Please wait - finding best movies...
Growing up on the family sheep farm was idyllic for smart, sensitive Harry Olfield, except for some knavish mischief from cocky brother Angus, until their dad has a fatal accident. Fifteen years later, Harry has finished sheep-phobia therapy and his ICT schooling and returns. Angus buys him out, all β¦ ready to present the genetically engineered Oldfield sheep he bred with a ruthless team. When environmentalist Grant steals a discarded embryo, which has sharp teeth, he gets bitten by it, and thus the first to be infected with predatory hunger and a mechanism that turns any mammal into a werewolf version. Running for the farm men, Grant's mate, student Experience, gets teamed up with Harry and his boorish but gentle pastoral youth friend Tucker. They must survive both the bloodthirsty sheep and their creators, who didn't realize this yet but dispose of an antidote. (Read More)
Subgenre: | creature featuredark comedycult film |
Themes: | death of fathermonsterfearjealousymurderdeath |
Mood: | gore |
Locations: | taxi driverfarm |
Characters: | writer directorbrother brother relationshipfather son relationship |
Story: | ear bitten offgenetic mutationsheep slaughterwilhelm screamtelescopic riflefalling into a pitanimal castrationrelaxation exercisemounted animal headcell phone out of rangewire fencedriving off a cliffglobal climate changeall terrain vehiclebumper sticker β¦third eyeherdingmethanetripping and fallingsheepdogcar hornhidepropellerland roverdna testingearentrailsbiohazardleg bracejumping from a carstampederunning for your lifeconvulsionbitten handdeoxyribonucleic acidbitten in the throatlambantidotesevered footbiplanephobiatoxic wasteexperiment gone wrongcuregenetic engineeringbestialityvegananimal rightswhisperinglightermeatintestinesnew zealandactivistmutationtrophyvegetarianstabbed in the neckpresumed deadeaten aliveanimal attacksheepmutantkilling an animalsyringetwenty somethingsevered armdeath of brotherloss of fatherinjectionscreamrabbitpublic nuditytransformationdisguiseaxecandlescientistcolor in titleprayeranimal in titleriflebare buttcamerashot in the headshotguncar accidentblood splattercorpsecell phonesurprise endingexplosionmale rear nuditymale nudityviolenceblood (See All) |
Subgenre: | independent filmmartial artssuspenseconspiracycorporate conspiracy |
Themes: | feardeathmurderrevengesuicidekidnappingbetrayalescapeinvestigationdeceptionangerbrutalityparanoiasurveillancepanic β¦artificial intelligence (See All) |
Mood: | car chase |
Locations: | farmforestwoodskitchenlakelaboratoryresearch station |
Characters: | boyfriend girlfriend relationshipdoctorhostageinterracial relationshippsychiatristchinesesuicide by hangingbabe scientistfemale scientistgeneticist |
Period: | near future |
Story: | deoxyribonucleic acidbitten in the throatexperiment gone wronggenetic engineeringmutationstabbed in the neckpresumed deadmutantinjectionscientistriflecamerashot in the headcar accidentblood splatter β¦corpsecell phonesurprise endingviolencebloodcharacter name in titleone word titleinterviewflashbackbare chested malefighttitle spoken by characterknifechasepistolshowerbeatingfistfightmirrorshot in the chestrescuepunched in the facecomputerbrawlshowdownheld at gunpointhand to hand combatbedinterrogationriversciencekung fushot in the backf wordfoot chasebedroomassassinambushstrangulationdeath of friendimpalementstabbed to deathmixed martial artsdinerstabbed in the chestman with glassesdisarming someonedouble crossdrowningshot in the foreheadlatex glovesattempted murdertreecharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backkaratesuitcasecover upknocked outkicked in the faceshot in the shoulderisolationlaptopneck breakingsuspicionthreatened with a knifedirectorial debutsubtitled scenetrustfalling down stairssabotagerevelationhead buttelectronic music scorehypodermic needlelooking at oneself in a mirrorcatfightjoggingcooksecurity camerabeardkicked in the stomachpsychologistcompassionfemale killerandroidfull moonrampagestealing a carblood on facefight to the deathgash in the faceevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiertied feetcorporationcharacters killed one by onekilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerstabbed in the armclimbing through a windowhired killermercy killingwoman kills a mandeath of boyfriendfilmed killinghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagewoman's neck brokenthroat rippingcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All) |
In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman, β¦will try to stop him and the plague of worms generated by the creature. (Read More)
Subgenre: | creature featurecult filmblack comedyb movie |
Themes: | monstermurderdrunkennesscannibalismmurder of a police officer |
Mood: | gorehigh school |
Locations: | barswimming poolforestsmall townpolice station |
Characters: | husband wife relationshipteenagerzombiealienmayorcountry singer |
Period: | year 2005 |
Story: | meatmutationeaten aliveanimal attackmutantkilling an animaltransformationrifleshot in the headshotgunblood splattercorpseexplosionmale rear nudityviolence β¦bloodsexone word titleflashbackbare chested malephotographpartypistolshot to deathshot in the chestwritten by directorcar crashclassroomdecapitationfoot chasebandimpalementstabbed to deathstabbed in the chestmapsevered headchild in perilhit by a carshot in the foreheadcharacter repeating someone else's dialoguedomestic violenceexploding bodybasementpolicewomancharacter says i love youdirectorial debuttwincowdismembermentgrenadebarnnosebleedmind controlalien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All) |
The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit β¦e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)
Subgenre: | creature featurecult filmindependent filmblack comedysuspensetragedyasian horror |
Themes: | death of fathermonsterfeardeathmurderrevengesuicidekidnappingbetrayaldrunkennessescapefuneraldeceptionmilitaryanger β¦dysfunctional familygriefabductionpanicunemploymenthomelessnessenvironmentself sacrificenear death experience (See All) |
Mood: | goresatirerain |
Locations: | hospitalsnowboatwatertaxielevatorpolice cartrucktunnelsewer |
Characters: | brother brother relationshipfather son relationshipfamily relationshipspolicefather daughter relationshipteenagerdoctorchildrenbrother sister relationshipteenage girlsoldierpolice officernursephotographerhostage β¦little girllittle boydaughteramericanamerican abroadsingle fatherfishermangrandfather granddaughter relationshiphomeless man (See All) |
Period: | 2000syear 2000year 2006 |
Story: | mounted animal headbiohazardtoxic wastemutationeaten aliveanimal attackmutantsyringedeath of brotherinjectiondisguisescientistriflecamerashotgun β¦blood splattercell phonesurprise endingexplosionviolencebloodone word titletwo word titlephotographtitle spoken by characterchasepistolfirecryingurinationrescueslow motion scenewatching tvshowdownheld at gunpointbeertearsislandriversurvivalfoot chaseorphanflashlightgangambushambulancebridgearmyimpalementmapfishfishingchild in perildouble crosscreaturesearchvannews reportlatex glovesflash forwarddangerprologueprotestpoisonrace against timecover updeath of childtragic eventgovernmentsleepingsacrificesingle parenteavesdroppingsabotagebow and arrowathleteburned alivehypodermic needleheavy rainvirusdemonstrationmorguenosebleedgiantdesperationjumping from heightskullparking garagecrushed to deathgas maskrampagepump action shotgunremote controlbraverymourningpower outagehungerevacuationheadphonesescape attemptdead childinfectionpollutiongasolineburned to deathsirenmedia coverageparking lottext messagingfinal showdownmolotov cocktailkoreagiant monstersuit and tiedead childrenshot with an arrowarcherymedalchangeshot in the eyewetting pantsmegaphoneteenage daughtertentaclesouth koreashot through the mouthquarantinearcherhomeless personrecreational vehiclecoughing bloodcheckpointpsychotronic filmimprovised weaponanimal killingmortuarygiant animalgrindhouse filmstarvinglootingdustflaming arrowrescue attemptkaijujumping off a bridgesquidhazmat suitflash driveboneshuman skulltarget shootingmealblood samplevomiting bloodchild in dangersocial criticismreference to robin hoodlong tongueseoulbeer cancollege graduatetoxicurinating in fearman eating monsterchild eatenboy eatenpaddle boathypodermicbio hazardkiller fishman versus naturedemonstratorformaldehydelazyworld health organizationjumping from a bridgeeaten by animalman versus monstersnack barbullseyecell phone tracedropkickirresponsible fatherriot squadchild killed by an animalbronze medalworld cinema (See All) |
After an experimental bio-nerve gas is accidentally released at a remote U.S. military base in Texas, those exposed to the gas turn into flesh-eating, mutating zombies out to kill. An assortment of various people who include stripper Cherry, her shady mechanic ex-boyfriend Wray, a strong-willed doct β¦or, the local sheriff, and an assortment of various people must join forces to survive the night as the so-called "sickos" threaten to take over the whole town and the world. (Read More)
Subgenre: | creature featurecult filmblack comedyb moviesurvival horrorzombie apocalypsezombie survival |
Themes: | fearmurderdeathfriendshipinfidelityadulterypregnancymilitaryextramarital affairpsychopathparanoiacancerunfaithfulnesscannibalismmurder of a police officer |
Mood: | goreone night |
Locations: | hospitalbeachcarhelicoptermotorcycleelevatormexicogas stationtexastwo on a motorcycle |
Characters: | brother brother relationshipfather son relationshiphusband wife relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctortattoofemale protagonistzombiesoldierpolice officertough guyaction herosheriff β¦ex boyfriend ex girlfriend relationshipstand up comedianlesbian relationshipgo go dancerevil doctor (See All) |
Period: | 2000s |
Story: | biohazardtoxic wastemeatmutationstabbed in the neckeaten alivetransformationaxescientistshot in the headshotguncar accidentblood splattercorpsecell phone β¦explosionviolencebloodsexfemale nuditydogtwo word titlebare chested malepistolfirecryingshootouthigh heelsshot to deathtesticlesmachine gunmirrorshot in the chestarrestsecretfalling from heightheld at gunpointtearsdead bodyhandcuffsstrippershot in the backdecapitationsurvivalflashlightthroat slittingstabbed to deathdinerstabbed in the chestexploding carsevered headman with glassesanti herochild in perilhit by a cartongueshot in the legshot in the foreheadstabbed in the backperson on firedeath of childtough girlringattempted rapeglassespremarital sextwindismembermentcheating wifehypodermic needlebabysittermad scientistmorguehammerspiderend of the worldrapistaction heroinebreakfastgas maskcameosevered fingercouchunfaithful wifeshot in the faceshovelscene after end creditsexploding headthrown through a windowassault rifleinfectionturtlestabbed in the eyebarbecuefemale doctorcastrationsevered legdeath of loved oneabusive husbandgrenade launchersurprise after end creditssouthern accentleather jacketenglishman abroadbisexual womanblood on camera lensneedleshot in the neckhomagekilling a doghead blown offexotic dancersubtitlesamputeeold flameknocking on a doorsicknessaccidental shootingjackethit by a truckexploding truckscorpionmilitary baseone linersawgarbagedirector also cinematographerflesh eating zombiewalking deadcut into pieceszombie violencedeformitypole dancertext messageshot in the crotchpole dancingexploitation filmmad doctorwhite coatbloody body of a childtrail of bloodchild with a guncontaminationdoomsdayhot pantsprosthetic limbreference to osama bin ladenmusic score composed by directoranthropophagusover the topdeus ex machinacheating on husbandwaterbedmilitary veteranchild uses a gunchild shot in the headwooden legkilled by a propellerchemical weaponskicking someonechemical weapondeadly diseaseripped in halfaccidental suicidehair curlersrunning mascarabroken wristintentional goofmelting mananesthesiologistspanish languagetwin girlsdeath of an animalpainting nailspusgrabbed by the hair (See All) |
A medical student and his girlfriend become involved in a bizarre experiment into reanimating the dead conducted by the student's incorrigible housemate in this campy sendup of an H.P. Lovecraft story. The emphasis is on humour but once the dead walk, there is gore aplenty.
Subgenre: | cult filmindependent filmblack comedy |
Themes: | feardeathinsanitypanicmadness |
Mood: | goredarkness |
Locations: | hospitalelevatorlaboratory |
Characters: | doctorzombienursestudent |
Story: | convulsionbitten handexperiment gone wrongintestinessyringesevered arminjectionaxescientistblood splattercorpsemale rear nuditymale nudityviolenceblood β¦sexfemale nudityfemale frontal nuditymale frontal nudityfemale rear nudityfemale full frontal nuditynipplespantiespunctuation in titleface slapcatdead bodysciencedecapitationstrangulationimpalementfemale pubic hairwhite pantiessevered headman with glassesanti herobreast fondlinglatex glovesdangerscreamingglassesthreatbasementfirst partsplattergirl in pantiesexperimenthyphen in titledestructionhypodermic needledrugmad scientistmorgueblack humordead womanguardsevered fingerbased on storydead manh.p. lovecraftfemale doctorsexual assaultsurgeondeath of loved onebraindead girldead fatheroverdosespreadeaglestrait jacketcrushed headdisembodied headmassachusettsmacabrehit with a shoveldead catbagblack cathuman experimentmedical doctormolestationscience runs amokmad doctorsinistersurgical operationclothes rippingmedical experimentreanimationheadliterary adaptationevil scientisttalking headserummedical schooldecapitated bodydefibrillationdefibrillatorevil deadmedical researchzurich switzerlandneurosurgeonprofessional rivalryreanimated corpsebone sawcardiopulmonary resuscitationman undressing a womanexploding eyesurgical instrumentsglowshovel through throat (See All) |
A zombie is found aboard a boat off the New York coast which belongs to do a famous scientist. Peter West, a journalist, travels to the Antilles with Ann, the daughter of the scientist. On the way, they meet with with Brian, a ethnologist, and Susan. When they arrive at Matul Island, they find Dr. M β¦enard, and discover a terrifying disease which is turning the islanders into horrifying zombies which devour human flesh and seem indestructible.... (Read More)
Subgenre: | creature featurecult filmindependent filmsuspensesurvival horrorbody horrorzombie apocalypsezombie survivalitalian horrorsadistic horrorzombie outbreak |
Themes: | death of fatherfeardeathmurderbrutalitysupernatural powersadismcrueltydeath of wifeapocalypsecannibalismtraumamurder of a police officer |
Mood: | goredarknessblood and gorezombie film |
Locations: | new york citycemeteryboat |
Characters: | husband wife relationshipdoctorzombienurse |
Period: | 1970syear 1979 |
Story: | bitten in the throatsevered footintestineseaten alivesevered armscreamscientistbare buttcamerashot in the headshotgunblood splattercorpsesurprise endingexplosion β¦violencebloodfemale nuditynumber in titlebare breastsfemale frontal nuditygunfemale rear nudityfightfemale full frontal nuditynippleschasepistolshowerfireshootoutdigit in titleshot to deathmirrorshot in the chestface slapslow motion scenegunfightthongheld at gunpointdead bodyislandsciencemanhattan new york citycombatshot in the backnew yorkmassacrestabbingdeath of friendthroat slittingstabbed in the chestfemale pubic hairsevered headpolice officer killedshot in the foreheadpaincursebeaten to deathscreamingperson on fireundeadspearvirusmutilationgrindhousesharknaked womanend of the worldback from the deadinvasionobesitycannibalmercilessnessgash in the facegunshot woundshot in the facedeath threatstabbed in the headhit on the headexploding headdisembowelmentautopsyblood on shirteye gougingslaughterstabbed in the eyedark pastvoodoodeath of loved oneworld trade center manhattan new york cityliving deadmolotov cocktailhead woundhead blown offblood stainbullet ballethead bashed inscene of the crimestatue of liberty new york citybitten in the neckcrushed headscuba divingcarnagebody bagextreme violenceflesh eating zombiegraphic violencemaggotcut into piecesbloody violencezombie violencepool of bloodpsychotronic filmbreaking through a doorgrindhouse filmshark attacknewspaper reporteroutbreakzombie attackexploitation filmhead ripped offmad doctortropical islandbiteexit woundbitingdoomsdaypolice officer knocked unconsciousbitten on the armflesh eatingitalian cinemadrive in classiceye injuryinfamygory violenceoxygen tankeast coastvideo nastyzombificationstab woundsequel by name onlyeating human fleshbitten in the facehell on earthflesh eating zombiesmutilated bodyresident evilzombie bitedeadly diseasenotorietybitten by a zombienude reflected in mirrorwrapped in a bedsheeteye woundzombie invasioneye skeweringhuman eaten by zombiesleg bitingswim capdiving mask (See All) |
This is the story of an isolated Alaskan town that is plunged into darkness for a month each year when the sun sinks below the horizon. As the last rays of light fade, the town is attacked by a bloodthirsty gang of vampires bent on an uninterrupted orgy of destruction. Only the small town's husband- β¦and-wife Sheriff team stand between the survivors and certain destruction. (Read More)
Subgenre: | cult filmsuspense |
Themes: | fearmurderdeathsuicidemarriagebrutalitysupernatural powerdeath of wifewritingself sacrificemurder of a police officerwilderness |
Mood: | gorenightdarkness |
Locations: | carsnowsmall townairportshiptrucktownalaskaout of town |
Characters: | brother brother relationshipvampiresheriffterrorgrandmother grandson relationshippolice arrestdeath of heroblood lust |
Period: | 2000swinter |
Story: | wilhelm screambitten handstabbed in the neckkilling an animalsevered armloss of fatherinjectionscreamaxerifleshot in the headshotguncar accidentblood splattercorpse β¦explosionviolencebloodnumber in titledogknifepistolfiredigit in titleshot to deathshot in the chestcomputerfalling from heightbookbased on comiccar crashmarijuanajailhandcuffsorgyshot in the backdecapitationflashlightbased on comic bookgangthroat slittingimpalementdinerstabbed in the chestsevered headno opening creditschild in perilhit by a carcreaturegunshotperson on firereadingkicked in the facedeath of childautomobileisolationneck breakingpolicewomanshot in the armdismembermentundeadarsonpowercouplerecord playerdestructionrevelationhead butthypodermic needlecomic bookmutilationvandalismwalkie talkiebeardhidingwatching a movieexploding buildingloss of wifedesperationsevered handstrangerbroken legseriesteamoildeath of protagonistexploding headsundynamiteatticmurder of a childalzheimer's diseasemarital separationaxe murderlightsirenseparationtorso cut in halfdead dogvodkabeheadingbarking dogsunsetwifeharborset uptractordead animalkilling a doghead blown offstrandedsubtitlesblonde womanmini dressblackoutcomicasthmalanguagebearded manburnt facehunthit by a truckbased on graphic novelmercy killingblizzardbitten in the neckbloody body of childsunrisecrushed headpotburnt bodycomicsfemale police officerdeath of grandmothersuperhuman strengthcut into piecescoldloss of familylunaticsnowmobiletoothlong haired malebear trapthroat rippingphonograph recordremotechevroletset on firewheelbarrowlocationgeneratorgraphic novelnumberburned bodyburning carfrozenbaitestranged couplelittle brotherover the topskull crushingestranged wifemarriage crisisbroken ankledark horse comicslocked upclosing credits sequencevampire versus vampiretundrahead on a stakehusky dogmini serieshand through headsled dogchild vampirevampires29 year olddog killedpopulationremote locationgraphicoil pipelineshort dresstraffic violationthroat slitreference to bela lugosihuman versus vampirehusband and wifeopening creditsanimal killedharbinger of deathhuskyidw publishingwife killedbad teethanimal violenceidw comicsdeath by sunrisedrilling for oilman's best frienddeath of animalgmc truckmusic video directorbarrow (See All) |
A virus has escaped in a secret facility called "The Hive," turning the staff into hungry zombies and releasing the mutated Lab "Animals" that they were studying. The complex computer shuts down the base to prevent infection. The parent corporation sends in an elite military unit, where they meet Al β¦ice, who is suffering from amnesia due to exposure to nerve gas. The military team must shut down the computer and get out, fighting their way past zombies, mutants, and the computer itself, before the virus escapes and infects the rest of the world. Alice must also come to terms with her slowly-returning memories. (Read More)
Subgenre: | independent filmmartial artssurvival horrorzombie apocalypseamerican horrorzombie survivalbritish horrorzombie outbreakfrench horror |
Themes: | monstermurderdeathbetrayalmilitarytheftcannibalismamnesiaartificial intelligence |
Mood: | gorenightdarknessone night |
Locations: | hospitaltraincitylaboratorytunnelsewer |
Characters: | brother sister relationshipfemale protagonistzombiesoldierterrorkiller dog |
Period: | 2000snear future |
Story: | bitten handbitten in the throatantidotecuremutationeaten alivemutantkilling an animalsyringeinjectionrabbitaxescientistshot in the headblood splatter β¦corpseexplosionviolencebloodfemale nudityfemale frontal nudityflashbackdogtwo word titlegunchasepistolshowershot to deathmachine gunmirrorshot in the chestcomputersex in bedshootingvomitingheld at gunpointhand to hand combatdead bodybathroomshot in the backdecapitationmansionimpalementsevered headpart of seriescreatureshot in the legdrowningshot in the foreheadlatex glovesgunshotstabbed in the backperson on firestatuekicked in the faceneck breakingfirst partgardenkissing while having sexundeadexperimentdisasterundergroundbulletmass murderlooking at oneself in a mirrorred dressviruslaserend of the worldaction heroinetowelback from the deadreverse footagetrappedwindbootssevered fingerresearchbased on video gamehungerspecial forcesjumping through a windowdeath of sisteraerial shotcommandospyinghologramcorporationaxe murderburned to deathtorso cut in halfdead dogimpersonating a police officerbarking dogliving deadgun in mouthfemale fighterlegssuitbroken windowclimbing through a windowmessageunconsciousnesssuicidalfemale herocrashing through a windowdripping bloodfinger cut offbreaking a windowgassole black character dies clichequarantineflesh eating zombietwo way mirrorwalking deadanimal experimentationpasswordsubterraneanwaking upcut into pieceszombie violenceone woman armyfemale gunfighterevil corporationoutbreakzombie attackcaged animalmegacorporationcorporate crimedoomsdaycut armwoman shot in the foreheaddark heroinebitten on the armtrapped in an elevatorflesh eatingleafkilled in an elevatordobermananthropophaguswoman with a gunwhite rabbithand guneating human fleshlong tongueslide locked backfake marriagebusiness suittongue cut outresident evildeadly diseaseloading a gunthrown from a trainlaser cutterbio weaponbitten by a zombieelevator crashoff screen deathspilled coffeeposing as husband and wifebio organic weaponfuturistic traintwitchingbio hazardspilling coffeedoberman pinschergunshot off cameraposing as married coupleholographic projectiondog cagesmashing through a windowentering through windowfogged mirrorvirus outbreakanti virushuman versus undeadhuman versus zombieprotective suitraccoon citycoffee spillhuman statue (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial artsconspiracydystopiafish out of watercyberpunkdark fantasy |
Themes: | monsterdeathmurderrevengekidnappingescapeinvestigationsupernatural powersurveillancehome invasionpolice brutality |
Mood: | goredarknesspoetic justice |
Locations: | helicopterelevatorpolice stationrooftopsewer |
Characters: | father son relationshippolicemother daughter relationshipdoctorfemale protagonistdetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughterself mutilation |
Period: | future2010s |
Story: | antidotecuregenetic engineeringmutationanimal attackkilling an animalsevered arminjectiontransformationaxescientistshot in the headshotguncar accidentblood splatter β¦corpsesurprise endingexplosionbloodviolencesequeltwo word titlebare chested malephotographknifechasepistolfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescuepunched in the facebattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashhandcuffsrevolvercombatkung fushot in the backsubjective cameradecapitationgood versus evilsurvivalflashlightstrangulationmassacrethroat slittingimpalementstabbed to deathcolon in titlemixed martial artsstabbed in the chestsevered headno opening creditsanti herochild in perilhit by a carfictional warunderwater scenecreaturesearchnews reportshot in the legshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderexploding bodyneck breakingmercenaryshot in the armhenchmanexperimentwerewolfhand grenadehypodermic needlegothicsecurity camerakicked in the stomachfourth partgiantjumping from heightparking garageaction heroinegun fucrushed to deathsocial commentaryback from the deadfemale warriorstealing a carexplosivestabbed in the throatwhippartner3 dimensionalresurrectionshot in the facestabbed in the headstabbed in the leg3dpunched in the chestjumping through a windowthrown through a windowbody landing on a carknife throwingstabbed in the eyeflamethrowertelepathytorso cut in halfdesert eaglesuper strengthstabbed in the armshot in the eyescalpeldamman kills a womanscene of the crimebitten in the neckepiloguestabbed in the shouldershot in the throatopen endedstabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingwoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Subgenre: | creature featurecult filmindependent filmsuspensetragedyallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak |
Themes: | feardeathmurderrevengemarriageescapemilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality β¦near death experienceradiation (See All) |
Mood: | gorenightdarknessone night |
Locations: | farmforestcarhelicoptercemeterywoodsrural settingkitchentruckpennsylvania |
Characters: | husband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorbrother sister relationshipzombieprofessorsheriffterrorpolice dog |
Period: | 1960syear 1968year 1967 |
Story: | entrailsintestinesmutationeaten alivemutantsevered armdeath of brothertransformationaxescientistriflebare buttshot in the headshotguncar accident β¦blood splattercorpsesurprise endingexplosionviolencebloodfemale nuditybare breastsfemale frontal nuditydoggunfemale rear nudityfightcigarette smokingknifechasepistolfiretopless female nudityhigh heelsbeatingshot to deathfistfightfoodshot in the chestface slaprescuepunched in the facewatching tvbrawlheld at gunpointrunninglow budget filmrevolvertelevisionshot in the backsurvivalfoot chasemassacrestabbingwomanbridgearmystabbed to deathstabbed in the chesthouseexploding carman with glassescultradiocontroversycreaturegraveyardpantyhosenews reportshot in the foreheadlimousinegravetreebeaten to deathdangerscreamingperson on fireattackfirst of seriesactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderamerican flagtragic eventexploding bodyisolationbasementdie hard scenariofirst partdirectorial debutgeneralhandgunvigilantecult directorundeadwashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicdiseasevirusbarnloss of loved onehammerimpersonationsevered handgrindhouseskulltorchend of the worldwhite housesocial commentaryback from the deadcamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectionbroken glassinsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinecellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterliving deadmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillypatricidequarreloffscreen killingfriends who live togetherhandshocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manpsychotronic filmimprovised weaponfade to blackfamous lineghoulgrindhouse filmheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarhorror movie remadezombificationhunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All) |
Seth Brundle ('Jeff Goldblum' (qv)), a brilliant but eccentric scientist attempts to woo investigative journalist Veronica Quaife ('Geena Davis' (qv)) by offering her a scoop on his latest research in the field of matter transportation, which against all the expectations of the scientific establishm β¦ent have proved successful. Up to a point. Brundle thinks he has ironed out the last problem when he successfully transports a living creature, but when he attempts to teleport himself a fly enters one of the transmission booths, and Brundle finds he is a changed man. This Science-Gone-Mad film is the source of the quotable quote "Be afraid. Be very afraid." (Read More)
Subgenre: | creature featurecult filmtragedycyberpunkallegorybody horror |
Themes: | monsterjealousysuicidepregnancyparanoiaabortionfalling in love |
Mood: | gorenightmare |
Locations: | hospitallaboratory |
Characters: | love triangledeath wish |
Period: | 1980s |
Story: | earexperiment gone wronggenetic engineeringintestinesmutationmutantscientistanimal in titleshotgunmale rear nuditymale nudityviolenceinterviewbare chested malesex scene β¦dreamremakeslow motion scenecomputersciencereporterlatex glovesstalkingfirst partcult directorexperimentlifting someone into the airmad scientistmagazinemale underwearscissorsexploding headbriefsteleportationmedical masksurgical masksuper strengthex boyfriendeditordental maskmetamorphosisteethwoman wearing only a man's shirtorchestral music scoresuperhuman strengthtragic loveanimal experimentationarm wrestlingex loverpsychotronic filmfamous lineassisted suicidescience runs amokweepingarm ripped offphysicistmoral ambiguitylifting a female into the airlifting an adult into the airsteakpleadingremake of cult filmbaboondefenestrationdoomed romancestrange behaviorgrand guignoljaw ripped offmedicine cabinettrailer narrated by hal douglasstockingfingernailmonster as victimloft apartmentblurred boundariescountdown timergenetic alterationwall climbingwoman takes off stockingremoving a fingernailvoice recognition (See All) |
A US research station, Antarctica, early-winter 1982. The base is suddenly buzzed by a helicopter from the nearby Norwegian research station. They are trying to kill a dog that has escaped from their base. After the destruction of the Norwegian chopper the members of the US team fly to the Norwegian β¦ base, only to discover them all dead or missing. They do find the remains of a strange creature the Norwegians burned. The Americans take it to their base and deduce that it is an alien life form. After a while it is apparent that the alien can take over and assimilate into other life forms, including humans, and can spread like a virus. This means that anyone at the base could be inhabited by The Thing, and tensions escalate. (Read More)
Subgenre: | creature featurecult filmsuspensebody horror |
Themes: | monsterfeardeathmurdersuicidedrinkingparanoiadrug usepanicapocalypse |
Mood: | goreambiguous endinghorror movie remakebittersweet ending |
Locations: | helicoptersnowouter spacetunnelearthshedresearch station |
Characters: | african americandoctoralienamericanbiologist |
Period: | 1980swinter |
Story: | lighterintestinesmutationkilling an animalsevered arminjectiontransformationdisguiseaxescientistrifleshotguncorpsesurprise endingexplosion β¦violenceblooddogtwo word titlecigarette smokingphotographtitle spoken by characterknifechasepistolfirebeatingshot to deathremakepunched in the facewatching tvcomputerheld at gunpointsunglassesmarijuanarevolversurvivalflashlightdeath of friendthroat slittingtied to a chairmapfalse accusationsevered headanti heroradiocontroversyshot in the legshot in the foreheadpilotdangerperson on firebased on short storylong takeexploding bodyisolationsuspiciontied upcult directortrustheart attackicesabotagegrenadedestructionburned aliveelectronic music scorehypodermic needlegothictape recordercowboy hatcookbeardspacecraftvideotapesevered handrampagereverse footagepool tabledynamiteinfectionautopsytitle at the enddisfigurementrefrigeratorlanternlens flareaxe murdercharacters killed one by oneflamethrowerburned to deathexploding helicopterweatherdead dogall male castfire extinguishermolotov cocktailtractorplaying poolphysicianalarmbearded manflaretape recordingshot in the eyescalpelmercy killingmetamorphosisblizzardtentacleunsubtitled foreign languagenoosefamous scorequarantineopen endedparasiteroller skatesshape shifterstarsclawshapeshiftingdistrustmorphinearm cut offflying saucerbreaking through a doordragging a bodyping pongsilhouetteanimal killingkicking in a dooralien creatureantarcticasmoking potvcrvideo cassettered herringscientific researchtrail of bloodpower failurefire alarmremotefrozen bodytable tennishand through chestgeneratorgeologistdefibrillationdog sledimitationblood testfinger cutexcavationnorwegianblood samplecoors beerpart stop motionassimilationlong tongueancient astronautsplit headshape shiftingcampsiteshape shifting aliendreadalien life formlovecraftianalien parasitestitchhusky dogbreaking through a wallcardiopulmonary resuscitationhuman duplicationkerosenesled dogtentaclesblood and gutskennelpower generatorsurgical stitchesorganismscientific expeditioncomputer chessboarded up windowj&b scotchstuck in the middle of nowherepolar research station (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | cult filmindependent filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | feardeathmurderfriendshiprevengedrinkingdrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion β¦exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | farmhospitalforestbathtubbicyclewaterwoodslaketruckcavegas stationcampfirebackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | bitten handsevered footstabbed in the neckeaten aliveanimal attacksevered armaxeriflebare buttshot in the headshotguncar accidentblood splattercorpsecell phone β¦surprise endingviolencebloodfemale nudityfemale frontal nudityflashbackmasturbationdogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiespistolshowerfirewoman on topbeatingshot to deathhorseshot in the chesturinationblondeslow motion scenepunched in the facewritten by directorbikinibrawlvomitingheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushmassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchpeeping tomsexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | creature featuredark comedycult filmindependent filmslasher flicksadistic horror |
Themes: | death of fathermonsterfearjealousymurderdeathsurrealismkidnappingrapetorturefuneralseductiontheftinsanitymental illness β¦sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | gorerainnightmareslasher |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | father son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | mounted animal headintestinesaxerifleshot in the headshotguncar accidentblood splattercorpsesurprise endingviolencebloodnumber in titleflashbackbare chested male β¦dancingphotographknifechasepistolfirebeatingdreamdigit in titleshot to deathslow motion scenewatching tvthongmaskheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedstabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji β¦mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
Subgenre: | creature featurecult filmindependent filmblack comedysuspenseabsurdismteen movieteen horrormonster movielgbt horror |
Themes: | monsterfearjealousydeathmurderrevengesurrealismdrunkennessescapeseductionsupernatural powerparanoiawrestlingrivalryhome invasion |
Mood: | satirehigh schoolnightmare |
Locations: | barlos angeles californianightclubelevatorpolice carofficemuseumfire truck |
Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature |
Period: | 2000s |
Story: | eaten aliveanimal attackpublic nuditytransformationbare buttshot in the headshotguncar accidentcorpsecell phonesurprise endingmale rear nuditymale nudityviolenceblood β¦nudityone word titledogbare chested malekissfemale rear nudityfightphotographtitle spoken by characterpartyknifechasepistolbeatingshot to deathfistfightshot in the chestrescueslow motion scenepunched in the faceswordbrawlfalling from heightshowdowncar crashdead bodybathroomdecapitationfoot chasegay slurorphanambushcaliforniamassacreambulancestabbed to deathdinerstabbed in the chestinternetsevered headhit by a carcreaturenews reportshot in the foreheadlimousinecursecoming outelectrocutionattackproduct placementknocked outkicked in the faceshot in the shoulderscargymhigh school studentcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzawerewolfactor playing himselfwolflooking at oneself in a mirrorscene during opening creditscatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivalfull moonrampagecameoblood on facestabbed in the throatpower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowbody landing on a carcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hosthuman becoming an animalcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalahowlingwoman hits a mangay jokesilvertroubled productiongay athletepublicistlycanthropypalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationlycanthropeburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All) |
A businessman sinks $200 million into a special project to help fight Alzheimer's disease. As part of this project, medical biologist Susan McAlester rather naughtily figures out a way to genetically enlarge shark brains, so that disease-battling enzymes can be harvested. However, the shark subjects β¦ become super smart and decide they don't much like being cooped up in pens and being stabbed with hypodermics, so they figure a way to break out and make for the open sea... (Read More)
Subgenre: | creature feature |
Themes: | monsterdeathdrinkingdeceptioncannibalismself sacrifice |
Mood: | gore |
Locations: | helicopterelevatorstormlaboratoryu boatresearch station |
Characters: | babe scientistfemale scientistbiologist |
Period: | 1990s |
Story: | experiment gone wronggenetic engineeringmutationeaten alivekilling an animalsyringesevered armscientistshotguncorpseexplosionbloodviolencebare chested malekiss β¦cigarette smokingtitle spoken by characterthree word titlefireurinationkissingfalling from heightswimmingsurvivalwomanno opening creditsbirthday partyunderwater sceneshot in the legsmokingelectrocutionhairy chestexploding bodyunderwatersacrificeexperimentfalling down stairsmutilationcookcrucifixsharkdivingbra and pantiesreverse footageplayboy magazineresearchevacuationblood on shirtalzheimer's diseaseparrotexploding helicopterreference to elvis presleyflarescuba divingaltered version of studio logogurneymicroscopewoman in a bikinianimal experimentationwoman undressingelevator shaftgiant animalscience runs amokshark attackovenwoman in bikiniarm ripped offseaplaneoxygen maskharpoonkiller sharksurprise birthday partytranquilizersudden deathdead body in waterlicense plateresearch facilitywoman removes her clothesfalling off a ladderripped in halfwinchwoman wearing bra and pantiesgenetic experimentationsubmersibleshark featuregenetically modified organismmedical emergencywoman wearing a bikinihuman versus sharkman in a swimsuitman urinatingequipment malfunctionfalling from a helicopterpush up braman shoutingweather mapcomputer monitorwoman killed by a sharkzip drivedeath by animalelectrical cordscuba gearvicious animaleaten by sharkman wearing a swimsuitsubmarine base (See All) |
Set in the year 2010, Dr. Moreau has successfully combined human and animal DNA to make a crossbreed animal. Well, as usual, something goes wrong and David Thewlis must try to stop it before it is too late. Originally rated R, but cut by Frankenheimer to allow "a wider audience".
Subgenre: | cult filmindependent film |
Themes: | monsterdeathsurrealismbetrayaltortureblindness |
Locations: | junglelaboratory |
Characters: | self mutilationhuman animal relationship |
Story: | experiment gone wrongmutationeaten alivemutanttransformationscientistrifleshot in the headshotgunblood splattercorpsesurprise endingexplosioncharacter name in titlebased on novel β¦knifechasepistolvoice over narrationbased on bookshootoutshot to deathmachine gunshot in the chestheld at gunpointbombislandstrangulationcreatureshot in the legshot in the foreheadneck breakingshot in the armperiod in titleexperimentslaverymad scientistexploding buildingimpersonationrebellionanthropomorphismanthropomorphic animalfat mandisembowelmentdeceitgasolineimprisonmentgothvillain played by lead actorgiving birthstrandedfreakanimal crueltymetamorphosisbitten in the neckburnt bodymicroscopegeneticsanimal experimentationdeath of title characterexploding shipdeformityhomosexual subtextflare gunscience runs amokanimal that acts humancontrolhuman becoming an animaltroubled productiongene manipulationgod complexcat womanimpressionman beastchimerairish wolfhoundmutant animalsecret islandhybrid animalanimal becomes humananimal metamorphosisgenetic sciencehomunculusunnatural experimentwanting to be human (See All) |
The Draytons - David, Steff and their son Billy - live in a small Maine town. One night a ferocious storm hits the area, damaging their house. The storm is accompanied by a strange mist. David and Billy and their neighbour Brent Norton go into town. There they discover that the mist contains some fr β¦ightening creatures, creatures intent on killing humans. (Read More)
Subgenre: | creature featurecult filmsuspensetragedysurvival horrormonster movie |
Themes: | monsterfeardeathmurdersuicidemarriagemilitarynatureangersupernatural powerparanoiainsanitypanicapocalypse |
Mood: | gore |
Locations: | helicoptersmall townrural settinglake |
Characters: | father son relationshipteachersoldierlawyerartistbiblesuicide by hangingreligious fanaticmilitary policehuman versus monster |
Period: | 2000s |
Story: | wilhelm screamexperiment gone wrongwhisperingeaten aliveaxescientistprayershot in the headblood splattersurprise endingbloodbased on novelsex scenefighttitle spoken by character β¦knifefirefistfightshot in the chestface slappaintingneighborrevolversurvivalflashlightstabbingwomanarmystabbed in the chestfalse accusationchild in perilcreatureshot in the foreheadtreedangerperson on firebased on short storylightningtankhangingmanagerdie hard scenariohandgunchainsawexperimentropesupermarketdestructionmedicinespearmutilationloss of loved oneloss of wifedesperationmobtorchpreacherearthquakemechanictrappedu.s. armythunderstormdeath of protagonistfogmurder of a childhighwaysiegedead boyflamethrowersirenholding handshysteriafire extinguishergun in mouthbandagehuman sacrificeacidrestroomburnt facedenialpharmacymercy killingtentacleman kills a womanbloody body of childhanged manshockparasitestresstragic endingmainegrudgeburn victimalternate dimensionarmy baseassisted suicidehummergiant spidercowardicemovie posterchild killeddrugstorepower failuremistrunning out of gasbritish actor playing american charactergiant insectclothes linemercedescashierresentmentwoman shot in the foreheadfilicidestabbed in the bellybased on novellabiblical quotescience experimentbased on the works of stephen kingsingle locationpet foodvenomno cellphone signalboy killeddimensionchild shotmopchild shot in the headfalling treerulesbattle tankzealotspiderwebcrazy womanlovecraftianmale soldierfeelings of guiltblack outproselytizingripped in halfbaseball cap worn backwardsmanuremaniaromantic kisssurvivalismvicodinpower generatorfather murders sonpainting as artmob rulem1 abrams tankelectrical generatorbehemothharbinger of deathinsect stingcommercial artisttownspeopleelectric lightgrocery marthouse by a lakehowitzersafety glasseschild killed by fathergroanreference to sesame streetstorm damage (See All) |
A lethal virus spreads throughout Scotland, infecting millions and killing hundreds of thousands. To contain the threat, acting authorities brutally quarantine the country as it succumbs to fear and chaos. The quarantine is successful. Three decades later, the Reaper virus violently resurfaces in Lo β¦ndon. An elite group of specialists, including Eden Sinclair, is urgently dispatched into Scotland to retrieve a cure by any means necessary. Shut off from the rest of the world, the unit must battle through a landscape that has become a waking nightmare. (Read More)
Subgenre: | cult filmpost apocalypsedystopia |
Themes: | fearmurderdeathsuicidekidnappingtortureescapemilitarybrutalityparanoiasadismapocalypsecannibalismstarvation |
Mood: | gorecar chasesavage |
Locations: | hospitaltrainforesthelicoptermotorcyclebathtubbuslondon englandwoodscastlelaboratorytrain stationmotorcycle chase |
Characters: | policebrother sister relationshipsoldierpolice officernursehostage |
Period: | future2010s2030s |
Story: | driving off a cliffjumping from a carcurekilling an animalrabbitaxescientistshot in the headshotguncar accidentblood splattercorpseexplosionviolenceblood β¦female nudityone word titlechasepistolshootoutshot to deathmachine gunhorseshot in the chestrescuepunched in the facebattleswordgunfightthongfalling from heightvomitingshowdownheld at gunpointcar crashinterrogationbritishcombatstrippershot in the backdecapitationsurvivalfoot chasesword fightgangambushthroat slittingarmyexploding carsevered headchild in perilhit by a carkingpolice officer killednews reportshot in the legprologueprotestperson on firemissionkicked in the facetough girltankskeletonexploding bodyhorse ridingneck breakingmercenaryshot in the armsilencercowdismembermentriotchainsawmachismofalling down stairscaptainhand grenadegrenadebow and arrowburned aliveelectronic music scorediseasevirusjail cellsergeantmobsevered handtorchaction heroinecrushed to deathbroken leggas maskshieldstealing a carsurveillance cameracrossbowfight to the deathscotlandcannibalchaosgash in the faceshot in the facestabbed in the headspecial forcesthrown through a windowinfectiondungeoncommandohighwaydisfigurementeye patchaxe murderlasersightmedia coverageprime ministerdesert eaglefemale soldierblood on camera lensbarbed wiremolotov cocktailgun in mouthspit in the facehomagefemale fighterhead blown offepidemicarmored carpolice chiefmajorplaguewallcommando unitshot in the eyecommando missionarenabritish armytattooed womancorrupt politicianshot in the handbritainburnt bodyshot through the mouthsole black character dies clichebritish soldiercar set on firequarantineshot in the throatgladiatorbutt slapbreaking through a doormurder of a nude womananimal killingknocked out with a gun buttoutbreakscottish accentangry mobbrandingaxe in the headglasgow scotlandhand cut offbody armorgas grenadeglass eyewoman in a bathtubexploding busnude with a gunpushed down stairsarrow in chestcontagionaxe in the chestcrushed handtask forcedragged by a carleather maskcontamination suitpiercing ripped outarrow in backexploding animalnordenfelt guncar crashes through a windowhostage killedstage divinggimpcar falling off cliffface blown offpolitical adviserabandoned boatcrushed by a door (See All) |
Subgenre: | cult filmindependent filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | feardeathmurderfriendshiprevengekidnappingtortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | cell phone out of rangemutantsevered armaxerifleshot in the headshotguncar accidentblood splattercorpsecell phonesurprise endingexplosionbloodviolence β¦sexcigarette smokingknifechasepistolfirecryingbeatingshot to deathrescueslow motion scenefalling from heightshowdowncar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushmountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetegroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towerno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
Lake Victoria's annual Spring party by 50,000 young revelers is about to turn into a feeding frenzy with prehistoric hunger-pains. With knee-trembler's above the waves and tremors below, released from their dormant sleep, thousands upon thousands of flesh-eating nippers are released into the lake wi β¦th whetted appetites and razor-sharp teeth. With a motley crew of strangers thrown together to defend these shores, it is now up to them to prevent the largest eat-out in human, and piranha, history. (Read More)
Themes: | monsterdeathdrunkennessvoyeurismexploitationpanicself sacrifice |
Mood: | gorehigh schoolhorror movie remake |
Locations: | beachmotorcyclesmall townboatlakecavewater gun |
Characters: | brother brother relationshipmother son relationshipteenagermother daughter relationshipbrother sister relationshipsingle mothersheriff |
Story: | bitten handsevered footeaten aliveanimal attackkilling an animalsevered armscientistanimal in titlebare buttshotgunblood splattercorpsecell phonesurprise endingmale rear nudity β¦male nuditybloodviolencefemale nuditynuditynumber in titlebare breastsfemale frontal nuditybare chested malefemale rear nudityfemale full frontal nuditytitle spoken by characterpartylesbian kissleg spreadingpantiespistoltelephone calltopless female nuditydigit in titleblonderemakerescuearrestbikinisex in bedfalling from heightvomitinghandcuffsvoyeuralcoholf worddecapitationcleavageflashlightold manmassacrevideo cameracocainefishwhite pantiessevered headscantily clad femalefishingchild in perilpolice officer killedskinny dippingelectrocutionmini skirtchampagnefemale removes her clothescheerleaderexploding bodystagefirst partunderwaterdismembermentropepornographydestructionno pantiesnipples visible through clothingeggtouristscene during opening creditswalkie talkiedesperationsevered handskullcoituscgicrushed to deathmale underwearcameoflood3 dimensionalgash in the faceporn starrowboatensemble castaquariumexploding headdisembowelmentarizonaparachuteeye gougingslaughterraised middle fingerpiersevered legtank topcopulationlyingfast motion scenetorso cut in halftracking devicefemale female kissdjnude swimmingtaserscene before opening creditsfemale removes her dressnudelegsfish tankflarenude girldeputybitten in the neckdripping bloodeyeballcrushed headman in swimsuitscuba divingmotorboatteethfemale police officerspeedboatwoman in a bikinitequilacut into piecescocaine snortingmurder of a nude woman3d in titlediverspeedoteenage herox rayed skeletonexploitation filmexploding boatfemale in swimsuitjet skistun gunfossilsliced in twoface ripped off3 ddebaucherypiranhamass killingbody torn apartexposed breastwater skiingbitten on the armbinge drinkingpartyingsevered penisporn directorscalpingsevered faceexpertpet shopwatching pornographytorn in halffish in titlescuba diverinternet pornographybitten in the facebeer kegfinger bitten offhole in chestsplit in twokilled by a propellerpenis bitten offstranded on an islandwhirlpoolman eating monsterwet t shirt contestsinking boatporn actor in mainstream moviekiller animalfemale sheriffthrown from a boatbitten on the legunderwater cavecamera manloss of limbbuxom womancaught watching pornographycliff divingkiller fishskin torn offboat crashman in a swimsuitleg bitten offwhen animals attackpropanebloody waterpara sailingschool of fishseismologisthand bitten offloss of penisbitten by a fishexplicit female nuditycamera focus on female chestlake havasumaelstromwoman sheriff (See All) |
A disease carried by common cockroaches is killing Manhattan children. In an effort to stop the epidemic an entomologist, Susan Tyler, creates a mutant breed of insect that secretes a fluid to kill the roaches. This mutant breed was engineered to die after one generation, but three years later Susan β¦ finds out that the species has survived and evolved into a large, gruesome monster that can mimic human form. (Read More)
Themes: | death of fathermonstermurder of a police officerautismmissing child |
Mood: | rain |
Locations: | new york citytrainbathtubtunnelsewer |
Characters: | father son relationshiphusband wife relationshipbabe scientist |
Story: | lightermutationeaten alivemutantkilling an animalscientistshot in the headblood splattercorpseexplosionbloodone word titledogcigarette smokingtitle spoken by character β¦chasepistolshot to deathfalling from heightmanhattan new york cityflashlightnew yorkimpalementstabbed to deathstabbed in the chestsubwayexploding carchild in perilcreaturelatex glovesbased on short storydeath of childactor shares first name with characterdisappearancechild murdertape recorderdiseaseviruscrucifixpress conferencepreacherswitchbladefalling to deathinsectdead boydrugged drinkdead dogepidemiccockroachsubway stationdead childrenpiano playingpregnancy testsweatshoemetamorphosisbloody body of childbumcar set on firesick childsubterraneanspoonpolaroid cameracut handdragging a bodyhit by a trainchild killedgiant insectnesthazmat suitimitationtorn in halfdissectionboy killedgene manipulationjumping off a roofchild knocked unconsciousbuttonentomologistscentdouble child murderglow stickinjured leglungsfalling through a glass roofsearch for sonimpaled childchild killed by animalcenters for disease controlshoe shinerchild killed by an animalmole people (See All) |
Two young rebellious scientists are told by their employers to halt groundbreaking work that has seen them produce new creatures with medical benefits by splicing together multiple organisms' DNA. They decide to secretly continue their work, but this time splicing in human DNA.
Subgenre: | creature featureblack comedypost modern |
Themes: | monstermurderdeathloveinfidelityrapepregnancydrinkingmemoryseductiondysfunctional familyunfaithfulnessillnessfather daughter incest |
Locations: | farmapartmentrooftoplaboratorysex in barn |
Characters: | brother brother relationshipmother daughter relationshipboyfriend girlfriend relationshipdoctordancerbabe scientistfemale scientistpregnant from rapefather daughter dance |
Period: | 2000s |
Story: | convulsionexperiment gone wronggenetic engineeringkilling an animalsyringerabbitscientistbare buttblood splattercell phonemale rear nuditymale nudityviolencebloodfemale nudity β¦nudityone word titlefemale frontal nudityflashbackbare chested malesex scenedancingphotographfirewoman on topunderwearsex on couchfoodmirrorface slapcomputercatdrinkvomitingbeddead bodyf wordsubjective cameraflashlightstrangulationmontageeatingimpalementbirdcreaturesearchvanflash forwardmicrophonedollknocked outspeechchildbirthrecord playerpizzaexperimentnerdhypodermic needlelistening to musictape recorderrecordingred dressdiseasebarncaught having sexpatientloss of loved onesex on floorcovered in bloodburialambitionmale underwearbroken glasshit on the headjumping through a windowautopsylooking at self in mirrormother son incestbonfiretank toploss of brotherfast motion scenemotherhoodearphonesabandoned housepredatorsex changednaepiloguehit with a shovelsuperhuman strengthgeneticsdead catfully clothed sexparentingcloningfetusscience runs amokextreme close upphonographinfanticidedance lessonwingsbaldnessfemale executivecuriosityapple computercaught in the actmissionary positionmoral ambiguityanimated opening creditsinterspecies sexincest overtonesgender benderhazmat suitbreaking glasstiaraloss of boyfriendhit with a rockchildhood homeeroticismbarbie dollscience experimentcanuxploitationpharmaceutical companykilling a catblue dressshallow graveuncertaintyreference to fred astaireforce feedingmonster rapeincest rapebald womanhormoneliquid nitrogensecret experimentskylightlecture presentationsecret projectstrained relationshipheadbangerhalf humanumbilical cordreflection in eyecowboy sex positionmedical ethicsspontaneous sexpatentupside down viewplaying godrapid agingreference to ginger rogersbiotechnologynews conferenceamphibianethical dilemmapants pulled downhuman cloningsentiencespecimenleakchimeradry humparm in a slingproteinnecklace yanked offhead smashed with a rocknature run amokabusive childhoodblurred boundariesdress ripped offhouse catmutant humanbiochemistbiochemistryclimbing on a roofstingerabandoned farmhousegenetic testingmaternal instinctmaternity revealedupward camera shotuncertain futurebioethicscommercializationdead body in a treehuman hybridimprintingnitrogensurrogate parentabandoned farmaccelerated growthcrashing through a skylightregenerated limbsex with monstertylenolgenetic mutant (See All) |
This film is set in 2093 and takes place in the same universe as the 'Alien' movies. A group of explorers, including some archaeologists, are on an "undisclosed" mission. They arrive at a moon trillions of miles away from Earth. The team spot what they believe to be signs of civilization. They go to β¦ investigate and find more than just signs, they find conclusive evidence. But some of them have an ulterior motive for being there, including the Weyland Corporation. They believe that this is where the human race actually came from. Things soon turn from excitement to survival once inside their discovery. (Read More)
Subgenre: | cult filmsuspensemedicalfuturisticsurvival horror |
Themes: | monstermurdersuicidechristmasbetrayaldrunkennessescapefaithself sacrificetechnologyspace travel |
Mood: | gorepoetic justice |
Locations: | snowwheelchairouter spacecavestormlaboratory |
Characters: | father daughter relationshipboyfriend girlfriend relationshiptattooself mutilationbiologistself surgery |
Period: | future |
Story: | running for your lifedeoxyribonucleic acidgenetic engineeringmutationpresumed deadanimal attackinjectionaxescientistcamerashot in the headshotgunblood splattercorpseexplosion β¦violencebloodflashbackdogbare chested malechasepistolshot to deathshot in the chestshowdownrobotpianosciencedecapitationsurvivalflashlightold manstrangulationmountainbasketballimpalementsevered headman with glassesdream sequencespaceshipcreaturenecklacepilotperson on fireattackmissionrace against timestatueknocked outchristmas treelightningskeletonshot in the shouldercrossneck breakingpremarital sexmercenarywaterfalldismembermentmoonsurgeryshavingcaptainburned aliverevelationhypodermic needlelooking at oneself in a mirrormutilationplaneteccentricskullcrushed to deathback from the deadandroidbarefootgash in the facepool tableexploding headinfectionhologramlens flarebroken armdeath of loved oneflamethrowerburned to deathprequellaser gundrugged drinktracking devicetombexpeditionsuper strengthgiant monsterstrandedacidmegalomaniacbillionairehead bashed incrash landingmercy killingtentacledeath of boyfrienddisembodied headexplorermicroscopecountdownopen endedalien contactparasitegeneticsalien planetexploding shipstarshipman on firesole survivorimmolationliquidslimespacesuithead ripped offalien racecryogenicsmegacorporationarchaeologistmeaning of lifeflame throwerhuman alienhuman versus alienmedicbiological weaponalien technologytrapped in spacehuman in outer spacelifted by the throatmayhemtalking headsandstormgiant creaturetrailer trashred rosegeologistreligion versus scienceescape podgreen bloodlifeboatimpregnationarcheological digbotanistalien possessionkamikazestomach ripped openancient astronautdune buggyxenomorphalien space craftcave paintingsuspended animationshared dreamdust stormplanetariumspaceship crashcrucifix pendantlovecraftianalien parasiteanestheticgod complexterraformingcave drawingprobestarship captainwinchfire axemaintenance manstasisstasis podvideo screenspaceship pilotsterilecaesarean sectioncommandeered vehiclespaceship captainemergency surgeryholographic projectionmedical scannerdecontaminationcross necklacespaceship explosionfinger ringpush upspace voyagehuman body as an alien hoststar mapalien intrusioninternal view of bodyspace expeditionstarship crewspace helmet (See All) |
Huge advancements in scientific technology have enabled a mogul to create an island full of living dinosaurs. John Hammond has invited four individuals, along with his two grandchildren, to join him at Jurassic Park. But will everything go according to plan? A park employee attempts to steal dinosau β¦r embryos, critical security systems are shut down and it now becomes a race for survival with dinosaurs roaming freely over the island. (Read More)
Subgenre: | creature featurecult filmsuspenseepic |
Themes: | monsterdeathbetrayalsurveillance |
Mood: | rain |
Locations: | helicopterkitchenjunglemuseumlaboratoryescape by helicopter |
Characters: | brother sister relationshipteenage girllawyersecurity guardgrandfather grandson relationshipgrandfather granddaughter relationshipbabe scientist |
Period: | 1990s |
Story: | deoxyribonucleic acidexperiment gone wronggenetic engineeringvegetarianeaten aliveanimal attackkilling an animalsevered armscientistrifleshotgunviolencebased on noveltwo word titletitle spoken by character β¦chaserescueslow motion scenecomputerplace name in titleislandsciencesurvivalno opening creditschild in periltonguescreamingelectrocutionfirst of seriesproduct placementlightningfirst partexperimentdisastersabotagejeepheavy rainegglifting someone into the airice creamsecurity camerahunterblockbustervirtual realitypart animationdinosaurrampagechild's point of viewpower outagemillionaireamusement parkrainstormtourcomputer crackercomic relieftween girlbillionaireflarecomputer hackerentrepreneurfemale herobiologyfriends who live togethersole black character dies clichetyrannosaurus rexfamous scoremicroscopepart computer animationcloningtheme parkfamous linenight vision gogglesscience runs amoktropical islandmegacorporationscreenplay adapted by authorfossilmosquitoscreaming in fearwalking stickmathematicianlifting an adult into the airhawaiian shirtouthouseindustrial espionagetriceratopssneezechild in dangerelectric fenceembryoscreaming girlshaving creamlifting a male into the aircorporate espionagegene manipulationpaleontologistmusic score features pianoreference to disneylandclimbing over a fencevelociraptordinosaur eggpaleontologyjurassic parkdinosaur skeletonhail marychaos theorymale sitting on a toiletapple macintosh computerdinosaur attackbrontosaurussecurity breachelectric carfemale hackerman on a toiletpart computer animatedbaby dinosaursecret islandboy in dangerholding one's hand over someone's mouthscience goes awryhuman versus dinosaurdungcorporate logomusic score features choirtouch screendinosaur featurepanama hatpopping a champagne corkdinosaur and mangallimimusdilophosaurusford explorerattacked by dinosaurbrachiosauruschild screaminggame wardenhatcherytechnophobiatrailer narrated by nick tatecar in a treelive dinosaurraptor dinosaur (See All) |
Cloverfield follows five New Yorkers from the perspective of a hand-held video camera. The movie is exactly the length of a DV Tape and a sub-plot is established by showing bits and pieces of video previously recorded on the tape that is being recorded over. The movie starts as a monster of unknown β¦origin destroys a building. As they go to investigate, parts of the building and the head of the Statue of Liberty come raining down. The movie follows their adventure trying to escape and save a friend, a love interest of the main character. (Read More)
Subgenre: | creature featurecult filmfound footagesurvival horror |
Themes: | monsterfeardeathloveescapemilitarypanic |
Mood: | one night |
Locations: | new york cityhelicopterapartmentrooftopcar firehumveefire escape |
Characters: | brother brother relationshipsoldierout of control |
Period: | 2000s |
Story: | running for your lifeeaten alivedeath of brotheraxecamerablood splattercell phonesurprise endingexplosionviolencebloodone word titleflashbackphotographparty β¦rescuerunningmanhattan new york citysubjective camerasurvivalflashlightvideo cameraambulancedeath of friendarmysubwaynonlinear timelinecultno opening creditslooking at the cameratalking to the cameradangercharacter's point of view camera shotproduct placementtenttankexploding bodyratcharacter says i love youdirectorial debuttv newsdestructiongroup of friendsexploding buildingspiderbrooklyn new york cityrocket launchercrushed to deathrampageu.s. armychaosconvenience storeevacuationm 16amusement parksurprisehandheld cameraone daycellphonesirenblood on camera lensalleycentral park manhattan new york citysubway stationgiant monsterfireballbrooklyn bridgenight visionskyscraperold flamedepartment storehelicopter crashfighter jetferris wheelstatue of liberty new york citychandelierquarantinenewscastfrightparasitecrowbaru.s. marine corpsreference to supermanscaretelevision reporteru.s. air forcesurprise partychrysler building manhattan new york cityfootprintbitelootingloss of controlhorse drawn carriageno survivorspower failureaerial photographybuilding collapseviral videokaijuair strikeempire state building manhattan new york cityshaky camgeneration ymass destructionconey island brooklyn new york citynational guardpassed out drunkbridge collapsejapanese flagno musicmillennial generationambiguous titlebleeding from eyeslovecraftiandestroyed citycellular phonesubway tunnelstealth fightercrushed caraerial bombardmentout of focusdisaster in new yorkmonster terrorizes citygoing away partyclose encounterelectronic storebiohazard signcatching food in one's mouthrebarshoulder launched missilebell uh 1 iroquois helicopterconey island new york city (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
Subgenre: | creature featurecult filmindependent filmblack comedysuspenseb moviesurvival horrormonster movie |
Themes: | monsterfeardeathmurderlovesurrealismkidnappingdrunkennessescapedeceptionsupernatural powerparanoiahome invasionpaniccourage β¦near death experiencespace travel (See All) |
Mood: | satirenight |
Locations: | farmbarchurchhelicoptersmall townbicyclekitchenpolice stationpolice carrooftopouter spacebicycle accident |
Characters: | father son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralienpriesthostagelittle boy β¦alcoholicsheriffalien monster (See All) |
Period: | 1980s |
Story: | mutationeaten aliveaxerifleshotguncar accidentblood splattercorpsesurprise endingexplosionviolencebloodone word titlecigarette smokingphotograph β¦title spoken by characterknifefireshot to deathshot in the chestrescueslow motion scenewatching tvcatheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomflashlightambushimpalementtoiletradiochild in perilspaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batlightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail cellspacecrafteccentricphone boothlasersocial commentarybroken legmechanicredneckwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boylaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All) |
Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com β¦plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)
Subgenre: | creature featurecult filmindependent filmblack comedysuspensestop motion animationteen romancebody horror |
Themes: | monsterfearmurderdeathfriendshipdrunkennessescapedeceptionmilitaryparanoiaredemptionpaniccourageself sacrificenear death experience β¦unlikely hero (See All) |
Mood: | gorehigh schoolpoetic justiceone nighthorror movie remake |
Locations: | hospitalchurchforestcarhelicoptersnowmotorcyclecemeterysmall townwoodskitchenpolice stationpolice carouter spacesewer β¦car motorcycle chasemotorcycle chasetruck accident (See All) |
Characters: | brother brother relationshipfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorboybrother sister relationshipteenage girlteenage boysoldier β¦nursepriesttough guywaitressvillainbiblesheriffself mutilationhomeless manbiologistalcoholic drink (See All) |
Period: | 1980s |
Story: | biohazardjumping from a carexperiment gone wrongmutationeaten alivesevered armtransformationaxescientistcar accidentblood splattercorpsesurprise endingexplosionviolence β¦blooddogguncigarette smokingchasepistolfiremachine gunremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverdecapitationsurvivalorphanflashlightambushambulancedeath of friendbridgefootballdinermapexploding carfalse accusationsevered headanti herodisarming someonechild in perilhit by a carcreaturepolice officer killedvannecklacedangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderfilm within a filmexploding bodydateratdismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachercrushed to deathsocial commentarybikerfemale warriormechanicrampagereverse footageexplosivebraveryu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiumjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage loveurban legendfirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stunthazmat suitmotorcycle crashprojectionistyo yosinkmass deathjarpart stop motionfreeze to deathbiological warfaregeiger counterblobmanholetown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerchild eatenface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikecrash siteevil preachertoilet plungerteen heroteen couple eaten (See All) |
Life for former United Nations investigator Gerry Lane and his family seems content. Suddenly, the world is plagued by a mysterious infection turning whole human populations into rampaging mindless zombies. After barely escaping the chaos, Lane is persuaded to go on a mission to investigate this dis β¦ease. What follows is a perilous trek around the world where Lane must brave horrific dangers and long odds to find answers before human civilization falls. (Read More)
Subgenre: | zombie apocalypse |
Themes: | murderdeathsuicideescapeinvestigationmilitarysurveillancepanicapocalypseself sacrificeunlikely hero |
Mood: | rain |
Locations: | new york citybeachhelicoptermotorcycleairplaneparis francedesertbicycleairportelevatorapartmentshipcanadarooftopocean β¦indiaisraellaboratorypennsylvaniaairplane accidenthumveewalled city (See All) |
Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipdoctorzombiesoldiersister sister relationshipwarrioraction herolittle girlsecurity guardsniperamerican abroadsniper rifle β¦self inflicted gunshot wound (See All) |
Period: | year 1973 |
Story: | bitten handantidotecuremutationeaten alivesevered arminjectionaxescientistrifleshot in the headshotguncar accidentcorpsecell phone β¦surprise endingexplosionviolencebloodbased on novelflashbackdogbare chested malegunkisssingingknifechasethree word titlepistoltelephone callvoice over narrationcryingshootoutshot to deathmachine gunshot in the chestrescuebattlegunfightfalling from heightbeerbombcar crashinterrogationrevolvercombatshot in the backsurvivalfoot chasenew yorkdeath of friendwomanmontageimpalementstabbed to deathpoliticianstabbed in the chesttied to a chairexploding carradiochild in perilcreaturepolice officer killednews reportshot in the foreheadpilotcharacter repeating someone else's dialogueperson on firemissionproduct placementbaseball battankexploding bodyreuniondie hard scenariomercenarygeneralsilencerrefugeesubtitled sceneundeadfreeze frameriotak 47missiletv newshuggingfalling down stairscaptainhand grenadesupermarketgrenadeburned alivespearelectronic music scoreheavy rainmachetediseasevirussecurity camerajail cellmagazineaccidental deathsevered handend of the worldcolonelbreakfastapartment buildingstealing a carexplosivenew jerseypower outage3 dimensionalchaosevacuationfalling to deathstabbed in the headspecial forcesassault rifleairplane crashinfectioncommandobody landing on a cargasolinephiladelphia pennsylvanialens flareduct tapestadiumflamethrowerexploding helicoptershaved headgatling gungrenade launchermoscow russiahit with a baseball batfemale soldierpalestinecia agentliving deadstuffed animalunited nationscafeteriaepidemicfamily reunionjerusalemwallasthmacommando unitflaresicknesshelicopter crashpharmacyhit by a truckreluctant heroamputationbitten in the neckbunk bedisraeliwalessaving the worldu.s. navysouth koreaburnt bodyopen endedairfieldvaultcrowbaraircraft carrierrecreational vehiclenorth koreamotorcycle copzombie violencevending machineimprovised weaponshopping cartarmy basenight vision gogglesoutbreakpittsburgh pennsylvaniaepic battlelootingpancaketoothcamperchild with a gunatlantic oceanhand cut offbarricadecoming out of retirementvaccinechihuahuabitten on the armnova scotiapandemicblockademass destructionmossadkiss on the foreheadbacteriatroubled productionbell 206 jet ranger helicopterexplosive decompressionswarmwatching news on tvisraeli soldierbelarushand chopped offjerusalem israelimmunityresearch facilitybitten on the legclimbing a wallnewark new jerseyself injectiontruck crashhit with a crowbarisraeli flagair stripcardiff walesworld health organizationboeing 767eurocopter dauphinvirologistfairchild republic a 10 thunderbolt iimass panic (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks β¦the colonists in a whole new environment. (Read More)
Subgenre: | dark comedyindependent filmmartial artsblack comedysuspenseb movieabsurdismfish out of waterteen horror |
Themes: | monsterfeardeathmurderescapemilitarypsychopathbrutalitysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
Mood: | goreslasherambiguous ending |
Locations: | woodslakeouter spacelaboratoryspace stationresearch stationship explosion |
Characters: | teenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyvillainteacher student relationshipprofessorterrorengineerbabe scientist |
Period: | 2000s |
Story: | deoxyribonucleic acidpresumed deadsevered arminjectiontransformationscientistrifleshot in the headshotgunblood splattercorpsesurprise endingexplosionbloodviolence β¦female nuditycharacter name in titlenumber in titlesequelfemale frontal nudityflashbackbare chested malesex scenekissfightnipplesknifechasepistolfirebeatingshot to deathfistfightmachine gunshot in the chestface slaprescuepunched in the facecomputerfalling from heightmaskshowdownheld at gunpointhand to hand combatnumbered sequelrobotkung fushot in the backdecapitationsurvivalflashlightambushstrangulationmassacrethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the leglatex glovesflash forwardpilotstalkerbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timeevil mankicked in the facetough girlstalkingexploding bodyneck breakingthreatened with a knifemercenarylove interestkissing while having sexdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatmutilationroman numeral in titlestabbed in the stomachspacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadandroidmasked mancyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramslaughterdisfigurementknife throwingfemale doctorsevered legcharacters killed one by onetank topmasked killergatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shoulderextreme violencemicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimmurder of a nude womanarmy basemass murdererstupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicssleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d β¦ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
Subgenre: | martial artspost apocalypsedystopiacyberpunkchrist allegory |
Themes: | death of fathermonsterdeathmurderrevengekidnappingreligionbetrayaltorturefuneralherodeceptiondeath of motherredemptionhome invasion β¦justiceself sacrificeghost town (See All) |
Mood: | gorenightmarenightdarknesspoetic justice |
Locations: | bartrainchurchmotorcyclecemeterysmall towndesertelevatorcitycavetownbar brawlmotorcycle chasetrain explosionwalled city |
Characters: | brother brother relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoopriesthostagetough guychristianvampirewarrioraction herovillainbible β¦sheriffuncle niece relationshipex soldierhuman versus monsterfacial tattoo (See All) |
Period: | future |
Story: | mutationpresumed deadeaten aliveanimal attackmutantkilling an animalsevered armdeath of brothertransformationshotgunblood splattercorpsesurprise endingexplosionviolence β¦bloodcharacter name in titlebased on novelone word titleflashbackbare chested malegunfightcigarette smokingphotographtitle spoken by characterknifechasefirevoice over narrationshootoutbeatingfistfightmachine gunshot in the chestrescuepunched in the facebattlebrawlfalling from heightbased on comicshowdownheld at gunpointhand to hand combatinterrogationcombatkung fudecapitationgood versus evilsurvivalflashlightbased on comic bookambushmassacremountainthroat slittingimpalementstabbed to deathstabbed in the chestweaponsevered headno opening creditsanti heroone man armycoffinfictional warcreatureon the runconfessionone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuespiritualityperson on fireelectrocutionattackbased on mangamissionrace against timedollstatuekicked in the facetough girllightningfarmerscarcrossexploding bodyneck breakingthreatened with a knifecabinmercenarychickenvigilantestylized violencestrong female characterbulletrevelationhead buttheavy rainmachetecowboy hatjail cellcrucifixkicked in the stomachnosebleedasian womanjumping from heightcovered in bloodskullhonoraction heroinecrushed to deathsocial commentarybar fightfemale warriorfull moonguarddamsel in distresstarget practiceveteransandcrossbowteamanimated sequence3 dimensionalgash in the facestabbed in the leg3dpunched in the chestdark herodynamitejumping through a windowdisembowelmentblood on shirtfascismboyfriendknife throwingdark pastlanterngadgetsevered legcellardaggertorso cut in halftracking devicefemale soldierprayingcrucifixionruinsvigilantismparkourworld dominationconfessionalshot with an arrowmegalomaniacflask18 year oldflarequitting a jobgramophonepocket watchvigilante justicebased on graphic novelbitten in the neckmeat cleaveracrobatstabbed in the shoulderfight the systembladerepeated linesuperhuman strengthtragic pastsubterraneancut into piecestrapdoornight timemass gravevampire hunterone woman armypsychotronic filmanti heroinegogglesman with no nameacrobaticssome scenes animatedvampire slayerstarts with narrationhit by a trainwire fubritish actor playing american characterpassenger traintrain conductorcoming out of retirementmotorcycle stuntnieceoil lampexploding motorcyclecouncilinsubordinationoutpostalternate worldtrain wreckclergytrackinggeiger countertotalitarianknife in chestsuperhuman speedtrain derailmentexploding trainhit by a motorcyclefight on train roofhuntressmonolithsolar panelblack hathiveriding motorcyclehuman versus vampireopening credits18 year old girldisobeyfall through floorvampire queengiant statuelong haired womanwoman with long hairfemale vampire hunter (See All) |
Attack the Block follows an unlucky young woman and and a gang of tough inner-city kids who make an unlikely alliance to try to defend their turf against an invasion of savage alien creatures, turning a South London apartment complex into a war-zone.
Subgenre: | creature featurecult filmindependent film |
Themes: | monsterdeathmurderfriendshiprevengeescaperobberyunlikely hero |
Mood: | goreone night |
Locations: | helicoptermotorcyclelondon englandbicycleelevatorurban settingapartmentwater gun |
Characters: | policeteenagerteenage boynursealienbiologist |
Story: | eaten aliveanimal attackkilling an animalsevered armaxeblood splattercorpsecell phoneexplosionviolenceblooddogknifechasethree word title β¦pistolfirebeatingshot to deathmachine gunslow motion scenewritten by directorswordarrestfalling from heightshowdownheld at gunpointcar crashmarijuanahandcuffsrevolverf worddecapitationsurvivalfoot chasegangambushdeath of frienddrug dealerstabbed to deathstabbed in the chestexploding carsevered headanti herochild in perilhit by a carcreaturepolice officer killedlimousinedrug addictbinocularscharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on firecharacter's point of view camera shotdeath of childbaseball batexploding bodydie hard scenariocharacter says i love youthreatened with a knifeprofanityfireworkschild murdercrime bossfalling down stairsburned alivemacheteswat teamjumping from heightcovered in bloodparking garagealien invasionstealing a carplaygroundkatana swordgash in the facestabbed in the headcigarette lighterjumping through a windowthrown through a windowone daylens flareburned to deathlocation in titlehit with a baseball batmarijuana jointgang wargateimperative in titlestreet gangparkourstonerflarehit by a truckcrashing through a windowbloody body of childmuggingmeteortoy gungang membergang leaderanimal killingsocial decaymopedteenage herofirecrackergas explosionthroat rippinghuman versus alienset on firehousing projectkilled in an elevatoroutrunning explosionskylineslanggreen bloodlondon undergroundstabbed through the chinstolen police carentomologistzoologistyouth gangreference to ebayultraviolet lightbitten on the legsevered noseman eaten by monsterviolent youthpheromonestower blockalien hunthiding in a dumpsterreference to simon cowellmeteor crashbonfire night (See All) |
Paleontologist Kate Lloyd is invited by Dr. Sandor Halvorson to join his team who have found something extraordinary. Deep below the Arctic ice, they have found an alien spacecraft that has been there for perhaps 100,000 years. Not far from where the craft landed, they find the remains of the occupa β¦nt. It's cut out of the ice and taken back to their camp but as the ice melts, the creature reanimates and not only begins to attack them but manages to infect them, with team members devolving into the alien creature. (Read More)
Subgenre: | survival horrorbody horror |
Themes: | monstermurderdeathdeceptionparanoia |
Mood: | gore |
Locations: | snowlaboratoryshed |
Characters: | doctoralienbabe scientist |
Period: | 1980syear 1982 |
Story: | mutationkilling an animalsevered armtransformationaxescientistshot in the headblood splattercorpsesurprise endingexplosionblooddogtwo word titletitle spoken by character β¦chasepistolfireshot to deathfalling from heightflashlightimpalementstabbed to deathstabbed in the chestno opening creditsspaceshipperson on firescene during end creditsexploding bodyisolationsuspicionsubtitled scenesabotagegrenadeburned aliveautopsyaerial shotlens flarecharacters killed one by oneflamethrowerprequelflarehelicopter crashlanguage barriertentaclewrist slittingtestsole black character dies clichemicroscopeclawshapeshiftingdrillglacieralien creatureantarcticascientific researchhelicopter pilotsnowstormflame throwerfrozen bodyimitationfalling through icenorwegianoutpostbell 206 jet ranger helicopterassimilationsplit headsuspended animationpaleontologistshape shifting alienhusky dogfrozen alivehorror movie prequelmale wearing an earringtooth ripped outironic endingprequel to remakesikorsky hh 53 jolly green giantnorwegian flagpolar research station (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather β¦ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | martial artsconspiracypost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsepost apocalypticcorporate conspiracy |
Themes: | monsterfearmurderdeathrevengekidnappingbetrayalescapedeceptionangerbrutalityparanoiaredemptioninsanityillness β¦surveillancehopepanicself sacrificeartificial intelligence (See All) |
Mood: | gore |
Locations: | motorcyclewheelchairrooftoplaboratorytunnelsewerhumveecable car |
Characters: | father daughter relationshipboyfriend girlfriend relationshipdoctorfemale protagonistzombiesoldierhostagesecurity guardbibleprofessorengineer |
Period: | zip lineseeing the future |
Story: | deoxyribonucleic acidantidotesevered footcuregenetic engineeringeaten aliveanimal attacksevered armscientistshot in the headcar accidentblood splattercorpsesurprise endingexplosion β¦violencebloodsequelflashbackdogfightknifechasepistolfirevoice over narrationshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facewritten by directorbattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatsunglassesbombrunningcar crashinterrogationcombatkung fushot in the backsubjective cameradecapitationgood versus evilsurvivalflashlightambushstrangulationmassacrethroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestexploding carsevered headno opening creditsdisarming someonefictional wardouble crossunderwater scenecreaturevoice overshot in the legnecklaceshot in the foreheadone against manybinocularsbeaten to deathdangerstabbed in the backprologuelocker roomfired from the jobperson on fireelectrocutioncharacter's point of view camera shotmissionactor playing multiple rolesrace against timecover upevil manknocked outkicked in the facetough girltankopening action sceneshot in the shoulderscarexploding bodythreatened with a knifemercenarywaterfallshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanak 47missileropetraitoruzihand grenadesabotagefireplacedestructionburned aliverevelationhead buttelectronic music scoreheroinehypodermic needlemachetesociopathdiseasevirussecurity camerawalkie talkiecrucifixmad scientistkicked in the stomachwristwatchdesperationjumping from heightsevered handstrong female leadlasergenociderocket launchertorchend of the worldaction heroinemexican standoffwhite housegun fusocial commentaryfemale warriorcyborgmechanicstealing a carsevered fingerfight to the deathresistancedual wieldstabbed in the throathatredbased on video gamehit in the crotchmercilessnesspower outagechaosshot in the facebroken glassevacuationcigarette lighterstabbed in the legpunched in the chestairplane crashinfectionbooby trapaerial shothologrambody landing on a carknife throwingraised middle fingergasolinestabbed in the eyesevered legburned to deathsirenclonegatling gunfast motion scenebullet timerockettorso cut in halfenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownreturning character killed offfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantstabbed in the armcommanderflarehanging upside downhelicopter crashsawed off shotgunfemale herobitten in the neckwoman kills a manfight the systemfinal battleshot through the mouthsole black character dies clicheshot in the footcountdownopen endedjumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killinganti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gunmegacorporationcorporate crimedetonatornail gunstabbed in the footchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All) |
Animal activists invade a laboratory with the intention of releasing chimpanzees that are undergoing experimentation, infected by a virus -a virus that causes rage. The naive activists ignore the pleas of a scientist to keep the cages locked, with disastrous results. Twenty-eight days later, our pro β¦tagonist, Jim, wakes up from a coma, alone, in an abandoned hospital. He begins to seek out anyone else to find London is deserted, apparently without a living soul. After finding a church, which had become inhabited by zombie like humans intent on his demise, he runs for his life. Selena and Mark rescue him from the horde and bring him up to date on the mass carnage and horror as all of London tore itself apart. This is a tale of survival and ultimately, heroics, with nice subtext about mankind's savage nature. (Read More)
Subgenre: | cult filmpost apocalypseallegoryzombie apocalypsezombie survivalbritish horrorzombie outbreak |
Themes: | death of fatherfeardeathmurdersuicidebetrayalescapemilitarylonelinessbrutalityparanoiainsanityapocalypsecouragestarvation β¦ghost town (See All) |
Mood: | goremurder of a boy |
Locations: | taxi driverhospitalchurchforestlondon englandtaxilakerooftopgas stationstormlaboratorytunnelcar explosionchurch of england |
Characters: | father daughter relationshipteenage girlteenage boyzombiesoldierhostageinterracial relationshipsingle fathermilitary officerdeath of a boy |
Story: | animal attacksevered armloss of fatherscientistbare buttshot in the headcar accidentblood splattercorpseexplosionmale rear nuditymale nuditybloodviolencefemale nudity β¦nuditynumber in titlemale frontal nuditybare chested malegunshowerfiredreamshot to deathfoodmachine gunhorsemirrorundressingvomitingcar crashlow budget filmmale pubic hairalcoholshot in the backsurvivalmansionarmyimpalementno opening creditsbeaten to deathwidowerperson on firefantasy sequenceproduct placementevil manbaseball batattempted rapeexploding bodyisolationratfirst partgraffitidismembermentriotsupermarketdressmacheteshot in the stomachsurvivorcomadiseaseragevirussergeantend of the worldrapistpicnicapartment buildingdrug overdoseinterracial romancegrocery storebutcherdespairthunderstorminfectionmurder of a childeye gouginggasolinesexual assaultchainflat tirepervertblood on camera lenscar troublegroupepidemicoverdosemajorplaguefortresscredit cardinterracial kissroadblockbritish armybullet woundwindmillchimpanzeesewingdeath of parentsretributionkiss on the cheekbutcheryloss of parentsoutbreakzombie attackradio broadcaststairwelllandminebloody body of a childdoomsdaymanchester englandbig ben londonzombie childsafe housedead parentsdeath of a childruinanimal liberationtire ironblood vomitingchild driving a carzombificationlondon undergroundvaliumhell on earthaccident victimlondon eyechild knocked unconsciousanimal researchdeadly diseasebicycle messengertankersoft drinkcontamination suitcoming out of a comaregaining consciousnesssneak attackbicycle courierchocolatesgas siphoningplunderingimplied happy ending (See All) |
New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)
Subgenre: | independent filmsuspenseconspiracyamerican horrorbritish horrorfolk horror |
Themes: | death of fatherfeardeathmurderkidnappingreligionghostmagicsupernatural powerdeath of motherredemptionguiltinsanityillnessevil β¦dyingdevilmadnesswildernessfather love (See All) |
Mood: | goreraindarkness |
Locations: | farmchurchforestvillagewoodsrural settingenglandcampfirenew englandbackwoods |
Characters: | brother brother relationshipfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerboybrother sister relationshipteenage girlbabysister sister relationshipchristian β¦reference to godlittle girllittle boyvillainbiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All) |
Period: | winter17th century1600s |
Story: | whisperinganimal attackdeath of brotherrabbitaxecandleprayerrifleblood splattermale rear nuditymale nudityviolencebloodfemale nuditynudity β¦female frontal nuditydogbare chested malekisssingingknifecryingsongfoodhorseundressingsecretliedemonhallucinationreference to jesus christsubjective camerastrangulationstabbingwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessiondisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinwolfmass murdergothiceggwitchcraftcrying womancrying manburialgoatapplepromisetensionhypocrisysonhungerbutchershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All) |
Almost eleven years after the futile and disastrous expedition on the distant moon LV-223, the deep-space colonisation vessel Covenant equipped with more than 2,000 colonists in cryogenic hibernation, sets a course for the remote planet Origae-6 with the intention to build a new world. Instead, a ro β¦gue transmission will entice the crew to a nearby habitable small planet which resembles The Earth. The unsuspecting members of Covenant will have to cope with biological foes, beyond human comprehension. Ultimately, what was intended as a peaceful exploratory mission, will soon turn into a desperate rescue operation deep into the cold infinite space. (Read More)
Subgenre: | creature featuresuspensetragedyfuturisticsurvival horrorbody horror |
Themes: | monsterfeardeathmurderbetrayalescapefuneraldeceptionangerbrutalityparanoiainsanitysadismfaithsurveillance β¦death of wifepanicnear death experienceartificial intelligencespace travelunlikely hero (See All) |
Mood: | gore |
Locations: | forestwoodsouter spacecavelaboratorysex in shower |
Characters: | husband wife relationshiphomosexualdoctorsoldieralienhostagegay kissinterracial relationshipsnipersniper rifleengineerbabe scientistship captainbiologist |
Period: | future |
Story: | biohazardstabbed in the neckpresumed deadeaten aliveaxescientistbare buttcamerashot in the headshotgunblood splattercorpsesurprise endingexplosionmale rear nudity β¦male nudityviolencebloodfemale nuditybare breastssequelflashbacktwo word titlebare chested malegunsex scenefemale rear nudityfightcigarette smokingphotographknifechasepistolshowerfiretopless female nuditybeatingshot to deathfistfightmachine gunshot in the chesturinationrescueslow motion scenepunched in the facebrawlfalling from heightpaintingshowdownheld at gunpointsecond partrobotpianorivershot in the backf wordsubjective cameradecapitationsurvivalflashlightstrangulationmassacremountaindeath of friendimpalementwidowstabbed in the chestsevered headradiodisarming someonedouble crossspaceshipcreaturecigar smokinglatex glovestraininggravepilotbeaten to deathdangerstabbed in the backprologuescreamingwidowerperson on firecharacter's point of view camera shotmissionactor playing multiple rolesrace against timestatuetough girllightningskeletonscartragic eventexploding bodydeath of husbandlaptopneck breakingsuspicionmercenarywaterfallobscene finger gesturecult directorshavingcaptainbulletburned aliveheavy rainegglooking at oneself in a mirrorsociopathscene during opening creditshelmetviruscowboy hatloss of friendsecurity cameramad scientistloss of loved onebeardspacecraftsergeantloss of wifeplanetbarefoot malesevered handlasergenocidecrushed to deathandroidmexicanfemale warriormechanicrampagefight to the deathmercilessnessevacuationexploding headpunched in the chestassault rifledisembowelmentinfectionaerial shothologramrainstormraised middle fingerhomoeroticismfemale doctormale male kissloss of husbandcharacters killed one by onelasersightsequel to cult favoritekilling spreedeath of loved onetank topburned to deathmoral dilemmaprequelgrenade launchertracking deviceclose up of eyesinterrupted sexfemale soldiersuffocationextraterrestrialexpeditionfinal showdownfire extinguisherreturning character killed offvomithead blown offarmored carsuper strengthtwist endingacidburnt facehurricaneinterracial marriagepartial female nuditycrash landingreluctant herooffscreen killingaltered version of studio logoquarantineparasitewoman fights a mandistrustsubterraneansole survivormass graveflare gunbulldozerceocreationismstupid victimvillain not really dead clichearmoryalien creaturespacesuitsecret roomspace explorationcryogenicsscrollkilled during sexarchaeologisthuman alienbiological weaponbritish actor playing american characteralien technologytrapped in spacehumanoidsuper computervideo recordinggay subtexthomoeroticdisobeying ordersinfirmarycolonizationsecret laboratoryblood vomitingexplosive decompressionspace westernembryospacewalkrobot as menacexenomorphalien space craftsuspended animationrobot as pathosreference to richard wagnerhole in chestsignallovecraftianalien parasitewheatcamera shot from inside human bodyterraformingface burnfemale mechanicprequel and sequelreference to lord byronshockwavewoman wearing a tank topecologistfemale mercenaryrecorderhelmet camerastasisreference to john miltoncutting own hairdereliction of dutyhomosexual couple2100spathogenspace colonizationsuffocated to deathreference to john denverneutrinoreference to michaelangeloreference to percy bysshe shelleychest ripped open (See All) |
22 years after the original Jurassic Park failed, the new park (also known as Jurassic World) is open for business. After years of studying genetics the scientists on the park genetically engineer a new breed of dinosaur. When everything goes horribly wrong, will our heroes make it off the island?
Subgenre: | creature featuremonster moviedisaster film |
Themes: | feardeathchristmasbetrayalescapedeceptionparanoiasurveillancecouragehuntingnear death experienceunlikely hero |
Mood: | satire |
Locations: | beachforesthotelhelicoptersnowmotorcycleairplaneairportelevatorjunglemuseumlaboratorysuvforest fire |
Characters: | brother brother relationshiphusband wife relationshipmother son relationshipteenagerboyfriend girlfriend relationshipsoldiersister sister relationshiptough guywarrioraction herosecurity guardemployer employee relationshipamerican abroadaunt nephew relationshipself referential β¦geneticist (See All) |
Period: | 2010s |
Story: | deoxyribonucleic acidexperiment gone wronggenetic engineeringeaten aliveanimal attackscientistrifleshotgunblood splattercorpsecell phonesurprise endingexplosionviolenceblood β¦sequeltwo word titlekisstitle spoken by characterknifechasepistolfirecryingmachine gunrescueslow motion scenewritten by directorbattlefalling from heightshowdownislandrevolverriversciencecombatsubjective camerasurvivalflashlightambulancewomanimpalementstabbed in the chestmapno opening creditschild in perilhit by a carunderwater scenesearchtrainingelectrocutioncharacter's point of view camera shotmissionproduct placementskeletonlong takeexploding bodypigmanagermercenarywaterfallafricandestructionjeeptouristmouseexploding buildingfourth partblockbusterjumping from heightsharkrocket launchergoatcrushed to deathsocial commentarydinosaurrampagecameobraveryconstruction sitefight to the deathchaosevacuationfalling to deathtitle appears in writingaquariumspecial forcesswampamusement parkassault rifleaerial shotcommandohologramgasolinecorporationrescue missionlasersightferryexploding helicoptermoral dilemmagatling gunnannytracking deviceclose up of eyesheroismbazookablood on camera lensfinal showdowntaserteenage lovelizardnight visionold flametrailer homebillionairecommandercommando unitflarehelicopter crashcommando missionfall from heightarenadripping bloodfinal battletyrannosaurus rexfamous scorefilmed killinghigh techpart computer animationcamouflageorchestral music scoregeneticsman wearing glassescloningtheme parkceoanimal killinglifting person in airnight vision gogglesscience runs amokarmoryhelicopter pilottoothtrainerenglishwoman abroadcorporate executivejumping off a cliffel trainpagerhot dog standevil scientistcollapsing buildingtranquilizer dartcaught in a netdeus ex machinachild in dangercosta ricapterodactylsearch and rescuenight vision binocularssea creatureair raid sirenmaulingcattle prodvelociraptormonster versus monsterdinosaur eggpaleontologyemployee employee relationshipjurassic parkreboot of seriesmonorailvibrating cell phonechimeradinosaur attackhatching eggscore employs electronic instrumentshotwiringhybrid animalex navyhuman versus dinosaurmusic score features choirdinosaur featureheart rate monitordinosaur skullroad flareflying dinosaurjumping into riverraptor dinosaur (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film |
Themes: | fearmurderdeathrevengesuicidedrunkennessescapedeceptionbrutalitysupernatural powerparanoiainsanitysurveillancehome invasionpanic β¦apocalypsecannibalismnear death experience (See All) |
Mood: | gorebehind the scenesnightmareambiguous ending |
Locations: | bartrainforestcemeteryairplaneairportwoodskitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire β¦train driver (See All) |
Characters: | father son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteacherzombiepolice officerstudentartistsecurity guardteacher student relationship |
Period: | 2010s |
Story: | mutationeaten alivemutanttransformationaxerifleshot in the headshotgunblood splattercorpsecell phonesurprise endingexplosionviolenceblood β¦based on novelone word titledogfightcigarette smokingdancingtitle spoken by characterpartyknifechasepistolfirebased on bookbeatingdreamshot to deathshot in the chestrescueslow motion scenecatswordbrawlfalling from heightshowdownheld at gunpointbombshot in the backsurvivalfoot chaseflashlightambushmontageimpalementstabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perilhit by a cardouble crosssearchshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyperson on fireattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterfireplacebow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivorviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialbarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosshovelstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murderburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead β¦that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
Subgenre: | martial artspost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsezombie survival |
Themes: | monstermurderdeathrevengekidnappingbetrayalprisonescapedeceptionbrutalitycelebritysurveillanceamnesia |
Mood: | gorerainpoetic justice |
Locations: | beachhelicoptersnowairplanelos angeles californiaboatwaterelevatorjapanpolice carshiprooftoptunnelseweralaska β¦airplane accident (See All) |
Characters: | tattoobrother sister relationshipfemale protagonistzombiesoldierhostagewarriorjapanesesniperasian americansniper rifleself destructivenessself healing |
Story: | genetic mutationbiohazardmutationeaten aliveanimal attackkilling an animalinjectiontransformationaxeshot in the headshotgunblood splattersurprise endingexplosionviolence β¦bloodsequelflashbackdoggunfightknifechasethree word titlepistolshowervoice over narrationpunctuation in titleshootoutshot to deathmachine gunshot in the chestrescueslow motion scenepunched in the faceswordbrawlfalling from heightheld at gunpointsunglassesbombbathroomrevolvercombatshot in the backf wordswimmingdecapitationgood versus evilsurvivalflashlightassassincaliforniamassacremountaindeath of friendarmyimpalementcolon in titleprisonerstabbed in the chestsevered headanti heropart of serieschild in perilfictional warunderwater scenecreatureshot in the legshot in the foreheadbinocularsstabbed in the backumbrellaevil mankicked in the facetough girltankscene during end creditsshot in the shoulderamerican flagexploding bodytraptied upunderwatermercenaryshot in the armsubtitled sceneundeadhenchmanropeuzigrenaderevelationassassination attemptsociopathsurvivorviruscooksecurity camerajail cellexploding buildingkicked in the stomachfourth partgiantjumping from heightfaked deathmind controltorchaction heroinegun fusocial commentarygun battlefemale warriorcamera shot of feettokyo japanfloodexplosivebased on video gamemercilessness3 dimensionalchaosgash in the faceshot in the faceblack and white scenespecial forces3dexploding headaerial shotfoghologramknife throwingsiegecorporationsirencloneexploding helicopterbullet timecrowtorso cut in halfsatellitestabbed in the handtimebombhead blown offmovie producersuper strengthnight visionselfishnessplane crashsuper powersraftbillboarddouble barreled shotgunbullet balletflarecameo appearancecrash landinggun actionsawed off shotgunfemale herocrashing through a windowgun duelhollywood signbitten in the neckswimming underwatersubmachine gunshot through the mouthcamcorderaspiring actressopen endedairfieldoverhead camera shotholesubterraneanfrenchmanglacierone woman armyflare gunfemale gunfighterexploding airplaneelevator shaftanti heroineglowing eyesarmoryhummerzombie attackreturning character with different actorexit woundloss of memoryjumping out a windowmegacorporationvideo diarybattle axesurprise during end creditssuper speedinvulnerabilitythrowing starhuman experimentationshurikenham radioocean linerred eyesbackflipchild uses a gunnight vision binocularselectro magnetic pulseknife in the headbungee jumpkilled by a propellerdestroyed citystorm drainresident evilamateur radiodistress signalknife in handamnesiaccamera shot from inside human bodyswimwhite room3d sequel to 2d filmsoselevator crashaustralian accentimplosionbullet dodgingabandoned prisonstop actionfalling elevatorimpaled through the headhoming devicecrash survivordialogue over end creditsknife in thighmutant dogold gloryextreme brutality (See All) |
A British Squad is sent on a training mission in the Highlands of Scotland against Special Operations squad. Ignoring the childish "campfire" stories heard about the area, they continue with their mission and come across the bloody remains of the Special Ops Squad, and a fierce howling is pitching t β¦he night sky... With two mortally wounded men, they make an escape, running into a zoologist by the name of Megan - who knows exactly what hunts them. What began as what they thought was a training mission turns into a battle for their lives against the most unlikely enemies they would have expected - werewolves. (Read More)
Subgenre: | cult filmindependent filmsurvival horrorbritish horror |
Themes: | deathdrunkennessself sacrifice |
Mood: | gore |
Locations: | foresthelicopterkitchenblood in car |
Characters: | soldierwarriorfemale scientist |
Story: | bitten in the throatintestineseaten alivekilling an animalsevered armaxecamerashot in the headshotgunblood splattersurprise endingexplosionblooddoggun β¦photographknifepistolfireshot to deathmachine gunshot in the chestpunched in the faceswordfalling from heightheld at gunpointdecapitationfoot chasenewspaperdeath of friendimpalementstabbed in the chesttied to a chairexploding carsevered headshot in the foreheadstabbed in the backknocked outskeletongiftbasementtrapshot in the armdismembermentwerewolfgrenadebulletinjurysevered handfull moonscotlandpunched in the stomachspecial forcesdisembowelmentwisecrack humorhealingstabbed in the eyemudshot through a windowblood on camera lensmolotov cocktailstandoffnight visionstabbed in the armclimbing through a windowflarecabin in the woodsmetamorphosisbritish armywalesgasexploding housesole survivorarm cut offtrapdoorbreaking through a doorshot through a doorgas explosionhead ripped offfalling through the floorthroat rippingsoccer fansilverglueplatoonhiding in a carbackpackerreference to little red riding hoodcampsitescottish highlandsjumping from a helicoptersuperglueancient swordtraining missionwerewolf family (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the β¦mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
Subgenre: | creature featuredark comedycult filmindependent filmblack comedyb moviepost apocalypseabsurdismdystopiasurvival horrorzombie apocalypseamerican horrorindependent horroritalian horrorzombie outbreak |
Themes: | monsterfearmurderdeathrevengesuicidekidnappingmoneypregnancyescapemilitaryrobberybrutalityparanoiasadism β¦executionexploitationpanicapocalypsecannibalismpolice brutalityhuntingmurder of a police officernear death experience (See All) |
Mood: | goresatirepoetic justicemurder of a boy |
Locations: | farmrestaurantcarhelicoptermotorcycleairplaneboatelevatorapartmenttruckrooftoppennsylvaniafire truck |
Characters: | policeafrican americanboyfriend girlfriend relationshipdoctorzombiesoldierpolice officerpolicemanpriesthostagetough guywarriorsecurity guardvillainprofessor β¦sniperpolice shootoutsexistpolice doghispanic americanhunting partymurder of a girl (See All) |
Period: | 1970s |
Story: | entrailsbitten in the throatintestinesmutationstabbed in the neckeaten alivesevered armaxescientistriflecamerashot in the headshotgunblood splattercorpse β¦surprise endingexplosionviolencebloodsequeldogbare chested maleguncigarette smokingphotographknifechasepistolfireshootoutbeatingarcade gameshot to deathfoodmachine gunshot in the chestrescuepunched in the facewatching tvwritten by directorbattleswordgunfightfalling from heightvomitingheld at gunpointsunglassessecond partbedlow budget filmrevolvertelevisioncombatkung fushot in the backsubjective cameradecapitationgood versus evilsurvivalgangambushmassacreambulancebasketballdeath of frienddrug dealerwomanmontagebridgefootballstabbed to deathtoiletstabbed in the chestexploding carsevered headnunradiohit by a carcontroversycreaturepolice officer killedvannews reportcigar smokingshot in the legshot in the foreheadracial slurtrainingone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backscreamingprotestsuburbperson on fireattackcharacter's point of view camera shotmoaningknocked outkicked in the facedeath of childtough girlbaseball batopening action scenebankscene during end creditsscarbasementdie hard scenariothreatened with a knifeshot in the armhandguncult directordismembermentundeadchild murderstylized violencehenchmanrioteyeglassesdisasterhand grenadecard gamesupermarketgrenadebow and arrowburned alivehead buttelectronic music scoremass murderlooking at oneself in a mirrormachetesociopathscene during opening creditshelmetdiseaseviruscowboy hatsecurity camerawalkie talkiehunterloss of loved onebeardhammerkicked in the stomachswat teamsevered handcovered in bloodgrindhouseend of the worldburialgun fuinterracial friendshipsocial commentarybikercannonfemale warriorgas maskthugredneckstealing a cartarget practiceu.s. armycrossbowdual wielditalian americancannibalmercilessnesspower outagechaosshot in the faceshopping mallm 16butcherpsychotronicescape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestice skatingdisembowelmentoutlawghettoinfectionaerial shotblood on shirtracistslaughtertough copdisfigurementknife throwingsiegegasolinephiladelphia pennsylvaniapolice raideye patchbody countdead boysevered legethnic slurdeath of loved oneburned to deathmoral dilemmamannequinmedia coveragefirefighterhit with a baseball batleather jacketdead girlbanditmexican americanblood on camera lensbad guyhysteriasidekickcandyliving deadhiding in a closetvomithead blown offepidemicspiral staircasegolf clubquick drawstolen moneyplaguebroken windowmallstabbed in the armclimbing through a windowgang violencefalling into waterflaskflaredepartment storeshot in the eyeanarchyhit by a trucksawed off shotgunhillbillymercy killingoffscreen killingbitten in the neckpiecheesen wordfriends who live togetherconsumerismdeath of boyfriendmoustacheperfumecar set on firedirector also cinematographerextreme violencemeteorflesh eating zombiegraphic violencemotorcycle gangrepeated linewalking deadairfieldoutlaw gangcrowbarpuerto ricanradio newsbloody violencehit with a hammerzombie violencevending machinesledgehammertommy gunbiker gangshot through a doorgang leaderhedonismshopping cartcalendardreadlockselevator shaftfamous linekicking in a doorgrindhouse filmsocial decayberetoutbreaktechno musiczombie attackmotorcycle with a sidecarlootingvinylice rinkhardware storejewelry storebandanabloody body of a childhelicopter pilotmacewrencharm ripped offrookie copdoomsdaynewscasterdecomposing bodysurprise during end creditsreanimationwheelbarrowbarricadedocksdinner dateharley davidsonheadbandsecret passagewayvideo arcadezombie childmartial lawjamaicancircular sawblowtorchphoto boothflesh eatinghangarpolice vigilantismblockadehousing projectgas grenadegolf ballham radioloss of boyfriendmidnight moviescalpingremadeabsurd violencenational guarddrive in classictire irongun storeanthropophagusmass deathtennis racketcontemplating suicidegory violencehorror movie remadezombificationsombrerotennis ballair ventbaseball glovehare krishnadumb policenewsroomhell on earthmorning sicknessleg ripped offderringergrowlingclaustrophobichordedeadly diseaseamateur radiogun shopstabbed in the eardouble child murderend of civilizationtelevision stationcomplainingevil nuncontemporary settingemergency broadcast systemright hand manfirearm pointed at the cameragang that lives togethermilitary jeepracist copbiker chickdereliction of dutysidecarpie fightscally capthompson gungroaningracket ballpropanebikersbitten in the armmorning starshort wave radioshot at the camerabattle cryshooting a childbitten in the leggearing uphelicopter landing padlooternewsboy capbiker womenknit capmass panicmilitary jacketabandoned shopping mallbald zombiebiker babelong haired bikermuzak (See All) |
The second chapter of the epic "Maze Runner" saga. Thomas (Dylan O'Brien) and his fellow Gladers face their greatest challenge yet: searching for clues about the mysterious and powerful organization known as WCKD. Their journey takes them to the Scorch, a desolate landscape filled with unimaginable β¦obstacles. Teaming up with resistance fighters, the Gladers take on WCKD's vastly superior forces and uncover its shocking plans for them all. (Read More)
Subgenre: | suspensepost apocalypsedystopiacyberpunk |
Themes: | feardeathmurderfriendshipsuicidekidnappingbetrayaltortureescapedeceptionmemoryparanoiasurveillanceunrequited lovehope β¦near death experience (See All) |
Locations: | helicopterdesertlaboratorytunnelairship |
Characters: | teenagerprostituteteenage boyzombiesoldierhostagetough guysnipersniper rifleevil doctor |
Period: | zip line |
Story: | telescopic rifleall terrain vehiclerunning for your lifecuresyringeinjectionscientistrifleshotguncorpsesurprise endingexplosionbloodviolencebased on novel β¦sequelflashbackbare chested malepartypistolfireshootoutbeatingshot to deathshot in the chestrescueslow motion scenepunched in the facebattlefalling from heightheld at gunpointbombsecond partrunninginterrogationhallucinationrevolvershot in the backsubjective cameragood versus evilsurvivalfoot chaseflashlightambushmassacremountaindeath of friendtied to a chairno opening creditsdream sequencedisarming someonedouble crosscreatureshot in the foreheadon the runelectrocutionfugitivecharacter's point of view camera shotrace against timetentknocked outtough girlshot in the shoulderscarexploding bodyratmercenaryobscene finger gestureak 47eavesdroppingmissilerevelationhead butthypodermic needlemachetediseaseviruswalkie talkiehidingsocial commentaryresistancepower outageshopping mallfalling to deaththunderstormjumping through a windowassault rifleinfectionblood on shirtcommandohologramcaptureraised middle fingerlasersightmoral dilemmagatling gunmale in showercrowdrugged drinkabandoned buildingreturning character killed offpickpocketcafeteriaepidemicyoung version of characterflasksmugglerhanging upside downsawed off shotgunreluctant herowhistlingravefight the systemcommando raidopen endeddistrusthuman experimentresistance fighterteenage heroevil corporationvinylmegacorporationdetonatorstun guncollapsing buildingstruck by lightningabandoned carsandstormbolt action rifledark futuresand dunebased on young adult noveluh 1 huey helicoptercity in ruinsair ventimmunitysuspension bridgebuilding demolitionhit with a metal pipecrawling through an air shaftlightning stormfalling down an elevator shaftelectric generatordestroyed bridgesleeping in the opencamp siteeye swollen shut (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
Subgenre: | creature featurecult filmblack comedysuspensesupernaturaltragedypunkfish out of watermonster movie |
Themes: | monsterfeardeathmurderfriendshiprevengesurrealismescapevoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness β¦murder of a police officermurder of family (See All) |
Mood: | goresatirenightmaremurder of a boy |
Locations: | taxi driverhospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtruck β¦laboratorysex in shower (See All) |
Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
Period: | 1980s |
Story: | eaten aliveanimal attacksheeppublic nuditytransformationanimal in titleriflebare buttcar accidentblood splattercorpsesurprise endingmale rear nuditymale nudityviolence β¦bloodsexfemale nuditynuditybare breastsfemale frontal nuditymale frontal nuditydogbare chested malesex scenefemale rear nuditycigarette smokingknifechaseshowertopless female nuditydreamshot to deathmachine gunshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedplace name in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reportfive word titleracial slurlegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodcoitushitchhikerhitchhikingrealityindianfull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
Set in futuristic Metro City, Astro Boy is about a young robot with incredible powers created by a brilliant scientist in the image of the son he has lost. Unable to fulfill the grieving man's expectations, our hero embarks on a journey in search of acceptance, experiencing betrayal and a netherworl β¦d of robot gladiators, before he returns to save Metro City and reconcile with the father who had rejected him. (Read More)
Subgenre: | coming of agesuperherocomputer animationslapstick comedyfuturisticcgi animationchrist allegory |
Themes: | monsterbetrayalpoliticsescapedeceptionmilitarysupernatural powerhopecourageself sacrificenear death experienceartificial intelligenceunlikely heroutopiarobotics |
Mood: | high schoolpoetic justice |
Locations: | taxi driverairplanetaxirooftoplaboratoryfuture city |
Characters: | father son relationshipteenagerteenage girlteenage boysoldierwarrioraction heroprofessorsingle fatherengineer |
Period: | future |
Story: | wilhelm screamdeoxyribonucleic acidexperiment gone wrongpresumed deadsevered armtransformationaxescientistcar accidentcell phonesurprise endingexplosioncharacter name in titletwo word titlebare chested male β¦title spoken by characterchasebeatingmachine gunrescuewritten by directorbattlearrestsecretfalling from heightshowdownheld at gunpointcar crashrobotsciencecombatsubjective cameradecapitationgood versus evilorphanbased on comic bookambushmountainmontagearmyexploding carsevered headno opening creditschild in perildouble crosscreaturemarriage proposalon the runone against manybased on tv serieselectrocutionbased on mangafugitivecharacter's point of view camera shotevil manknocked outdeath of childpresidenthigh school studentexploding bodydeath of sonelectiongeneralsingle parentpizzachainsawmissiledestinyteen angstdestructionrevelationflyingloss of loved oneexploding buildinggiantservantpress conferencejumping from heightlasercompassioncrushed to deathsocial commentaryback from the deadandroidcannonfull moonrampagestealing a carbraverycrossbowcynicismfight to the deathloss of soninventormanhuntpower outage3 dimensionalresurrectionevacuationbutler3dhologramcapturelonerstadiumdeath of loved oneflamethrowertracking devicesatelliteheroismgiant robotfinal showdownoutcastpickpockettaserhigh school teacherjunkyardsuper strengthgiant monstergolf clubdronecomic reliefskyscraperidealismbased on cartoon13 year oldshot in the eyecrash landingarenabaseball capcrashing through a windowloss of childilliteracycorrupt politicianbased on animefinal battletrampolinefeatherhigh techopen endedrepeated linegladiatorfreedom fighterspray paintforce fieldvillain arrestedx rayed skeletonfictional citykiller robotbanishmentstun gunsuper speedintegrityorigin of heroflying carcollapsing buildingleonardo da vincicircular sawgiant creatureorbteenage superherooutrunning explosionelectromagnetic pulsespherefighting in the airhome schoolingrobot as menacerobot as pathosboy geniusfuturistic citydeathmatchflying robotrobot dogscience classx ray visioncrushed carsecret hideoutelectromagnetismstashabsorbing powerfuturistic trainsight gagfloating citysuper hearingcharacter shaped hole (See All) |
In a dystopian near future, humanity has been ravaged by a mysterious fungal disease. The afflicted are robbed of all free will and turned into flesh-eating 'hungries'. Humankind's only hope is a small group of hybrid children who crave human flesh but retain the ability to think and feel. The child β¦ren go to school at an army base in rural Britain, where they're subjected to cruel experiments by Dr. Caroline Caldwell (Glenn Close). School teacher Helen Justineau (Gemma Arterton) grows particularly close to an exceptional girl named Melanie (Sennia Nanua), thus forming a special bond. But when the base is invaded, the trio escape with the assistance of Sgt. Eddie Parks (Paddy Considine) and embark on a perilous journey of survival, during which Melanie must come to terms with who she is. (Read More)
Subgenre: | independent filmcoming of agesuspensepost apocalypsedystopiasurvival horrorzombie apocalypse |
Themes: | feardeathmurderkidnappingescapedanceexperimentaldeceptionmilitaryparanoiahopepanicapocalypsecannibalismnear death experience β¦evolutiongreek mythology (See All) |
Mood: | gorenightdarknessmurder suicide |
Locations: | hospitalschoolforestlondon englandwaterwoodswheelchairrooftoplaboratoryschool teacher |
Characters: | doctorchildrenfemale protagonistteacherzombiesoldiernursedancerhostagelittle girlteacher student relationshipamerican abroadself mutilationfemale scientistzombie girl |
Story: | wilhelm screamantidotecuremutationeaten alivemutantsevered arminjectiontransformationscientistshot in the headblood splattercorpsesurprise endingblood β¦violencebased on noveldogknifechasepistolfirebeatingshot to deathfoodmachine gunshot in the chestrescueslow motion scenecatbattleheld at gunpointhandcuffsbritishrivercombatshot in the backf wordsurvivalorphanflashlightambushmassacreprisonertied to a chairno opening creditsdisarming someonechild in perilfictional warcreaturevanshot in the foreheadbinocularscharacter repeating someone else's dialoguebeaten to deathdangerscreamingproduct placementstorytellingrace against timeknocked outbaseball batlong takegiftthreatdarkhauntingratsix word titleclasssilencerundeadexperimentidentityundergroundhand grenadehypodermic needlediseaseviruswalkie talkiesergeantplanetdesperationparking garagepuzzlesocial commentarygas maskreverse footagetensionchild's point of viewblood on facefight to the deathcannibalchild protagonistconvenience storeshot in the faceassault rifleinfectionaerial shotshadowblood on shirtfemale doctorbody countexistentialismsevered legpigeonmoral dilemmabrainplantimprisonmenthit with a baseball batfemale soldierliving deadface maskfire extinguisherfemale teacherarmored cartowerreading aloudabandoned housebunkerredheaded womanhit by a truckmilitary basewormmercy killingbitten in the neckbritish armykiller childflesh eating zombiecelldistrustriddlepsychotronic filmcut handanimal killingarmy basestupid victimoutbreakchild with a gundecomposing bodyscreenplay adapted by authorexaminationbandaged handvaccinezombie childwoman in uniformyoung girlhazmat suitbitten on the armchild murdererpandemicstudent teacher relationshipchild murders a childhybridblack britishwater bottlehand woundcaseabandoned hospitalcamouflage uniformpodfilm with ambiguous titleinfectedferal childarm woundhordeabandoned cityend of civilizationspiralbitten by a zombiechild killing an adultgender in titlematchsticksmellfunguschild murders an adultblood poisoninggifted childheartbreakingopening creditspathogenreference to pandora's boxstrapped to a tablereference to prometheuswhite saviorarmy bunkerabandoned librarychild kills mansporeeating a catreference to pandorawhitewashing (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | creature featurecult filmblack comedysuspensepost apocalypsezombie apocalypseamerican horrorsadistic horrorzombie outbreakfrench horrorcanadian horror |
Themes: | fearmurderdeathsuicideracismbrutalitysadismgreedapocalypsecannibalism |
Mood: | goredarknessblood and goresequel to cult horror |
Locations: | urban settingcitytruckgas station |
Characters: | african americanprostitutezombievillain |
Period: | 1990syear 1995 |
Story: | bitten handbitten in the throatsevered footeaten aliveshot in the headcar accidentblood splattercorpseexplosionviolencebloodfemale nuditysequellesbian kisspistol β¦shootoutshot to deathmachine gunshot in the chestrescuearrestshootingdead bodyjailriverdecapitationdeath of friendexploding carsevered headdouble crossshot in the legshot in the foreheadracial slurlimousineperson on fireelectrocutionkicked in the faceshot in the shoulderexploding bodyratmercenaryshot in the armcult directordismembermentundeadblood spatterarsonsplatterdisasterhead buttmachetevirusfourth partassaultsevered handskateboardrocket launcherend of the worldback from the deadsevered fingerfight to the deathgash in the faceshopping mallbutcherexploding headdisembowelmentracistsiegesevered legethnic slursequel to cult favoritetorso cut in halfmexican americanbad guybeheadingliving deadkillgun in mouthskyscraperslashingfortressshot in the eyemeat cleaverburnt bodyshot through the mouthextreme violenceshot in the throatflesh eating zombiegraphic violencewalking deadbloody violenceburn victimshot in the crotchbutcheryevil clownbody partoutbreakzombie attackpittsburgh pennsylvaniastairwellliquor storehung upside downdoomsdayauto theftsliced in twofireworklawnmowerbodily dismembermentflesh eatingdisturbingevil deadanthropophagusgory violencespear guneast coastzombificationgruesomehell on earthman eaterbody partsblown to piecesdrawbridgezombie biteabandoned citydeadly diseasebrutalmonster as victimhole through torsopiercing ripped outthrowbackzombie with gunzombie invasionzombie clown (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo β¦rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
Subgenre: | martial artspost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsezombie survival |
Themes: | monsterdeathmurderrevengekidnappingtortureescapemilitarysupernatural powersurveillancecannibalismself sacrificeartificial intelligence |
Mood: | goreraincar chase |
Locations: | helicoptersnowmotorcycleairplanetaxielevatorshiprooftoplaboratorysubmarinecar explosioncar motorcycle chasemotorcycle accidentairshiphelicopter explosion β¦airplane explosiontruck explosion (See All) |
Characters: | female protagonistzombiesoldierhostagetough guywarrioraction herodeafnessex police officer |
Story: | running for your lifegenetic engineeringmutationeaten alivemutantsyringeinjectionaxeshot in the headshotguncar accidentblood splattersurprise endingexplosionviolence β¦bloodfemale nuditysequelflashbackfightknifechasethree word titlepistolshootoutshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facecomputerbattlegunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashinterrogationcombatshot in the backsurvivalfoot chaseassassinstrangulationarmyimpalementcolon in titlemixed martial artssubwaymappart of serieschild in perilhit by a carunderwater scenecreatureshot in the legshot in the foreheadone against manysuburbumbrellamissionproduct placementrace against timekicked in the facetough girlbaseball batstreet shootoutshot in the shoulderexploding bodydie hard scenariocharacter says i love youunderwaterthreatened with a knifemercenaryshot in the armbattlefieldwashington d.c.stylized violencechainsawexperimenteyeglassesiceundergroundhand grenadeheroinehypodermic needlecatfightred dressdiseasevirussecurity camerakicked in the stomachwristwatchgiantmind controllaserrocket launcherend of the worldaction heroinemexican standofftowelwhite housegun fucrushed to deathfemale warriorgas masktokyo japanfloodexplosiveresistancedual wieldbased on video gamepower outageshot in the facespecial forces3dpunched in the chestairplane crashinfectioncommandohologramone dayalternate realitybulletproof vestcorporationrescue missionchainfifth partclonesign languagebullet timemoscow russiatracking devicehit with a baseball batclose up of eyesfemale assassindesert eaglefemale soldierblood on camera lensreturning character killed offhiding in a closettimebombfemale fighterarmored carsuper strengthgiant monsterplaguecommando unithelicopter crashhit by a truckcommando missionfemale herobitten in the necksubmachine guntimes square manhattan new york cityfilmed killingflesh eating zombieopen endedparasitewalking deadwoman fights a mansubterraneanone woman armyfemale gunfightervillain not really dead clichescience runs amokevil corporationx rayed skeletonknife held to throatfemale antagonistnew york city new yorkstarts with narrationtime bombmegacorporationcorporate crimesuper speedbiological weaponcrushed by a carinvulnerabilitygiant creaturepandemicsuper computerassembly linewashington monumentfalling through icegrappling hookwoman with a gunbad actingexposed brainbuilding explosioncar flipdeaf childresident evilfighting the systemlaser cutterhouse explosionunderwater explosionbio weaponbrainwashdeaf girlcar hit by a truckfalling to one's deathmutant creaturereverse motionflesh eaterunderground laboratoryformer agentvehicular accidentcomputer controlverticle take off and landing aircraftraccoon cityflying creaturekamchatka (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | creature featureindependent filmmartial artssuspensepost apocalypsedystopiasurvival horror |
Themes: | fearmurderdeathsuicidebetrayalescapedeceptionnaturebrutalitysadismsurveillanceexecutionpaniccannibalismcourage β¦self sacrificenear death experiencestarvation (See All) |
Mood: | gorenightmaredarknesssavage |
Locations: | farmhelicoptersnowwatertunnel |
Characters: | husband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagetough guywarrioraction herointerracial relationshiplittle boysecurity guardengineerex soldier |
Period: | futurewinternear future |
Story: | stabbed in the neckeaten alivemutantrabbitaxerifleshot in the headshotgunblood splattercorpsesurprise endingexplosionviolencebloodflashback β¦two word titlegunkissfighttitle spoken by characterknifechasepistolfirevoice over narrationshootoutbeatingdreamshot to deathfistfightfoodshot in the chestrescueslow motion scenepunched in the facewritten by directorbattlegunfightbrawlfalling from heightshootingshowdownheld at gunpointhand to hand combatdead bodyhandcuffsrevolvercombatshot in the backf worddecapitationgood versus evilsurvivalfoot chaseorphanflashlightambushthroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headdream sequenceanti herodisarming someonecreaturesearchshot in the legshot in the foreheadattempted murderbeaten to deathdangerstabbed in the backscreamingkeyfactorymissionrace against timetough girlshot in the shoulderpursuitexploding bodydeath of sonthreatlaptopthreatened with a knifechickenprofanitydismembermentblood spatterchessiceundergroundhead buttspearmachetesurvivordiseasevirussecurity camerabeardmagazineexploding buildingkicked in the stomachladderbald manfemale warriorculturereverse footagehaunted by the pasttensionexplosivebraveryfight to the deathstabbed in the throatcannibalmanhuntmercilessnesspower outagemutehungerbutcherenvironmentalstabbed in the headcigarette lighterenvironmental issuestabbed in the legdynamiteinfectionknife fightdark pastlens flareaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefinal showdownfemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorstabbed in the shoulderbullet woundsole black character dies clichequarantinetragic pastintergenerational friendshippsychotronic filmbreaking through a doorcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudsfrozen bodycollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All) |