villainserial murderer (See All) |
Period: | 1970s1950ssummer |
Story: | dead teenagersole survivorcharacters killed one by onebody countatticpower outagemercilessnessdead womanmurdererstabbed to deathstabbingdecapitationvoyeurblood splattersurprise ending β¦violencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiesbeatingcorpsedigit in titlefistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationguitarsubjective camerabedroombracandleold manaxemassacrewomanthroat slittingdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseperversiondead manslaughterlens flareaxe murderroomkilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencetraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
3 backpackers are in Amsterdam where they get locked out of their youth hostel. They are invited into a man's house where he tells them of a hostel somewhere in eastern Europe where the women are all incredibly hot and have a taste for American men. When they get there, everything is too good to be β¦true - the hostel is "to die for" (Read More)
Subgenre: | slasher flickcult filmconspiracysurvival horrorsadistic horror |
Themes: | sadismpsychopathfearmurderrevengedeathsuicidekidnappingdrinkingtortureescapedeceptionseductiontravel β¦brutalitypolice brutality (See All) |
Mood: | slashergorecar chase |
Locations: | trainpolice stationbrothelmuseumtrain stationsex in a bathroom |
Characters: | slasher killerserial killerfriendprostituteamerican abroad |
Story: | sole survivorburnt facescalpeleye gougingmercilessnessrear entry sexcollege studentmissing personsevered headhousestrangulationvomitingblood splattercell phoneviolence β¦female nuditybloodone word titlethreesomefemale frontal nuditymale rear nuditybare chested malefemale rear nuditydancingphotographtitle spoken by characterpantiespistolbeatingcorpseshot to deathshot in the chestface slapheld at gunpointprostitutionhandcuffsshot in the backsubjective camerafoot chasebound and gaggeddeath of friendthroat slittingtied to a chairchild in perilhit by a carcontroversysearchfemme fataleshot in the foreheadpainon the runbeaten to deathscreamingcharacter's point of view camera shotcover updisappearanceglassestrappremarital sexfirst partwhippingeuropedismembermentsurgerychainsawpot smokingwarehousegothicmachetemutilationdesperationsevered handcovered in bloodsadomasochismcrying manpassportsexual desirecameostealing a carwhippunched in the stomachtitle appears in writingscissorstitle at the endvegetariantoursevered legsurprise after end creditsdrugged drinkpsychopathic killermysterious manbongbag over headforeigneramsterdam netherlandshead bashed inwoman in bra and pantiesicelandwhistlingbusiness cardunsubtitled foreign languagefinger cut offcrushed headcorrupt policekiller childextreme violencespaslaughterhousedrillcut into pieceshit with a hammerlocked in a roomstupid victimnude photographhit by a traintorture chamberpower drillbodily dismembermentbubble gumblowtorchhostelhit with a rocksledge hammerbackpackersaladhit on the head with a rockdrill in the headburn injuryslovakiaachilles tendon cuthead in a toiletugly americanhit by a doorsevered toebegging for lifefanny packthrown out of a barbratislavareflection in glasshousehold cleaning gloveswhimperingkid gangtitle appears in text on screensearching for friendsearching for missing friend (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | slasher flickholiday horrorteen horrorindependent filmcult filmpsycho thrillerteen movieamerican horror |
Themes: | psychopathfearmurderdeathcorruptionparanoiaevilmurder of family |
Mood: | slasherhigh schoolnight |
Locations: | carsmall towncar theftkitchen knife |
Characters: | slasher killerserial killerteenage boyteenage girlhusband wife relationshipteenagerboyfemale protagonistgirllittle girlkillerlittle boyvillainpsychiatristterror β¦doctor patient relationshipserial murderer (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | laundry roomdead teenagerdead woman with eyes openbody countmercilessnessdead womanmurdererstabbed to deathstabbingstrangulationtelephoneblood splattersurprise endingcigarette smokingviolence β¦female nuditynudityone word titledogguntitle spoken by characterknifeshot to deathshot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisionsubjective cameragood versus evilhalloweenthroat slittingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingfirst parthandgunkillingmaniacpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbusterpsychogrindhousemasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhunttvtitle at the endkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phoneheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | slasher flickteen horrorcult filmsupernaturalpsycho thrillerparanormal phenomenaamerican horror |
Themes: | psychopathmurderdeathprisonmonstersupernatural powerinsanityevilmurder of a police officer |
Mood: | slashergorecar chasedarknessbreaking the fourth wall |
Locations: | forestcemeterysmall townboatwoodslakeamerica |
Characters: | slasher killerserial killerpoliceteenagerzombiekillervillainsheriffterrorserial murderer |
Period: | 1980s |
Story: | dead teenagerbody countneck breakingmurdererelectrocutionsevered headstabbed to deathstabbingflashlightdecapitationblood splattersurprise endingflashbackviolencesex β¦character name in titlenumber in titlesequelmasknumbered sequeldemonmassacreambulancechildlooking at the cameradrowningevil manstalkingunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightninghockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | slasher flickteen horrorindependent filmcult filmpsycho thrillerparanormal phenomenaamerican horror |
Themes: | psychopathmurderrevengedeathmonstersupernatural powerevildrug addictionmurder of a police officer |
Mood: | slashergorerainhigh school |
Locations: | new york cityboatwoodsseacityamericasewer |
Characters: | slasher killerserial killerteenage boyteenage girlzombiepolice officerkillervillainteacher student relationshipterrormysterious villainserial murderer |
Period: | 1980s |
Story: | dead teenagercharacters killed one by onebody countstabbed in the eyeelectrocutionstabbed to deathimpalementstabbingstrangulationflashlightdecapitationblood splatterviolencefemale nuditycharacter name in title β¦number in titlebloodsequelbare chested maleexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york citygangnew yorkaxevideo camerathroat slittingsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantiescharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughtersequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoonhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | sadismpsychopathfearmurderdeathfriendshipsurrealismkidnappingrapetorturedeath of fatherbrutalitydeath of motherinsanityevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | slashergorenightmarecar chasenightdarknessblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | slasher killerserial killerteenage girlfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipfemale protagoniststudent β¦best friendkillervillainterrorfrenchbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | plastic bagpadlockdisturbed individualsuffocationcharacters killed one by onebody countmurdererdollsevered headhouseimpalementstabbingflashlightdecapitationtelephone β¦voyeurblood splattershowersurprise endingcigarette smokingviolenceflashbackfemale nudityf ratedbloodbare breastsfemale frontal nuditymasturbationdoggunphotographknifelesbian kisschasetelephone calldreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborshot in the backsubjective camerasurvivalbound and gaggedaxemassacrethroat slittingstabbed in the chestscantily clad femalevanon the runevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultkilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killertaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerweirdocircular sawbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | slasher flickteen horrorindependent filmcult filmteen movieamerican horrorindependent horror |
Themes: | psychopathmurderrevengesurrealismfuneralsupernatural powerevil |
Mood: | slashergorehigh schoolnightmareavant garde |
Locations: | cemeterybathtubpolice station |
Characters: | slasher killerserial killerteenage girlhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipkilleralcoholicvillainterrorpolice chaseself mutilationmysterious villain β¦serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | person on firedead teenagerbody bagburnt facecharacters killed one by onebody countdisfigurementhousestrangulationtelephoneblood splattersurprise endingcigarette smokingviolenceblood β¦bare chested maledreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomsubjective cameragood versus evilfoot chasedeath of friendstabbed in the chestcoffeefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapcellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a window15 year olddripping bloodfinger cut offdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | slasher flickteen horrorindependent filmcult filmblack comedysuspensetragedypsycho thrillersurvival horroramerican horrorindependent horror |
Themes: | cannibalismsadismdysfunctional familypsychopathfearmurderdeathfriendshipkidnappingtortureescapebrutalityparanoiainsanityevil β¦exploitationpanicinheritancemadnessnear death experience (See All) |
Mood: | slasheravant gardedarknessambiguous ending |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | slasher killerserial killerteenage boyteenage girlfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshiphostagekillervillainterrorself mutilationtruck driver β¦serial murdererself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | inbreedingdead teenagerdisturbed individualsole survivoreyeballcharacters killed one by onebody countdark humormercilessnessskullmurderernews reportimpalementflashlightdecapitation β¦vomitingblood splattersurprise endingviolencebloodphotographknifechasevoice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightsunglassesrunninglow budget filmcollegesurvivalfoot chasebound and gaggedambushmassacredeath of friendstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigtied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captivesummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammerpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonelifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographgruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | psychopathincestmurderdeathdrugsrapetorturebrutalityinsanityevilexploitationmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | slasher killerserial killerbrother sister relationshipprostitutekillervillainterrormysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | woman's neck brokendisturbed individualbody countstabbed in the eyedark humorneck breakingsevered headstabbed to deathstabbingstrangulationdecapitationblood splattersurprise endingviolencefemale nudity β¦character name in titlenuditybloodbare breastsgunshot to deathshot in the chestlow budget filmmarijuanacriminalbisexualvideo cameradrug dealerstabbed in the chestchild abusecontroversypantyhosestalkerevil manattempted rapestalkingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetbutcherpsychotronicperversionmurder of a childslaughterabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
Subgenre: | independent filmcult filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
Themes: | crueltysadismdrunkennessfearmurderdeathfriendshipsurrealismescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoia β¦illnessevilunrequited lovepanicblindnessself sacrificemysterious death (See All) |
Mood: | slashergorerainnightavant gardedarknessstylization |
Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
Characters: | sister sister relationshipteenage girlteenagerfrienddoctorboyfemale protagonistteachergirlpolice officerstudentkillerpsychiatristprofessorwitch β¦germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
Period: | 1970syear 1977 |
Story: | nauseadead woman with eyes opendisfigurementatticpower outagemercilessnessdead womanmurderercollege studentmissing personstabbed to deathimpalementstabbingstrangulationwine β¦telephonevoyeurblood splatterfiresurprise endingcigarette smokingflashbackviolencebloodone word titledogdancingexplosionknifechasetelephone callvoice over narrationcorpseslow motion scenesecretfalling from heightshowdownbathroompianodemonhallucinationsubjective cameraswimminggood versus evilfoot chaseambushdeath of friendthroat slittingtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotcover uplightningscreamhangingdisappearanceinjectionsuspicionfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadstabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotshadowblood on shirttitle at the endrainstormnotedressing roomblind manopening a doorroomlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a doghallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | slasher flickteen horrorcult filmcoming of ageblack comedysuspenseconspiracypost modernteen moviepsychological thrillerhorror spoof |
Themes: | psychopathdrunkennessfearmurderrevengedeathfriendshipinfidelitybetrayalescapeinvestigationextramarital affairdivorcebrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | slashergoresatirehigh schooldarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | slasher killerserial killerteenage boyteenage girlfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistvillain β¦sheriffsingle fatherself referential (See All) |
Period: | 1990s |
Story: | dead teenagerred herringcharacters killed one by onepower outageelectrocutionnews reportstabbed to deathflashlighttelephoneblood splattercell phonefiresurprise endingcigarette smokingviolence β¦f ratedbloodone word titlebare chested maletitle spoken by characterpartyknifechasepistolcorpseshot to deathcar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisionf wordsubjective camerasurvivalfoot chasebound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevanshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportermasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned carhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | slasher flickindependent filmcult filmdark comedycreature featuresadistic horror |
Themes: | cannibalismsadismfearmurderdeathsurrealismkidnappingrapejealousytorturefuneralmonsterseductiontheftdeath of father β¦insanitymental illnesstheatremadnessmurder of a police officer (See All) |
Mood: | slashergorerainnightmare |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | slasher killerserial killerfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipthiefsheriffpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | person on fireburnt bodydead woman with eyes openskullmissing personsevered headhousestabbed to deathblood splatterfiresurprise endingflashbackviolencenumber in titleblood β¦bare chested maledancingphotographknifechasepistolbeatingdreamcorpsedigit in titleshot to deathcar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed in the chesttied to a chairmapman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialoguecharacter's point of view camera shotactor playing multiple rolesevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanternpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a cartow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c β¦olleagues (Read More)
Subgenre: | slasher flickcult filmblack comedysuspensesurvival horror |
Themes: | psychopathfearrevengemurderdeathsurrealismrapedrinkingescapevoyeurismangersupernatural powerparanoiainsanitysurveillance β¦evilpanictechnologymadness (See All) |
Mood: | slasher |
Locations: | restaurantswimming poolelevatorlaboratory |
Characters: | slasher killerboyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientist |
Period: | 2000s1990s |
Story: | person on fireicicleburnt bodycharacters killed one by onebody countneck breakingelectrocutionimpalementstrangulationvoyeurvomitingblood splatterfireshowerviolence β¦female nuditybloodfemale frontal nuditymale rear nuditydogbare chested malegunkissfightnipplesexplosionchasepantiestelephone calldreamcorpseunderwearmirrorshot in the chesturinationface slappunched in the facecomputerdrinkthongmaskshowdownsunglassesbombdead bodycafebathroomsciencescientistsurvivalfoot chaseman with glassesanti herounderwater scenedrowningtransformationstalkerdangerstabbed in the backsuburbinjectionpursuitstalkingratfirst partcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathlifting someone into the airstabbed in the stomachmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance cameraresearchthirty somethinglasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abuseelectric shockgiving a toastseizuretop secretsole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insectsprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package β¦ - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)
Subgenre: | paranormalamerican horror |
Themes: | sadismpsychopathmurderdeathadulteryescapefuneralsupernatural powerdeath of motherevilmurder of a police officermurder of family |
Mood: | slashergore |
Locations: | cemeteryelevatorwheelchaircourtroom |
Characters: | slasher killersister sister relationshipserial killerfamily relationshipshusband wife relationshipmother daughter relationshippolice officerterroraunt niece relationshipbrother in law sister in law relationship |
Period: | year 1988year 2013 |
Story: | eyeballstabbed in the eyeeye gougingdollelectrocutionsevered headstabbed to deathdecapitationblood splattersurprise endingflashbackviolencecharacter name in titlebloodsequel β¦knifelesbian kisscorpseslow motion scenewritten by directorfalling from heightcar crashf wordaxethroat slittingtied to a chairjudgechild in perilcharacter repeating someone else's dialoguestabbed in the backelectronic music scorescene during opening creditssevered handhome movieduct tape over mouthcameoblack and white scenestabbed in the legscene after end creditsevidencedeath of sisteraxe murdernannyclose up of eyesblood on camera lenscartoon on tvbag over headold dark houseblackouthomicidal maniacfilm projectoryoung version of characterblood stainwoman in bra and pantieswrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedvillain not really dead clichestabbed with scissorsdeliveryevil dolldark and stormy nighthorror iconreference to charles mansondeath by electrocutionkilled in police carmanic laughterkiller dollmurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All) |
When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.
Subgenre: | slasher flickblack comedyconspiracydeadpan comedy |
Themes: | psychopathmurderdeathdeceptiondeath of fatherdeath of motherhome invasiondeath of wifepanicinheritance |
Mood: | slashergore |
Characters: | serial killerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipaustralian |
Story: | sole survivorcharacters killed one by onestabbed in the eyedark humorcollege studentargumentstabbed to deathimpalementwineflashlightblood splattercell phonesurprise endingcigarette smokingviolence β¦bare breaststwo word titlebare chested maleknifetopless female nuditycorpseshot to deathslow motion scenepunched in the faceneighborshot in the backfoot chaseaxemansionthroat slittingstabbed in the chestno opening creditspolice officer killedshot in the foreheadcharacter repeating someone else's dialoguebeaten to deathstabbed in the backshot in the shoulderdeath of brotherbasementtrapclaim in titlefireplaceheroinemachetefaintingcovered in bloodmasked mancamera shot of feetcrossbowstabbed in the neckkicked in the crotchtitle appears in writingstabbed in the headsibling rivalryjumping through a windowthrown through a windowbooby trapdeath of sistertitle at the endlooking at self in mirroraxe murderarrowmasked killermale in showerclose up of eyesman cryingshot through a windowwoman cryingfamily reunionbroken windowstabbed in the armhired killerhead bashed inwoman in bra and pantiespatricidecrashing through a windowman punching a womancollege professordeath of boyfriendstabbed in the shoulderstabbed in the facehiding under a bedmasked villainmatricidefilm starts with sexbloody violencebutcher knifewedding anniversaryflash camerafratricideleg woundsaying gracethroat cutbrickwoman wearing black lingeriejumping out a windowwoman punching a manstabbed multiple timeswriting in bloodstabbed in the footbig familybitten handrich familystartledloud musichit with a frying panmale in a showerno cellphone signalcleaversurvivalistblenderthrown through a glass doorfacial cutfamily portraithit in the throatstabbed with a screwdrivervictim invited to dinnervicodinclotheslinedvictim fights backpiano wirestabbed with a glass shardlooking under a bedstepping on a nailbreaking a lightbulb (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
Themes: | psychopathdeathsupernatural powerevil |
Mood: | slashergoreraincar chase |
Locations: | chicago illinoisschool buswater gun |
Characters: | slasher killerserial killerhusband wife relationshippoliceboyteacherkillervillainterrorserial murderernew student |
Period: | 1990s |
Story: | burnt facesuffocationbody countstabbed in the eyeeye gougingblack humorobscene finger gestureneck breakingmurdererdollelectrocutionstabbed to deathstrangulationcigarette smokingblood β¦sequelsingingpunctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedambulancethroat slittingstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathpossessionevil manlightningdeath of husbandbasementthreatened with a knifemaniacfalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedpsychosevered handbutchershovelstabbed in the legexploding headthrown through a windowswingraised middle fingersocial workersevered legsequel to cult favoritevoodoopajamasframed for murderpsycho killerpsychopathic killerbad guymadmanhiding in a closetevil spirithomicidal maniacclimbing through a windowelementary schoolhanging upside downhead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
A double-bill of thrillers that recall both filmmakers' favorite exploitation films. "Grindhouse" (a downtown movie theater in disrepair since its glory days as a movie palace known for "grinding out" non-stop double-bill programs of B-movies) is presented as one full-length feature comprised of two β¦ individual films helmed separately by each director. "Death Proof," is a rip-roaring slasher flick where the killer pursues his victims with a car rather than a knife, while "Planet Terror" shows us a view of the world in the midst of a zombie outbreak. The films are joined together by clever faux trailers that recall the '50s exploitation drive-in classics. (Read More)
Subgenre: | slasher flickholiday horrorcult filmblack comedyb movie |
Themes: | cannibalismsadismpsychopathmurderrevengedeathfriendshipghostjealousylesbianismescapeextramarital affairsupernatural powerexploitationmurder of a police officer |
Mood: | slashergorecar chaseblood and gore |
Locations: | hospitalbarbeachrestauranthelicoptermotorcycleelevatorstrip clubmexicokiller car |
Characters: | serial killerteenage boyteenage girlmother son relationshipfather daughter relationshipdoctortattoobrother brother relationshipzombiesoldiernursepriestactresssingle mother β¦killersherifftruck driver (See All) |
Period: | year 2007 |
Story: | person on firestabbed in the eyedisfigurementmorguesevered headstabbed to deathstabbingdecapitationfireviolencef ratedbloodone word titlefemale frontal nudity β¦sex sceneinterracial sextitle spoken by charactershootoutshot to deathunderweartesticlesmachine guncar accidentshot in the headfalling from heightmarijuanagood versus evilbridgedinerstabbed in the chestexploding carapologyman with glassesassassinationhit by a cardouble crossshot in the legmarriage proposalshot in the foreheadracial slurbeaten to deathstabbed in the backringattempted rapescarcheerleaderfilm within a filmexploding bodybasementpremarital sexsevered armshot in the armdismembermentmaniacwerewolfsyringekilling an animalmachetewoman with glassesbabysittercookmad scientistdrug abuseexploding buildingassaultgrindhouseparadeend of the worldinterracial friendshipeaten alivetensionsevered fingerloss of sonstabbed in the neckshot in the faceexploding headassault rifleinfectionsiegebarbecuecastrationsevered leggatling gungrenade launcherthanksgivingtext messagingserial murdercar troublestabbed in the handhomagehead blown offexotic dancerhuman monsterjukeboxhomicidal maniacold flamecameo appearancetennesseehit by a truckmilitary basesaxophoneretrotrampolinedirector also cinematographerflesh eating zombiedisc jockeywalking deadstuntmandeformitybroken neckchild with gunaustin texasunwed pregnancyfake commercialmakeup artistbroken handfake trailerdirected by several directorsmultiple cameosanthropophaguswooden legthermometercinephiliachemical weaponsripped in halfaccidental suicidenazi experimentintentional goofmelting manreal twins playing twinsfilm breakon hood of moving car (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β¦are after the backpackers find a way to escape. (Read More)
Subgenre: | slasher flickindependent filmcult filmsuspenseaustralian horrorsadistic horror |
Themes: | crueltysadismpsychopathdrunkennessfearmurderdeathkidnappingrapedrinkingtortureescapebrutalityinsanityevil β¦abductionexploitation (See All) |
Mood: | slashergorecar chasenightdarknessblood and gore |
Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β¦australian outbackcar on fireshed (See All) |
Characters: | slasher killerserial killerhusband wife relationshipdoctorsingerhostagekillervillainaustralianterrorself mutilationmysterious villainserial murderermysterious killer |
Period: | year 1999 |
Story: | helplessnessdisturbed individualsole survivorcharacters killed one by onebody countmercilessnessobscene finger gesturemurdererstabbed to deathimpalementstabbingflashlightvoyeurvomitingblood splatter β¦cigarette smokingviolenceblooddogtwo word titlegunkissphotographtitle spoken by characterexplosionsingingpartyknifechasebased on true storysongcorpseshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomguitarshot in the backf wordswimminggay slurbound and gaggedmassacrevideo camerafalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partdismembermentufokillinggaragemaniacpickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingergunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetopening a doorsexual assaultkilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencefemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichebutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | sadismpsychopathfearmurderrevengedeathbrutalityinsanityevilexploitationpolice investigation |
Mood: | slashergorerainnightmarenightdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | slasher killerserial killerpolicemother son relationshipteenagerbrother brother relationshipkillervillainsheriffterrormysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | disturbed individualeyeballcharacters killed one by onebody countstabbed in the eyeeye gougingmental institutionobscene finger gesturemurdererhouseimpalementdecapitationblood splattersurprise endingviolence β¦sexfemale nuditynumber in titlebloodbare breastssequelfemale frontal nuditykissdancingchasepantiesdigit in titledead bodylow budget filmnumbered sequelsubjective camerasword fightaxemassacrethroat slittingchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonkissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manrampagerednecknew jerseyitalian americanbutcherpsychotronicslaughteraxe murderfifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillymeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreebutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | slasher flickpsycho thriller |
Themes: | psychopathdrunkennessmurderrevengedeathtorturebrutalitydeath of motherevilmurder of a police officer |
Mood: | slashergoredarknesshorror movie remake |
Locations: | forestmotorcycleboatbathtubbicyclewaterwoodspolice carlakecampfiretunnelschool busbackwoodssex in a tent |
Characters: | teenage girlafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
Period: | 1980s |
Story: | remake of cult filmvideotaped sexburnt bodycharacters killed one by onebody countstabbed in the eyedisfigurementpower outagerear entry sexbuttocksmissing personsevered headstabbed to deathimpalementstabbing β¦strangulationflashlightdecapitationremakeblood splatterfiresurprise endingviolencefemale nuditynuditynumber in titlebloodbare breastsfemale frontal nuditymasturbationdogbare chested malesex scenefemale rear nuditynippleschasepistoltelephone calltopless female nuditywoman on topcorpsedigit in titleurinationblondeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingbracandletoplessaxemassacrevideo cameradeath of friendthroat slittingstabbed in the chestcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningtentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiecamppsychocovered in bloodmasked manrampagegrocery storenew jerseybackpackstabbed in the throatconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonebody landing on a caraxe murdersevered legarrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offcountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastssickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
Subgenre: | slasher flicksuspensebody horroramerican horrorsadistic horrorspanish horrorcanadian horror |
Themes: | cannibalismfearmurdersuicidetorturedeception |
Mood: | slashergorerainnightmareblood and gore |
Locations: | new york cityboatvillagejungleamericarain forest |
Characters: | slasher killerfather daughter relationshiptattoolawyervillainterroramerican abroad |
Story: | characters killed one by onebody countstabbed in the eyeeye gougingcollege studentsevered headimpalementdecapitationvomitingblood splattercell phoneviolencefemale nuditymale frontal nuditymale rear nudity β¦bare chested malelesbian kissthree word titlepistolshot to deathshot in the chesturinationwritten by directormarijuanacollegeislandmale pubic haircolor in titlerivershot in the backcookingthroat slittingdream sequenceritualroommatenecklaceshot in the foreheadcharacter repeating someone else's dialogueprotestscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplattermachetemutilationspidercovered in bloodvictimbroken legmasked maneaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endslaughterbroken armsevered legenvironmentalismcapitalismactivisttorso cut in halfsatellitemarijuana jointbad guykillshot in the neckunited nationshomagehuman monsterflutenaivetyamazonslashingveganantbleeding to deathkiller childextreme violencemiddle classperugraphic violencereference to twittertied up while barefootcamera phonebloody violencedeforestationignorancesadistic psychopathenvironmentalistpsychotronic filmbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeast coasteating human fleshfemale genital mutilationman eaterbody partshead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All) |
A teenage girl, trying to enjoy her birthday, soon realizes that this is her final one. That is, if she can figure out who her killer is. She must relive that day, over and over again, dying in a different way each time. Can she solve her own murder?
Subgenre: | slasher flickteen horrorblack comedy |
Themes: | murderdeathsuicideinfidelityjealousyextramarital affairtime travel |
Mood: | slasher |
Locations: | hospitalcar explosioncar on fire |
Characters: | slasher killerserial killerteenage girlhomosexualfather daughter relationshipmother daughter relationshipdoctorfemale protagonistpolice officerkillersecurity guardteacher student relationshipsuicide by hangingteacher student sex β¦police officer taken hostageblonde asianasian girlteacher student affairsex with a studentasian boybaby mask (See All) |
Story: | sorority housedead teenagerdriver's licensered herringsororitycharacters killed one by onemurderercollege studentnews reportstabbed to deathcell phonesurprise endingviolencefemale nudityblood β¦masturbationgunkissfemale rear nudityexplosionpartyknifechasethree word titlecryingshot to deathmaskbirthdaycollegef wordfoot chasethroat slittingdinerstabbed in the chestexploding carpolice officer killedpublic nuditymini skirtbaseball batamerican flagstalkinglove interestarsonbirthday cakecloseted homosexualcrying womanflatulenceteddy bearparking garagefemale killermasked manstealing a carmobile phoneplot twistblack brahit on the headtitle at the endalternate realitycasual sexglobal warmingmasked killerholding handsprequelparking lothit with a baseball batleather jacketserial murderfinal showdownhiding in a closetrepeated scenetwist endingsuit and tiealarmblonde womanmini dresstelevision newsfemale friendshipyoung womanescaped convictfriendship between girlspartial female nuditybaseball capshort skirtfemale villainmercedes benzcollege campusmusic boxmasked villainfart jokevending machinepsychotronic filmtime loopgrindhouse filmyoung adultmurder victimsurprise partyknife held to throatdeja vualternate timelinemystery killerdyed hairmultiple outcomesfemale studentdoctor's officein the closetescaped prisonerrepeated eventdorm roomcupcakeco edhospital gowntime warprun over by a carfalling out a windowhit by a bustime travelercar alarmgay pornhorror iconbare midriffcheating on wifehanged by the necksurprise birthday partybell towermiddle fingerdisco ballcurly hairmarried mandying repeatedlypower cutpointing a gun on someonebirthday cardhighway patrolblowing out candles on a birthday cakesorority girlcollege roommatedeath in titleman murders a womanteacher student romancehooded sweatshirtreference to harry houdinishooting a womanmontage with pop songempty gunlong haired mancake in the facesmashing a car windowblowing out a candlehair curlerschocolate milksmashing a windowstood uptrapped in a time loopbloody knifemobile telephonereference to janis joplinrunning mascaracutting own hairloose womanshort dresskilled on birthdaysetting a car on firehead traumapoisoned to deaththroat slitwhite boardhit on the head with a hammeropening creditspoisoned foodreliving the pastfemale flatulenceknife held to someone's throatbirthday candleboarded up windowpulled over by policekiss on the neckpushed through a windowthe morning afterarizona desertfemale college studenthair curlernight walkreference to ghostbusterscrush on teachereternal recurrenceknife held to one's throatthrown against a wallfat shaminggirl in jeopardyhalter topreference to bill murraywalking alone at nightwatching a gay porn videowatching gay porn (See All) |
Death stalks the dreams of several young adults to claim its revenge on the killing of Freddy Kruger. Chased and chastised by this finger-bladed demon, it is the awakening of old memories and the denials of a past of retribution that spurns this hellish vision of a dreamlike state and turns death in β¦to a nightmare reality. (Read More)
Subgenre: | slasher flick |
Themes: | murderrevengedeathsurrealismrapetorturefuneralparanoia |
Mood: | gorehigh schoolnightmarehorror movie remake |
Locations: | snowhospitalswimming poolcemeterybathtub |
Characters: | father son relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipwaitresskillerterrorself mutilationyounger version of character |
Story: | person on fireburnt bodybody bagburnt facecharacters killed one by onestabbed in the eyeeye gougingdisfigurementstabbed to deathimpalementremakeblood splattercell phonesurprise endingflashback β¦blooddogbare chested malephotographdreamcorpsecar accidentslow motion scenearrestsecretplace name in titlecar crashjailhallucinationswimmingambulancedeath of friendthroat slittingdinerstabbed in the chestdrawingbathnecklacestabbed in the backcover upevil manattempted rapehigh school studentsyringeburned alivekilling an animallooking at oneself in a mirrorlifting someone into the airsecurity camerasevered handcovered in bloodrapistjanitorstabbed in the throatstabbed in the headstabbed in the legpedophilebookstoreblood on shirtperversiondark pastsexual assaultteleportationphoto albumpervertvillain played by lead actormolotov cocktailhiding in a closetpedophiliaohiovigilantismhuman monsterchild molestationclimbing through a windowhanging upside downvideo blogdeath of boyfriendopen endedclawchild molesterswimmerpool of bloodwrongful imprisonmentmolestationchild rapecut handvillain not really dead clicheplant in titledepravitystabbed with scissorsbloody body of a childfalling through the floorserial rapistsexual predatorbad dreamcut armhand cut offfalling asleeprepressed memorygrave side ceremonyhigh school principalhand through chestsex offendersickstreet in titleboiler roomboogeymanpre schooldream worldfictional townlucid dreamadrenalinesickosleep deprivationindoor swimming poolprescription drugswoman in bathburn scarshared dreamfreddy kruegernightmare becomes realitystabbed with glassreboot of serieshand through headchild sexual abuseremake of cult favoritealarm systemswimming coachdream sequence within a dream sequenceclass photographelm streetgardnerspringwood ohiosexual child abusecar cigarette lighterstabbed with a needlefalling asleep in classpaper cutterswimming teamdream imagerykilling of child molestertrying to stay awakeawakened by a phone (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | slasher flickteen horrorcult filmsupernaturalparanormalparanormal phenomenabody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | sadismpsychopathfearmurderrevengedeathfriendshipsurrealismkidnappingghostescapemonstervoyeurismbrutalitysupernatural power β¦paranoiaevilpanicmysterious deathshower murder (See All) |
Mood: | slashergorerainhigh schoolnightmaredarknesspoetic justice |
Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | slasher killerserial killerteenage boyteenage girlfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationship β¦brother sister relationshipteachergirlstudentpolicemanlittle girlkillervillainterrorself mutilationdriverserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | person on fireburnt facebody countdisfigurementobscene finger gesturemurdererhousestabbed to deathimpalementstabbingvoyeurblood splatterfireshowersurprise ending β¦cigarette smokingviolencecharacter name in titlenuditynumber in titlebloodmale nuditysequelmale rear nuditybondagedogbare chested malefightpartyknifechasetelephone callcryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrebasketballfootballstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomcharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratcharacter says i love youthreatened with a knifeclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalitypush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | black comedyconspiracysupernaturalsurvival horror |
Themes: | drunkennessfearmurderrevengedeathsurrealismmarriagemoneybetrayalghostdrinkingescapedeceptionseductionsupernatural power β¦paranoiainsanitysurveillanceunemploymentcourageself sacrificenear death experience (See All) |
Mood: | goreone nighthorror movie remake |
Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
Characters: | husband wife relationshipafrican americandoctornursesecurity guardalcoholic |
Period: | 1990s1930s |
Story: | insane asylumscalpelatticmental institutionskullelectrocutionsevered headhousestabbed to deathimpalementflashlightdecapitationremakeblood splattercell phone β¦firesurprise endingfemale nuditybloodfightphotographtitle spoken by characterpartyknifechasepistolcorpseshot to deathfistfightshot in the chestrescuepunched in the facewatching tvcomputerdrinkbrawlheld at gunpointsunglassesbirthdaydemonhallucinationf wordsubjective camerasurvivaljournalistambushaxestabbed in the chestfalse accusationdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingcharacter's point of view camera shotknocked outskeletonbasementhauntingsuspicionhaunted houseriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerfaked deathpresumed deadcameobraveryguestimpostorstabbed in the neckbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramanbubble bathoffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | slasher flickteen horrorindependent filmcult filmpsycho thrilleramerican horror |
Themes: | psychopathmurderdeathdrugsparanoiainsanityevilabductionalcoholism |
Mood: | slasherhigh schoolnightmare |
Locations: | schoolsmall townelevatorkitchentruck |
Characters: | slasher killerserial killerteenage boyteenage girlfamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipgirlnursepolicemansecurity guardalcoholic β¦villainsecretaryterrormysterious villain (See All) |
Period: | 1990syear 1998 |
Story: | dead teenagerbody bagcharacters killed one by onebody countsevered headstabbed to deathstabbingwineflashlightdecapitationtelephoneviolencenumber in titlebloodsequel β¦knifechasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighborhallucinationsubjective cameragood versus evilhalloweencandlecaliforniaaxeambulancedeath of friendthroat slittingtoiletstabbed in the chestweaponattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityevil manactor shares first name with characterstalkingreunionflowersplattermaniacbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingpsychovictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacslashinggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
When May was a child, she was a lonely girl with a lazy eye and without any friends except a weird and ugly doll kept in a glass case given by her bizarre mother on her birthday. May becomes a lonely, weird young woman, working in an animal hospital and assisting the veterinarian in surgeries and se β¦wing operated animals most of the time. Her lesbian colleague Polly has a sort of attraction for her. When the shy May meets the mechanic Adam Stubbs, she loves his hands and has a crush on him. They date, but the weirdness and bizarre behavior of May pushes Adam away from her. Alone, May has a brief affair with Polly, but she feels rejected again when her colleague meets Ambrosia. When her doll is accidentally broken, the deranged May decides to build a friend for her, using the best parts her acquaintances can offer. (Read More)
Subgenre: | slasher flickindependent filmcult filmblack comedytragedypunkpsychological horrorlgbt horror |
Themes: | affaircrueltypsychopathdrunkennessmurderdeathlovefriendshipjealousydrinkinglonelinessbrutalityobsessiontime travelinsanity β¦mental illnesschildhoodblindnesschildhood trauma (See All) |
Mood: | slashergorestudent film |
Locations: | hospitalrestaurantbathtubelevator |
Characters: | slasher killerteenage boyteenage girlmother daughter relationshipfriendtattooboyteachergirldancerfilmmaker |
Period: | world war two1940s |
Story: | eyeballscalpelcharacters killed one by onebody countstabbed in the eyeblack humordollstabbingsurprise endingcigarette smokingflashbackcharacter name in titlebloodone word title β¦dogkissdancingknifetelephone callcryingcorpsemirrorcatdrinklietearsbirthdaydead bodycafehalloweenbramontagethroat slittingradioparkliarhalloween costumestalkingfilm within a filmgaragesurgeryeyeglassesmass murdermutilationwatching a moviedesperationsevered handmilksevered fingerstabbed in the throatstabbed in the neckbroken glassscissorscigarette lightereye patchsevered legpumpkinvodkacoffee shop12 year oldforename as titleshynesslaundryinsecurityveterinariandead animaleyemasochismlaundromatyoung womananimal abuseamputationobsessive loveauto mechanicsewing machinehanddead catsewingmoleclothesbody partjack o'lanternbitestabbed with scissorshardware storefingerfreezerfrozen bodygutstaxidermyseamstresssocial outcastmohawk haircutsalsacuttingsinkeye injurylegblood samplekilling a catashtraycasedry humoroutdoor cafeblind childchildren's songdrinking milkoptometristreference to betty grablenecksurgical toolsuturecontact lensesschool dropoutschool for the blindfake knifeday care centereye doctorjack knifekneebroken dollgatoradeanimal hospitalsucking on one's thumblazy eye (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is β¦the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
Subgenre: | slasher flickteen horrorpsycho thrilleraustralian horror |
Themes: | murderdeathtorturefuneralbrutalityyouthabusecampingghost town |
Mood: | slashergorehorror movie remake |
Locations: | churchforestsmall townroad tripcampfire |
Characters: | slasher killerserial killerboyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshippriesttough guyinterracial relationshipvillainsheriff |
Story: | person on firecharacters killed one by onebody countsevered headhousestabbed to deathimpalementdecapitationvomitingcell phonefiresurprise endingviolencebloodmale nudity β¦male rear nuditybare chested malefighttitle spoken by characterknifechasethree word titlepantiescryingcorpseshot in the chesturinationface slapshot in the headshotgunundressingbare buttlingeriegood versus evilbravideo cameradeath of friendstabbed in the chestchild abusescantily clad femalebeaten to deathstripteasetentkicked in the facebaseball batinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowlifting someone into the airgroup of friendsloss of friendamerican footballhidingfloridarednecksevered fingercrossbowgash in the facestabbed in the necktitle appears in writingscissorsstabbed in the legred pantiestank topcar troublegroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingsdeformitywrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | slasher flickcult filmamerican horror |
Themes: | psychopathrevengemurderdeathabductionexploitation |
Mood: | slashergoredarkness |
Locations: | lake |
Characters: | slasher killerserial killerteenage boyteenage girlteenagerboyfriend girlfriend relationshipkillervillainterrorserial murdererlow self esteemmysterious killer |
Period: | 1980s |
Story: | disturbed individualsole survivoreyeballcharacters killed one by onestabbed in the eyemurdererimpalementshowersexnuditynumber in titlebloodsequeldigit in titlebikini β¦masknumbered sequelsubjective cameraaxethird partcharacter's point of view camera shotevil mancabinsevered armdismembermentsplattermaniacmass murdermachetelifting someone into the airragebarnroman numeral in titlepsychosevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughtersequel to cult favoritekilling spreemasked killerpsycho killertorso cut in halfserial murderpsychopathic killerbad guycar troublemadmandefecationhuman monstersexual violencehomicidal maniacslashingshot in the eyehillbillyhammockextreme violencefamous scoremasked villainknittingpitchforkdeformitysadistic psychopathpsychotronic filmbiker gangmurder spreemass murderergrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro β¦fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)
Subgenre: | slasher flickteen horrorteen movie |
Themes: | psychopathrevengemurderdeath |
Mood: | slashergoreraincar chase |
Locations: | swimming poolgas stationsinging in a car |
Characters: | serial killerteenagerfriendfemale protagonistsecurity guardprofessormysterious killer |
Story: | dead teenagerred herringscalpelcharacters killed one by onerear entry seximpalementstrangulationdecapitationtelephonevomitingblood splattersurprise endingviolenceflashbackblood β¦gunsex scenesingingpartychasepistolcorpsecomputerfalling from heightcollegejournalistbound and gaggedcandleaxedeath of friendbridgeradioroommateproduct placementlightninghangingsuspicionfirst partgothicheavy rainlifting someone into the airtied to a bedstabbed in the stomachvillainessjournalismparking garagefemale killerjanitorthunderstormrainstormaxe murdercar troubleurban legendscene before opening creditsfemale psychopathradio stationspreadeaglefraternitybody in a trunkcampusdisc jockeycollege campusorchestral music scoregoth girloff screen murdervillain not really dead clichemicrowave ovenpoodledorm roomfall to deathfemale serial killermicrowavepepsitalk radioradio hosthanged boyconvicted felondark and stormy nightchat roomsource musicyelling for helproommate issueslifting a male into the airdead body in a car trunkradio talk showshot with a guncollege roommatecry for helpcall for helploss of best friendcrying for helpbody in a car trunksinging along with radiostuck during sexwest highland white terrierkilled in a carradio call in showfalse scareradio callerthrown through windshieldannoying roommate (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off β¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | psychopathdrunkennessdeathsuicideghostbrutalityinsanityevilexploitationhomelessnessmurder of a police officerdeath of daughter |
Mood: | slashergorerainnightmaredarkness |
Locations: | hospitalhelicopterstrip club |
Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
Story: | body bagcharacters killed one by onebody countmental institutionneck breakingmurdererstabbed to deathimpalementstabbingstrangulationflashlightdecapitationvomitingblood splatterflashback β¦violencefemale nuditynumber in titlebloodsequelfemale frontal nudityinterviewfemale rear nuditysingingpartychasepistolbeatingdreamcorpsecar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookheld at gunpointsecond partcar crashcafehallucinationstripperf wordhalloweenbanddeath of friendthroat slittingstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackevil manhalloween costumescarstalkingglassesprofanitypizzamaniacsurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniagirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murderkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagehanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | independent filmcult filmblack comedypsycho thrillersadistic horror |
Themes: | cannibalismcrueltysadismpsychopathfearmurderrevengedeathfriendshipsuicidekidnappingrapebetrayaltortureescape β¦deceptionseductionangerdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationevilexploitationvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
Mood: | gorenightmareambiguous ending |
Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | serial killerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officernurse β¦hostagetough guyvillainmaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | body countdisfigurementmercilessnessobscene finger gestureneck breakingmurdererelectrocutionnews reporthousestabbed to deathimpalementstrangulationvomitingblood splatterfire β¦showercigarette smokingviolenceflashbackbloodsequelmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nudityphotographtitle spoken by characterexplosionknifechasepantiespistolshootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushaxedeath of frienddrug dealerthroat slittingcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killedcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementthreatened with a knifechickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to β¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | independent filmcult filmsuspensepsycho thrilleramerican horrorpsychological horror |
Themes: | psychopathfearmurderdeathmarriagemoneyfuneraldeceptionvoyeurismdivorcetheftguiltinsanitydatingmental illness β¦unrequited lovemadness (See All) |
Mood: | slasherraindarknessbreaking the fourth wall |
Locations: | churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water |
Characters: | slasher killersister sister relationshipserial killerfamily relationshipsmother son relationshipfriendpolicemanthiefkillervillainpsychiatristsecretarysheriffterrorserial murderer |
Period: | 1960syear 1960 |
Story: | hidden corpsedisturbed individualred herringpeep holeloss of sistercharacters killed one by onedead woman with eyes openbody countskullmurderermissing personstabbed to deathstabbingnewspapervoyeur β¦showersurprise endingviolenceflashbackbased on novelbloodone word titleinterviewbare chested malephotographtelephone callvoice over narrationcorpseunderweararrestundressingsecretbathroomjailhallucinationsubjective cameragood versus evilbracaliforniadisguisewomanwidowtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriescharacter's point of view camera shotmistaken identityscreamlong takefemale removes her clothescountrysidewitnessbasementtrapfirst partthreatened with a knifecross dressingkillingmaniacprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airmutilationblockbusterimpersonationphone boothpsychogrindhousevictimdriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatbutcherblack braswamparizonarainstormextortionnervous breakdowncellarmeetingdead motherphonefemale in showerbloodbathpsychoticpsycho killerfemale stockinged feetimpotenceserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationhomicidal maniacdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderbloody violencefemale victimreclusesadistic psychopathmurder of a nude womanmurder spreesilhouettefade to blackbutcherygrindhouse filmcrime spreeidentity crisiscurtainmysterious strangerworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in brapsycho terrorloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening thememurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | sadismpsychopathmurderdeathghostfuneralmonstersupernatural powerinsanityevil |
Mood: | slashergorenightmare |
Locations: | hospitalbarchurchcemeteryschool boy |
Characters: | slasher killerserial killerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherkillervillainterrorself mutilationalcoholic father β¦serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | dead teenagerburnt facescalpelcharacters killed one by onebody countstabbed in the eyedisfigurementmurdererdollstabbed to deathimpalementstabbingnewspaperdecapitationblood splatter β¦firesurprise endingcigarette smokingviolencefemale nuditynumber in titlesequelbondagebare chested maledreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemonfoot chasedeath of friendsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phoneevil manskeletonisolationbasementcharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogkilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesbody in a trunkone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t β¦he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
Subgenre: | independent filmsadistic horror |
Themes: | sadismpsychopathmurderdeathsuicidekidnappingtorturebrutalityinsanitypolice brutality |
Mood: | slashergorehorror movie remake |
Locations: | barbathtubwheelchairpolice carroad tripgas station |
Characters: | serial killerpolicemother son relationshipboyfriend girlfriend relationshippolice officercrying babyevil sheriff |
Period: | 1970s |
Story: | remake of cult filmsole survivorbody countdisfigurementobscene finger gesturesevered headimpalementtelephoneremakeblood splattersurprise endingviolencebloodknifevoice over narration β¦shot in the headinterrogationpianoaxeno opening creditshit by a carpolice officer killedlocker roomevil manpigbasementchickendirectorial debutsevered armcowdismembermentmoonmaniacchainsawfalling down stairspot smokingnipples visible through clothingheavy rainlifting someone into the airgroup of friendscowboy hatmutilationhomicidefull moonsevered fingerthrown through a windowalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All) |
SPOILER: Jang Kyung-chul (Choi Min-sik) is a dangerous psychopath serial killer. He has committed infernal serial murders in diabolic ways that one cannot even imagine and his victims range from young women to even children. The police have chased him for a long time, but were unable to catch him. O β¦ne day, Joo-yeon, daughter of a retired police chief becomes his prey and is found dead in a horrific state. Her fiance Soo-hyun (Lee Byung-hun), a top secret agent, decides to track down the murderer himself. He promises himself that he will do everything in his power to take bloody vengeance against the killer, even if it means that he must become a monster himself to get this monstrous and inhumane killer. (Read More)
Subgenre: | dark comedy |
Themes: | cannibalismsadismpsychopathfearmurderrevengekidnappingrapebetrayaldrinkingtorturemonstervoyeurismcorruptioninsanity β¦humiliationvengeancedevilmurder investigationdeath of daughterrape and revengethe devil (See All) |
Mood: | gorenight |
Locations: | snowhospitalforestcemeterytaxi |
Characters: | serial killerpolicechildrensoldierkillerlustpolice detectivedaughterserial murderer |
Story: | suffocationmercilessnessmurderersevered headstabbed to deathstabbingstrangulationdecapitationblood splattercell phonecigarette smokingflashbackviolencenudity β¦bloodfemale frontal nuditymasturbationmale rear nuditydogsex scenekissfemale rear nudityfightphotographknifebeatingfistfightpunched in the facesecretcar crashdead bodyfightingsubjective camerabound and gaggedthroat slittingstabbed in the chesthit by a carsmokingbeaten to deathcharacter's point of view camera shotknocked outkicked in the faceattempted rapetragic eventcabinsevered armsecret agentdismembermentpowerscene during opening creditsagentnosebleedcovered in bloodmasked manstabbed in the throathit in the crotchcannibalgash in the facestabbed in the neckstabbed in the headjumping through a windowdeath of sisterone daylens flaresevered legchaindeath of loved onemoral dilemmaengagement ringtorso cut in halftracking devicestolen carserial murderstabbed in the handbag over headforced to stripviolence against womenpolice chiefsexual perversionguitar playingstabbed in the armdouble barreled shotgunpharmacypolice captainhead bashed inbody in a trunkgreenhouseoffscreen killingscene of the crimesouth koreatop secretextreme violencegraphic violencemugshotstabbed in the facebutcher knifehit with a hammerpsychotronic filmcut handmurder of a nude womanscytheguillotinecat and mousepower strugglecamera focus on female buttstabbed with scissorstrail of bloodgenital mutilationsevered earhit with a chairstabbed multiple timestortured to deathbandaged handman punches a womantire ironmurder of a pregnant womanblood on the floorhit on the head with a fire extinguisherice pickhit on the head with a rockenvelope full of moneyhit with a wrenchburned with a cigarettejaw ripped offachilles tendon cutconfession of crimehacked to deathdead body in a freezerhit with a metal pipestabbed with a screwdriverfinger suckingwatching a porno moviebroken wristdriving a car without a doordeath of fianceedumb bellressentimentyoung women (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession β¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
Themes: | sadismpsychopathfearmurderdeathtorturelonelinessbrutalityobsessiondepressiondrug useinsanityunrequited lovephotographychildhood trauma β¦psychological trauma (See All) |
Mood: | slashergoreneo noir |
Locations: | restaurantlos angeles californiasex in public |
Characters: | serial killerhomosexualmother son relationshiptattooprostitutephotographervillainterrormysterious villain |
Period: | 1980s2010s |
Story: | disturbed individualsuffocationdead woman with eyes opennews reportstabbed to deathstrangulationwinevoyeurvomitingremakeblood splattercell phoneflashbackviolence β¦bloodone word titlethreesomefemale rear nudityphotographknifecorpseurinationcomputercameracar crashbathroomneighborhallucinationsubjective camerafoot chasebound and gaggedcocainestabbed in the chestsubwaychild abusehit by a carbreast fondlingvanlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguestabbed in the backevil mankicked in the facetragic eventstalkingthreatened with a knifesevered armdismembermentmaniaclooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetnervous breakdownsevered legmisogynymannequinwoman in bathtubserial murdervillain played by lead actorpsychopathic killerbad guyconfusionstabbed in the handhiding in a closethuman monstersubway stationsexual perversionslashingbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootknife murderfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanmurder spreeonline datingbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All) |