Please wait - finding best movies...
In this sequel to "47 Ronin," a new class of warriors emerges among the Samurai clans to keep a sought-after sword from falling into the wrong hands.
| Subgenre: | conspiracy |
| Themes: | samurairedemptionmagichero |
| Characters: | villain |
| Story: | sword fightingbased on legendsword fightuncertain futuredirect to videomodern dayleavethoughtroninshogunhandsyoung womankillkatanalow budget …couplelegendweaponarmyfightingsecond partswordsequelfight (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga …to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
| Subgenre: | conspiracytragedysword and sorceryepicdark fantasysword and fantasy |
| Themes: | samurairedemptionmagicmurderdeathrevengesurrealismsuicidekidnappingghostescapeweddingmonsterdeceptiondeath of father …supernatural powerunrequited loveritual suicide (See All) |
| Locations: | forestsnowcemeteryvillagewoodsjapanlakeshipcastlecampfire |
| Characters: | husband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guywarrioraction heroteacher student relationshipwitchself mutilationsamurai swordhuman versus monstersamurai warriorhunting party |
| Story: | based on legendsword fightshogunroninlegendarmyswordnumber in titlebloodviolenceflashbackbare chested maletitle spoken by characterexplosionknife …chasesurprise endingbased on true storyfirebeatingcorpsedigit in titleshot to deathblood splatterhorseshot in the chestshot in the headrescuebattleshowdowndemoncombatshot in the backdecapitationfoot chaseorphancandleambushaxemassacremountaindisguisethroat slittingimpalementstabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacestabbed in the backprologueperson on fireattackpoisondragonmanipulationexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagebattlefieldstylized violencebow and arrowburned alivespearheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadguardarranged marriagecrossbowfight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingsword dueltragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offarchermusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All) |
A group of idealistic young men, determined to clean up the corruption in their town, are aided by a scruffy, cynical samurai who does not at all fit their concept of a noble warrior.
| Subgenre: | conspiracycult filmdark comedy |
| Themes: | samuraicorruptionbrutalityevil |
| Mood: | satire |
| Locations: | small townjapan |
| Characters: | warriorsamurai warrior |
| Story: | sword fightroninkatanafightingsecond partfightsequelcharacter name in titlebased on novelviolenceblood splatterrescuebrawlshowdownhand to hand combat …mansionanti herodouble crossduelone against manymercenaryflowereavesdroppingloyaltybarncaptivetemplechop sockykatana swordblack and whiteextortionsword dueluncleauntfightershrineinfiltrationman with no namestreampower struggledojomercyjidai gekiclanpacifismfeudal japangame of gowipeblack and white film (See All) |
Blind Zatoichi makes his living by gambling and giving massages. But behind his humble facade, Zatoichi is a master swordsman, gifted with lightning-fast draw and strokes of breathtaking precision. Zatoichi wanders into a town run by sinister gangs and a powerful samurai. He's destined for violent s …howdowns when he stumbles on two beautiful geishas avenging their parents' murder... Duels, wit and a touch of zen! Cult anti-hero Zatoichi is back in a sword-fighting adventure written, directed and starring Takeshi Kitano. (Read More)
| Subgenre: | martial artscult film |
| Themes: | samuraiheromurderdeathrevengesuicidedrinkingescapedancememorybrutalityblackmailgamblingmental illnesstransgender …blindness (See All) |
| Mood: | gorerainnightdarkness |
| Locations: | beachrestaurantforestvillagejapanbrotheltownbar keeper |
| Characters: | tattoobrother sister relationshipprostitutedancerlittle boydirectoraunt nephew relationshipwriter directortattoo on backblonde asian |
| Period: | 19th century |
| Story: | sword fightingsword fightroninfightingswordsexcharacter name in titlebased on novelbloodmale nudityviolenceone word titleflashbackbare chested malegun …dancingpistolbeatingcorpseshot to deathblood splattershot in the chestremakeslow motion scenepunched in the faceshowdowndead bodyrevolvercriminalgood versus evilorphanwinecandlegangambushold manstrangulationmassacremountainstabbingbridgestabbed to deathstabbed in the chestnonlinear timelinecultone man armyold womantrainingduelattempted murderone against manytreestabbed in the backwritten and directed by cast membermassageninjalightningdirected by starbodyguardtragic eventneck breakingratstagemurderermercenarysevered armcult directorcross dressingfreeze framegamedressmass murderheavy rainstabbed in the stomachenemyaccidental deathmobsevered handcovered in blooddead womanthugrampagesevered fingerkatana swordfight to the deathstabbed in the throatthunderstormstabbed in the leghit on the headbathingaccidental killinghot tubeye gougingslaughteryakuzadisfigurementbetcaneblind manbody countlanternextortionbloodbathframed for murderchallengeblindmob bosspractical jokeswordsmanstabbed in the handgang warchild molestationaloneeditorslashinggang violenceblood stainhead bashed intavernembassydripping bloodfinger cut offkimonotransvestismstabbed in the shoulderbleeding to deathgame playingpool of bloodgang memberdiceoff screen murdergang leadermob violencecut handburning buildingtap dancingdead woman on floorman in dragno endingandrogynychopping woodknife in the chestmasseurstabbed multiple timeschopstickshand cut offstabbed in the sidechild prostitutionmass killinggeishajidai gekicrossdresserdead woman on groundbuilding on fireelderly womanstabbed in the heartfake bloodfast drawmutilated corpsedeath by impalementblood on the floorkilled with a swordstabbed through the chestaccidental murderdouble impalementtap danceelderly manrice fieldrival gangbody mutilationdry humorstringreflection in watercult favoriteeyes different coloredo periodtattooed manmultiple stabbingssliding doorsevered thumbsword throwingdeath by swordlimb shot offbroken footbroken swordwalking with a canerain fightfeeding an animalzatoichibreaking someone's neckmountain villagesick womancane swordwoman with long hairbeating with a stickblind swordsmaneye cut outeye slittingrice winesevered extremitystabbed in the testicles (See All) |
An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t …o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)
| Subgenre: | martial artscoming of agewuxia |
| Themes: | heromurderrevengedrunkennessrobberytime travelvengeancephilosophy |
| Locations: | forestdesertvillagerooftopcavechinacampfire |
| Characters: | villainteenagertough guywarrioraction herobullywitchamerican |
| Story: | sword fightkatanalegendweaponfightingswordfightbased on novelbloodviolenceflashbacktitle spoken by characterchasebeatingdream …fistfighthorseshot in the chesturinationbattlebrawlfalling from heightshootingshowdownhand to hand combatcombatkung fushot in the backorphanflashlightwinestrangulationmountainambulancestabbingmixed martial artsbirddisarming someoneduelkaratestatuemartial artistwaterfallwhippingstylized violencemartial arts masterbow and arrowspearquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopswordsmanalleyhairparkourshot with an arrowarcherywelldrumparamedicartifactpotionresponsibilitypawnshopinnmiddle ageswarlordbo staffcavalrystaffrelicwu shusecret loveshot with a bow and arrowslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneoutnumberedprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All) |
Young Danny Madigan is a big fan of Jack Slater, a larger-than-life action hero played by Arnold Schwarzenegger. When his best friend, Nick the projectionist, gives him a magic ticket to the new Jack Slater film, Danny is transported into Slater's world, where the good guys always win. One of Slater …'s enemies, Benedict the hitman, gets hold of the ticket and ends up in Danny's world, where he realises that if he can kill Schwarzenegger, Slater will be no more. Slater and Danny must travel back and stop him. (Read More)
| Subgenre: | martial artscult filmblack comedyb movie |
| Themes: | magicheromurderdeathlovefuneralgangsterpsychopathmafiainsanityhome invasionmurder of a police officer |
| Mood: | satirespoofcar chasebreaking the fourth wallself parody |
| Locations: | new york cityhelicopterlos angeles californiataxitruck |
| Characters: | villainfamily relationshipspolicemother son relationshipfather daughter relationshipserial killertough guywarrioraction herosingle motherkillerself referential |
| Period: | 1990s20th centuryyear 1993 |
| Story: | sword fightkillweaponswordfightviolenceflashbackkisschasethree word titlecell phoneshootoutbeatingcorpseshot to death …fistfightshot in the chestblondeface slapshot in the headpunched in the facegunfightbrawlfalling from heightshowdownheld at gunpointsunglassescar crashdead bodyhandcuffsmanhattan new york citycriminalshot in the backgangold manaxemansionwomanexploding carno opening creditschild in perildouble crosscigar smokingtheaterattempted murderelectrocutionfantasy sequencestatueevil mantough girlopening action scenefilm within a filmexploding bodydeath of sonneck breakingmurdererdie hard scenariothreatened with a knifecinemasemiautomatic pistolkillingredheadcorrupt cophenchmanmaniacactor playing himselfuzilifting someone into the airmobstermovie theaterclassical musicmexican standoffgun fudinosaurmovie theatrecameoswitchbladestealing a carchild's point of viewdark humorkicked in the crotchfather figureblack and white scenestabbed in the legdynamiteghettodeceithealingbulletproof vesttough coplasersightexploding helicoptergatling gunpsycho killerdesert eaglepsychopathic killerbad guymadmancartoon on tvstereotypehuman monstervideo storetwo man armyhomicidal maniacgang violenceno title at beginningcameo appearancestuntshot in the eyeexploding truckhollywood signman punching a womanpunmaverick coptimes square manhattan new york cityexploding housefart jokegrim reapercartoon catmass murdererkicking in a doorpremature ejaculationkicked in the groinactress playing herselfticketbullet proof vest555 phone numberdeja vumovie posterchild with a gunfalling off a roofjumping from a rooftopmushroom cloudsharpshooterprojectionistfilm premieremovie referencemovie premierecult movie castdobermancraneglass eyesame actor playing two charactersactor playing dual rolechild driving a caraxe murdererairbagthrown through a wallhandcuffed to a pipetwentieth centurywhite suitmagical objectsame actor playing two characters simultaneously on screenactor talks to audiencemovie reality crossovertarworried motherattempted child murdercartoon reality crossoverbreaking a glass windowlos angeles storm draindriving through a wallcartoon characterfictional characterknife in the thighhand slapplaying chickenhowie screamspinning axeinvisible barrierlife imitates artroaringla brea tar pitt 1000nun with a gunactor meets characterboy sidekickpunching through a car window (See All) |
Returning home with his father after a shopping expedition, Wong Fei-Hong is unwittingly caught up in the battle between foreigners who wish to export ancient Chinese artifacts and loyalists who don't want the pieces to leave the country. Fei-Hong has learned a style of fighting called "Drunken Boxi …ng", which makes him a dangerous person to cross. Unfortunately, his father is opposed to his engaging in any kind of fighting, let alone drunken boxing. Consequently, Fei-Hong not only has to fight against the foreigners, but he must overcome his father's antagonism as well. (Read More)
| Subgenre: | martial artscult filmslapstickslapstick comedy |
| Themes: | herofriendshiprevengedrunkennessphilosophy |
| Locations: | train |
| Characters: | father son relationshiptough guywarrioraction heroalcoholicchinesefatherhomeless manparent child relationshipstepmother stepson relationshipasian girlchinese girl |
| Period: | 1920s |
| Story: | sword fightleavelegendfightingswordfightsequelbloodviolenceknifefistfightbattlebrawlshowdownhand to hand combat …alcoholcombatkung fugood versus evilambushdeath of friendboxingsnakecultdisarming someoneone man armyduelone against manyperson on firemartial artistcountrysidestylized violencemartial arts masterloyaltyquestassaultasian womanhomechop sockyshoppingmeditationsequel to cult favoritemahjongstick fightkung fu fightingbloopers during creditskung fu classickung fu masterfemale fighterparkourold ladydrunkardembassytrain ridemasteracrobatreturning homebo staffacrobaticsstrong femaletramptraining montagestrong womanchinese womanchinese culturesteel millwoman fights manman woman fightbritish embassychinese dressstolen artifact (See All) |
In 1844, the peace of Feudal Japan is threatened by cruel Lord Naritsugu Matsudaira, who is politically rising and getting closer to his half-brother, the shogun. After the harakiri of the Namiya clan leader, samurai Shinzaemon Shimada is summoned by the shogun's advisor Sir Doi of the Akashi Clan t …o listen to the tragedy of Makino Uneme, whose son and daughter-in-law have been murdered by Naritsugu. Then Sir Doi shows a woman with arms, legs and tongue severed by Naritsugu and she writes with her forearm a request to Shinza to slaughter Naritsugu and his samurai. Shinza promises to kill Naritsugu and he gathers eleven other samurais and plots a plan to attack Naritsugu in his trip back to the Akashi land. But the cunning samurai Hanbei Kitou that is responsible for the security of his master foresees Shinza's intent. Shinza decides to go with his samurai through the mountain, where they find the hunter Koyata that guides them off the mountain and joins the group. Now the thirteen men prepare an ambush to Naritsugu and his army of two hundred samurai in a suicide mission to stop evil. (Read More)
| Subgenre: | martial arts |
| Themes: | samuraideathsuicidegambling |
| Mood: | gore |
| Locations: | villagejapanrooftopbrothel |
| Characters: | warriorjapanesesamurai swordsamurai warrior |
| Period: | future19th century1840s |
| Story: | sword fightshogunroninkillkatanaarmynumber in titlebloodviolenceexplosionblood splatterremakebattleshowdownhand to hand combat …combatkung fudecapitationassassinmassacrestabbingstabbed to deathstabbed in the chestsevered headassassinationfishingduelstabbed in the backmissionrabbittrapwaterfallbattlefieldloyaltybow and arrowspearstabbed in the stomachhunterhonorchop sockyexplosivekatana swordimmortalityfilm setbooby trapmurder of a childsword duelstick fightmudbeheadingswordsmankendoset upshot with an arrowamputeefilm starts with texttyrantkimonoslingshotimmortalguideimmolationassassination plotshot with a bow and arrowends with textdojoalternate versionjumping from a rooftoppolitical assassinationlordbuilding collapseemaciationjidai gekiflesh eatingbordellosuicide missionrecruitingbloody sprayhara kiriseppukuwading in watermultiple versionscode of honornumber 13 in titlecat housesheathbonsai treefalling into mudnon humansamurai eraforeign versionmultiple amputeerunning on roofyear 1844 (See All) |
In New York, the owner of a sophisticated antique shop Russell Edwin Nash is challenged to a sword fight in the parking lot of the Madison Square Garden by a man called Iman Fasil that is beheaded by Russell. He hides his sword and is arrested by the police while leaving the stadium. Russell recalls … his life in the Sixteenth Century in Scotland, when he is Connor MacLeod and is deadly wounded in a battle against another Clan. However he surprisingly survives and his Clan believes he has a pact with the devil and expels him from their lands. Then he meets Juan Sanchez Villa-Lobos Ramirez that explains that he is immortal unless he is beheaded. Further, the immortals dispute a game killing each other and in the end only one survives receiving a price with the power of the other immortals. Russell is released by the police, but the snoopy forensic agent Brenda J. Wyatt is attracted by the case since she founds fragments of an ancient Katana and follows Russell. But the also immortal Kurgan is hunting down MacLeod and Brenda is in the middle of their battle. (Read More)
| Subgenre: | martial artscult filmdark comedysword and sorcerydark fantasysword and fantasy |
| Themes: | magicheromurderdeathlovefriendshipkidnappingrapetortureinvestigationmemorysupernatural powerwrestling |
| Mood: | gorerain |
| Locations: | hospitalnew york citybarbeachchurchforesthotelhelicoptersnowboatvillagewoodspolice stationpolice carlake …castleamerica (See All) |
| Characters: | policeboyfriend girlfriend relationshipprostitutepolice officerdetectivephotographertough guywarrioraction herolittle girlpolice detectiveteacher student relationshipgermanamerican …police arrest (See All) |
| Period: | world war two1980s1940s16th century1500s |
| Story: | sword fightingsword fightkatanaweaponarmyswordfightsexnuditybloodviolenceone word titleflashbackkissphotograph …title spoken by charactersingingcryingbeatingcorpsefistfightmachine gunhorseblondepunched in the facewatching tvcomputercamerabattlebrawlmaskshootingpaintingshowdownheld at gunpointtearsrunningrock musicinterrogationhandcuffsrevolvermanhattan new york citycombatreporterdecapitationgood versus evilgay slurflashlightcandlestabbingbridgemixed martial artsfishnunanimaldisarming someoneone man armypart of seriesfictional warbartendertrainingduelelectrocutionbuxomevil manlightningtankopening action scenescreamfirst partkissing while having sexpubnewspaper headlinebattlefieldpoweruzientertainmentdestructionwoundgothictape recordercomic bookhelmetloss of loved onebuttockstimeaudienceknightparking garagehonorpromiseshieldthunderkatana swordold agescotlandzoopsychotronicimmortalityrowboatmentoraquariumdark herolionsuperstitionevidencetribesword dueltragic herobonfirereckless drivingdaggerwrestlershaved headrefereeparking lotshowpetenergyswordsmansunsethistorical fictionalleykendotelling someone to shut upfortressfencinglatinarenakindnesspressaudio cassettemonitorhead cut offdocumentmicroscopefemale coprepeated lineboxing ringimmortaladopted daughterantiquehorse and wagoniconbagpipesvalleymortalitychrysler building manhattan new york citymentor protege relationshipex marinescottishflintlock pistolsexual intercoursebanishmentbattle axewrestling matchmetropolisspectatorforceannouncerkiltprocessionwrestling ringrudenessbannerpracticeclanover the topgeeseelknewsstandalley fighthorsebackreference to mozartrapierhorseshoesiren the alarmlong swordhighlandscitadeloxenhighlandercar collisionstone bridge1530scentury1540s (See All) |
A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w …hen 40 bandits attack the village. (Read More)
| Subgenre: | martial artscult filmepiccult classic |
| Themes: | samuraiherodeathlovefriendshiprevengesuicidefeardrunkennessdeceptionangergriefhopedeath of wifepanic …falling in lovecouragestarvation (See All) |
| Mood: | rain |
| Locations: | forestvillagejapanfarmcampfiretown |
| Characters: | husband wife relationshipfather daughter relationshipchildrenhostagethieftough guywarrioraction heroold friendcrying babysamurai swordsamurai warrior |
| Period: | 16th century |
| Story: | sword fightroninkatanaswordnumber in titleviolencemale rear nuditybare chested malegunkisssingingchasefireshot to deathhorse …slow motion scenebattlesecretshowdownriflehand to hand combatrivercombatorphanold manprisonermapdisarming someonefishingchild in perilold womantrainingduelfarmerhorse ridingpremarital sextied upmercenarywaterfallflowerlove interestclass differencesarsonbattlefieldbow and arrowspearhappinessmale bondingcrying womanforbidden lovefollowing someonehonorcrying manburialmoralitycelebrationsufferingkatana swordmisunderstandinghungerdespairensemble castyoung lovearmorsiegeblind mantragic herostick fightmoral dilemmacrowdmudtombbanditswordsmanpeasantkendostrategyassumed identitystandofffencingoffscreen killingilliteracyhumormusketvictorybo staffhouse on firevillagerhillman with no namehostage situationstraight razorshot with a bow and arrowharvestlootingflintlock rifleweepingchopping woodricekneelingmoral ambiguitybarricadebarefoot womansicklejidai gekilong black hairstabbed with a swordmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshipsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoritestabbed with a spearweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
| Subgenre: | martial artscult filmsword and sorceryepicswashbucklersword and fantasy |
| Themes: | magicheromonstercouragemythology |
| Locations: | castle |
| Characters: | soldiertough guywarrior |
| Story: | sword fightingarmyfightingswordfightcharacter name in titlebased on novelone word titlebased on bookhorsebattlesecrethand to hand combatdemoncombat …subjective cameragood versus evilambushdeath of friendmixed martial artsdisarming someonefictional warkingdueldragonbattlefieldbow and arrowspearegghunterknightdwarfwizardsiegekingdomsword dueltragic herodaggerstick fightelfheroismadventure herofantasy worldsword and sandalopen endedchosen onestaffteenage heroshot with a bow and arrowfictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
In ancient China, before the reign of the first emperor, warring factions throughout the Six Kingdoms plot to assassinate the most powerful ruler, Qin. When a minor official defeats Qin's three principal enemies, he is summoned to the palace to tell Qin the story of his surprising victory.
| Subgenre: | martial artsepicchrist allegorywuxia |
| Themes: | redemptionherolovefriendshipsurrealismsuicideinfidelitybetrayaljealousyfuneraldeceptionexecutionhopevengeancecourage …self sacrifice (See All) |
| Locations: | schooldesertlakechina |
| Characters: | tough guywarrioraction hero |
| Story: | sword fightlegendarmyfightingswordfightbloodviolenceflashbackmale rear nuditybare chested malesurprise endingvoice over narrationshot in the chestshot in the head …slow motion scenebattleshowdownhand to hand combatcombatorphanassassincandlestabbed in the chestone man armyritualkingshot in the legtrainingduelone against manylibrarystabbed in the backkicked in the facepremarital sexstylized violenceflyingspearassassination attempttold in flashbackfaked deathhonorcompassionchop sockyfemale killersocial commentarydeath of protagonistrainstormsword dueltragic heroarrowmain character diespalacefemale assassinheroismswordsmanlocal blockbusterlost lovetrue lovearcheryidealismfilm starts with textheritagetyrantkindnessresponsibilityrespectredescorttragic lovegreendeath of title characterpatriotundressing someoneflashback within a flashbackman with no namewu shurewardbluemale full back nuditynameless charactercalligraphywuxia fictionancient chinaunreliable narratordouble impalementwarrior womanwalking on waterbody searchunreliable flashbackunreliable narrationthrone roomcolor motif (See All) |
The Legendary Zorro goes off on another adventure to protect the future of California and its citizens. This time, he fights against evil-doers with the help of his beautiful wife, Elena, and their precocious young son, Joaquin. Alejandro De LaVega is torn between two worlds: his life as Zorro and h …is life as a family man. After Alejandro once again breaks his promise to stop wearing the mask, Elena leaves him, and soon begins seeing Armand, a haughty French Count. But a mysterious explosion in the desert leads Zorro to believe that there's more to Armand than meets the eye, and our hero is intent on finding out what that is. Little does he know, there are others working to uncover certain truths as well. (Read More)
| Subgenre: | conspiracymartial artssuperheroswashbuckler |
| Themes: | heromurdermarriagedrunkennessweddingdivorceterrorism |
| Locations: | trainchurchtrain explosion |
| Characters: | father son relationshippriesttough guylove triangleaction herochinese |
| Period: | 19th century1850s |
| Story: | sword fightlegendfightingsecond partfightsequelcharacter name in titleviolencekissexplosionknifeshootoutshot to deathfistfighthorse …shotgungunfightbrawlmaskshowdownhand to hand combatclassroomcaliforniamansionbrunettedisarming someoneduelkaratetough girlopening action scenesecret agentarsonheroinecowboy hatexplosivedual wieldwhipthrown through a windowoutlawknife fightkarate chopsword duelpigeonswordsmanintolerancegovernoradventure herodouble barreled shotguncowboy bootsfencingpipechapelbathhouserepeating rifleflintlock pistolsecret organizationlong black hairracist commenttrain crashchild fighting adultpoloracist remarkpollracist insultzorrohenry rifleracial intolerancefight on a train roof (See All) |
While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos …hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)
| Subgenre: | martial artscult filmtragedyepicdisneyadult animationdark fantasysword and fantasychrist allegory |
| Themes: | samuraiherolovefriendshipdeceptionnatureprejudicemythology |
| Mood: | goreanime |
| Locations: | forestjapan |
| Characters: | warriorhuman animal relationshipsamurai sword |
| Period: | 16th century15th century |
| Story: | sword fightyoung womanweaponfightingswordfightf ratedcharacter name in titlebloodviolencetwo word titleguntitle spoken by characterknifechase …blood splatterhorseshowdownriflehand to hand combatdemoncombatshot in the backdecapitationanimaldisarming someonefictional warjourneyprincesstransformationduelcurseopening action scenemanipulationsevered armhateprincestrong female characterspiritwolfbow and arrowheroinemutilationhunterblockbusterstrong female leadcompassionfemale warriorkatana sworddual wieldpeaceenvironmentalenvironmental issuedark heroknife fightsword duelenvironmental issuesdaggerfolklorekendosuper strengthconservationgirl powerkindnessfablefamous scoretolerancemusketdeforestationgiant animalfortshot with a bow and arrowboarhorse chasemoral ambiguityirondilemmawild boarforest protectionleprosyelknature conservationanimal protectionferal childsevered limbpanterritoryutopia questhuman versus animalwhite wolfthe westcutting off a handanimal allytalking wolf (See All) |
When a magic scepter accidentally transports April back through time to 17th Century Japan, the boys take-off in hot pursuit, cowabungling their way out of the sewers right into Samurai-O-Rama! Now they must battle the evil Lord Norinaga to reclaim the magic scepter that will bring them back below t …he subways of New York City. (Read More)
| Subgenre: | independent filmmartial artscult filmsuperhero |
| Themes: | samuraimagicherosurrealismtime travel |
| Mood: | poetic justice |
| Locations: | japansewer |
| Characters: | teenagertough guywarrioraction herosamurai sword |
| Period: | 1900s1600s |
| Story: | sword fightfightingfightsequelviolenceexplosionchasefirefistfighthorsebattlebrawlhand to hand combatcombatkung fu …based on comic bookambushdisarming someonefictional warvoice overthird partfive word titleninjatough girlopening action scenemartial artistmercenaryvigilantearsonbattlefieldpizzamartial arts masterbow and arrowspearelectronic music scoreheroineslow motiontalking animallifting someone into the airroman numeral in titlepart of trilogyaction heroinechop sockycannonkatana sworddual wieldanthropomorphic animalturtlearmorsword duelsequel to cult favoritestick fightkung fu fightingkung fu classicfemale fighterninjitsuvigilante justiceunsubtitled foreign languagemusketroman numbered sequelwarlordbo staffcavalryliquidanimal that acts humanshot with a bow and arrowflintlock riflehorse chaseflintlock pistolnunchuckslifting male in airreference to clint eastwoodfurryhockey stickteenage mutant ninja turtlesfeudal japanmusketeersaininja turtlemirage comicslampshade (See All) |
In the 1870s, Captain Nathan Algren, a cynical veteran of the American Civil war who will work for anyone, is hired by Americans who want lucrative contracts with the Emperor of Japan to train the peasant conscripts for the first standing imperial army in modern warfare using firearms. The imperial …Omura cabinet's first priority is to repress a rebellion of traditionalist Samurai -hereditary warriors- who remain devoted to the sacred dynasty but reject the Westernizing policy and even refuse firearms. Yet when his ill-prepared superior force sets out too soon, their panic allows the sword-wielding samurai to crush them. Badly wounded Algren's courageous stand makes the samurai leader Katsumoto spare his life; once nursed to health he learns to know and respect the old Japanese way, and participates as advisor in Katsumoto's failed attempt to save the Bushido tradition, but Omura gets repressive laws enacted- he must now choose to honor his loyalty to one of the embittered sides when the conflict returns to the battlefield... (Read More)
| Subgenre: | martial artsepic |
| Themes: | samurairedemptionmurderdeathlovefriendshiprevengesuicidepoliticsdrinkingfeartorturedrunkennessdeath of fatherexecution …hopevengeancecourageself sacrifice (See All) |
| Mood: | gorerainnightmareambiguous endingsavage |
| Locations: | restaurantforestsnowvillagewoodsjapansan francisco california |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfriendboybrother sister relationshipprostitutesoldierwarriorreference to godnative americanjapanesealcoholicex soldiermilitary officer …samurai swordsamurai warrior (See All) |
| Period: | winter19th century1800s1870s |
| Story: | sword fightkatanalegendarmyswordfightbloodviolenceflashbackgunkissknifepistolfirevoice over narration …cryingshootoutbeatingshot to deathblood splattermachine gunhorseshot in the headshotgunslow motion scenecameradrinkbattlemaskrifleheld at gunpointtearshand to hand combatprayercombatshot in the backdecapitationassassinmassacrestabbingwomanthroat slittingstabbed to deathprisonerstabbed in the chestapologysevered headno opening creditsbathshot in the legshot in the foreheadflash forwardbinocularscharacter repeating someone else's dialoguestabbed in the backspiritualityfired from the jobperson on fireattackninjakicked in the faceu.s. presidentshot in the shoulderdeath of brothertragic eventdeath of sonneck breakingloss of fatherthreatened with a knifeshot in the armgeneralsacrificesubtitled scenebattlefieldchild murdercivil wartraitordestinycaptaindestructionbow and arrowspearmass murdercaptivestabbed in the stomachtemplesergeantblockbusterrebelsevered handrebelliongenocidehonorcompassionmonkcolonelsocial commentarycannonbuddhistbarefootreverse footagetokyo japanimaginationbraveryu.s. armykatana swordministerstabbed in the throathatredironystabbed in the neckstabbed in the legdark heromeditationslaughterarmortigertribeknife throwingbetloss of husbandtragic herodeath of loved oneloss of brothergatling gunarrogancepalaceshamedrugged drinktranslatorblood on camera lensbeheadinggreekirish americanshot in the neckwar heroremorsejournalforeigneridealismstabbed in the armemperortheatre productionshot in the eyerailroadpremonitionheritagestreet fightbayonetheld captiveamerican civil warkarmahead cut offstabbed in the shouldershot in the throattragic pastpatriotmilitary trainingspitting bloodwarlordsurrendershot through a doorwinchester riflesecret pastpacific oceanbrother in lawlast standcutting hairretreatdefeatdojofalling off a roofwisdomchopstickshand cut offpersianjapanese culturedead husbandstabbed in the sidedutyjidai gekirickshawsideshowambiguitycounciljapanese armyscalpinginter culturalenglish subtitles in originalfriendly firecalligraphytroubled youthbowljapanese flaglancesuicidal tendencymedal of honoru.s. civil warunreliable narratorhara kirilieutenant colonelstitchesarrow in chestbowingsabresakecherry blossomwarrior racecavalry chargeknife in backseppukuthrown from a horsedishonorregimentsea voyagelinguistu.s. cavalryspring the seasonsword throwingcode of honorhiding in a treeyokohama japancentennialcoolieantique gunshot through the chestscalpsheathreference to george armstrong custerbokkenmilitary disciplinethrowing a speartribal leaderdelegationhowitzertroubled mindyear 1877 (See All) |
In modern day Japan, Wolverine is out of his depth in an unknown world as he faces his ultimate nemesis in a life-or-death battle that will leave him forever changed. Vulnerable for the first time and pushed to his physical and emotional limits, he confronts not only lethal samurai steel but also hi …s inner struggle against his own near-immortality, emerging more powerful than we have ever seen him before. (Read More)
| Subgenre: | conspiracymartial artssuspensesuperherofish out of water |
| Themes: | samuraimurderdeathrevengesuicidekidnappingbetrayalghostdrunkennessescapefuneralgangstersupernatural powermafiaguilt …greedself sacrificenear death experience (See All) |
| Mood: | rainnightmare |
| Locations: | bartrainswimming poolforesthotelhelicoptersnowmotorcycleairplaneairportelevatorwoodsjapancanadacave …laboratorytunnellove hotel (See All) |
| Characters: | father son relationshipfather daughter relationshipfriendtattoojapanese womanprostitutesoldierhostagesister sister relationshiptough guylove trianglewarrioraction herohitmaninterracial relationship …japanesecanadianself mutilationgrandfather granddaughter relationshipex soldieryounger version of characterbabe scientistsamurai swordjapanese soldierformer friendself healingmurder of friendcanadian abroad (See All) |
| Period: | world war two2010syear 1945seeing the future |
| Story: | sword fightmodern dayleaveroninsecond partswordfightsequelcharacter name in titlebloodviolenceflashbacktwo word titlebare chested malekiss …title spoken by characterexplosionknifechasesurprise endingpistoldreamshot to deathfistfightmachine gunshot in the chestshotgunrescuecatbrawlfalling from heightbased on comicshowdownriflehand to hand combatrobothallucinationscientistshot in the backgood versus evilfoot chaseorphanassassinbased on comic bookambushstrangulationaxemountaindrug dealerimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestsubwayno opening creditsanti heroone man armyfemme fatalenews reportshot in the legon the runlimousineorganized crimecharacter repeating someone else's dialoguestabbed in the backelectrocutionfugitivepoisonninjatough girlopening action scenescene during end creditsshot in the shoulderscarbodyguardhairy chestneck breakingpremarital sexthreatened with a knifeshot in the armbearpubsubtitled scenestylized violencestrong female characterak 47crime bossuzishavingbow and arrowburned alivekilling an animalhead buttassassination attempthypodermic needlelooking at oneself in a mirrorcatfightmutantspin offstabbed in the stomachhunterloss of loved onetemplemediavillainessasian womanculture clashfaked deathrailway stationhonormonkaction heroinefemale killergoatcrushed to deathbar fightbroken legapplefemale warriorthuginterracial romancecameohaunted by the pasttokyo japanveteranthunderarranged marriagecrossbowkatana swordstabbed in the throat3 dimensionalgash in the facestabbed in the neckbusinesswomansuper villainfalling to deathimmortalitystabbed in the legmarvel comicsdark herothrown through a windowinfectionheartprisoner of warseasidewisecrack humorhealingrainstormyakuzaarmorfemale doctorlonerdark pastcorporationlens flarechainarrowburned to deathmedia coveragedrugged drinkfemale assassinfianceestabbed in the handkendodrifterveterinarianspit in the facefemale fighterlast will and testamentsubtitlesex boyfriendbugmecharestroomshot with an arrowvillaatomic bombstabbed in the armx raybillionaireno title at beginningburnt faceinterracial kissreluctant heromercy killingblizzardkidnapperheiresskimonoparasiteclawcorrupt officialprivate jetmain character shotnuclear explosionceofighter planebreaking a bottle over someone's headbilingualismolder man younger womanred hairworld war two veteranx rayed skeletonman slaps a womanregenerationchopping woodhit with a chairsurprise during end creditsx menhand through chesthanged womanphone conversationwashroomclangrizzly bearfalling into a swimming poolprisoner of war campkettlevenomhealing powerjumping off a roofbabechildhood lovepoison dartfountain penninja armyseppukutoxinnagasaki japanresearch facilitychopstickrobot suitatom bombthrown from a trainengaged couplefalse friendtree cuttingclaw fightpower armoregomaniacthrown off a balconycheating fianceoncologistfight on train roofkiss of deathstabbed in chestwolverine the characteradopted sisterfight on a train roof1945bullet trainatomic explosionbody scannersnake womanb 29poisoned arrowspin off sequelasian with coloured hairfemale mutantscannumber 13shaving beardatomic bomb victimatomic bombingdefense secretary (See All) |
Eons after the Gods won their mythic struggle against the Titans, a new evil threatens the land. Mad with power, King Hyperion (Mickey Rourke) has declared war against humanity. Amassing a bloodthirsty army of soldiers disfigured by his own hand, Hyperion has scorched Greece in search of the legenda …ry Epirus Bow, a weapon of unimaginable power forged in the heavens by Ares. Only he who possesses this bow can unleash the Titans, who have been imprisoned deep within the walls of Mount Tartaros since the dawn of time and thirst for revenge. In the king's hands, the bow would rain destruction upon mankind and annihilate the Gods. But ancient law dictates the Gods must not intervene in man's conflict. They remain powerless to stop Hyperion...until a peasant named Theseus (Henry Cavill) comes forth as their only hope. Secretly chosen by Zeus, Theseus must save his people from Hyperion and his hordes. Rallying a band of fellow outsiders - including visionary priestess Phaedra (Freida Pinto) and cunning slave Stavros (Stephen Dorff) - one hero will lead the uprising, or watch his homeland fall into ruin and his Gods vanish into legend. (Read More)
| Subgenre: | cult filmtragedysword and sorcerysword and fantasy |
| Themes: | magicheromurderdeathfriendshiprevengebetrayaltorturesupernatural powerdeath of motherself sacrificemadnessmythologygreek mythologymurder of mother |
| Mood: | gorenightmare |
| Locations: | village |
| Characters: | mother son relationshipfather daughter relationshipsoldierthiefaction herosingle motherinterracial relationshipyounger version of character |
| Story: | sword fighthandslegendweaponarmyswordviolenceone word titleflashbackbare chested malesex scenekissfemale rear nudityinterracial sexsurprise ending …showervoice over narrationcorpseblood splatterhorseshot in the chestslow motion scenebattlehand to hand combatcombatsubjective cameradecapitationgood versus evilthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headno opening creditsdisarming someonefictional warkingjourneycharacter repeating someone else's dialoguevirginstabbed in the backperson on firepoisoncharacter's point of view camera shotstatuekissing while having sexwhippingdismembermentsubtitled scenestylized violencetraitorbow and arrowburned alivespearloss of virginityquesthelmetslaverymutilationloss of friendstabbed in the stomachloss of loved onetemplehammermonkcrushed to deathback from the deadbroken legmasked manslavefemale warriorinterracial romancevisionfight to the deathloss of sonstabbed in the throathit in the crotch3 dimensionalstabbed in the neckresurrectionimmortalitystabbed in the headensemble caststabbed in the legdeath of protagonistexploding headtitle at the endeye gougingcastrationtragic herodeath of loved oneatheisttorso cut in halfheroismfemale soldierprayingfinal showdowngatemazefemale fighterbeastinterracial kisspremonitioneaglesword and sandalfinal battleatheisminterracial couplefacial scarbowshapeshiftinghit with a hammertsunamiimmolationhawkknife held to throatepic battletitle spoken by narratorlabyrinthlast standtragic villainsliced in twostabbed in the footlifted by the throatcamaraderieeunuchsevered tongueoracletidal waveminotaurspear throwingreference to socratesfilm starts with quoteencampmentzeustridentwarrior womanreflection in eyetorture devicesuper weapontitanathenachild born of rapeapolloposeidonolympuspart narratedaresson seeing mother murderedsword held to throat (See All) |
Sanjuro, a wandering samurai enters a rural town in nineteenth century Japan. After learning from the innkeeper that the town is divided between two gangsters, he plays one side off against the other. His efforts are complicated by the arrival of the wily Unosuke, the son of one of the gangsters, wh …o owns a revolver. Unosuke has Sanjuro beaten after he reunites an abducted woman with her husband and son, then massacres his father's opponents. During the slaughter, the samurai escapes with the help of the innkeeper; but while recuperating at a nearby temple, he learns of innkeeper's abduction by Unosuke, and returns to the town to confront him. (Read More)
| Subgenre: | martial artscult filmblack comedydark comedy |
| Themes: | samuraimurderfriendshipkidnappingbetrayaltortureescapegambling |
| Locations: | cemeterysmall townjapanbrothel |
| Characters: | mother son relationshippolice officerhostagewarriorsamurai warrior |
| Period: | 19th century1860s |
| Story: | sword fightroninfightingswordfightbased on novelviolenceone word titlegunpistolshootoutrescuegunfightshowdownrevolver …good versus evilanti herodisarming someoneone man armycoffindouble crossduelone against manystreet shootoutbodyguardmercenarysevered armcult directorarsoncorrupt copeavesdroppingassaultsevered handfemale tied uphonorcompassionchop sockydamsel in distresskatana swordintriguedark humorblack and whiterainstormknife throwingsword duelswordsmangang warstreet gangcomic reliefgunslingertavernkindnessrighteous rageoutlaw gangsix shooterarm cut offdoublecrossgunfighterman with no namedojojidai gekigunmangang warfareswordplayfast drawcrossroadsfeudal japanedo periodviolent comedyprisoner exchangewipeblack and white filmdog carrying a severed handgang bossgangster's sonyear 1860tokugawa shogunate (See All) |
Through contact with a mysterious substance, called Ooze, 4 little turtles in the canalization of New York mutate to giant turtles. They can speak, walk upright and love pizza. The wise rat Splinter becomes their mentor and educates them to Ninja fighters. Their arch-enemy is the bad, bad guy Shredd …er, who struggles to gain power over the world. Of course the ninja turtles will do everything to stop him. (Read More)
| Subgenre: | independent filmmartial artscult filmsuperheroslapstick comedy |
| Themes: | redemptionheromurderfriendshiprevengesurrealismangerregret |
| Mood: | poetic justice |
| Locations: | waterapartmentfarmsewer |
| Characters: | villainfather son relationshippoliceteenagerfriendbrother brother relationshiptough guywarrioraction heroemployer employee relationship |
| Period: | 1990s |
| Story: | sword fightkatanafightingswordfightviolenceflashbackfirebeatingfistfightbrawlsecretfalling from heightmaskshowdown …hand to hand combatcombatkung fureportergood versus eviljournalistbased on comic bookambushaxedisguiseboxingsubwaydisarming someoneduelargumentbased on tv seriescostumeattackninjatough girlopening action scenescarratfirst partvigilantepizzaanswering machineloyaltyspearelectronic music scoretalking animallifting someone into the aircomastealingblockbusterjumping from heightskateboardchop sockymasked mananthropomorphismkatana swordanthropomorphic animalmentorskateboardingmeditationknife fightwisecrack humorturtlefemale reportermutationsword dueljuvenile delinquentsecret identitystick fightkung fu fightingface maskcartoon on tvstreet gangkung fu classicspit in the faceold dark housesubway stationgolf clubpolice chiefdual roleadvicefish tankurban decayknocked unconsciousninjitsuvigilante justicepizza deliverygarbage truckboard gamefather son reunionantiquebo staffanimal that acts humanfemale journalistlifting female in airfalling through the floorantique shopcelebrity impersonationnunchuckshockey maskfurryhockey stickaudio flashbackteenage mutant ninja turtleshit with a golf clubninja armysaicomfortmirage comicsunderground hideoutelectrical wiretalking turtlewashclothcymbalstalking ratanthropomorphic turtlestaff weapon (See All) |
A Persian sailor named Sinbad is on a quest to find the magical legendary Book of Peace, a mysterious artifact that Eris, the Greek wicked goddess of chaos, has ultimately framed him for stealing! If he fails on this quest, his childhood friend Prince Proteus of Syracuse will take Sindbad's death pe …nalty, while Eris gains a desired foothold of power in the world of mortals. (Read More)
| Subgenre: | martial artsswashbuckler |
| Themes: | heromonster |
| Locations: | waterseashipsea monster |
| Characters: | ship captain |
| Story: | sword fightingsword fightlegendswordbased on filmpiratespin offadventurerfighting gamesword and sandalspin off from filmpirate shipaction adventure gamepirate captain |
Centuries ago, the evil Emperor Han was cursed by the sorceress Zi Yuan who transformed him and his army into mummies. In 1946, the explorer Rick O'Connell and his wife Evelyn O'Connell are invited by the British government to take a relic, the diamond "The Eye of Shangri-La" to China. The ancient s …tone is capable of resurrecting the Emperor Han and of pointing the way to Shangri-La and the eternal pool of life. When the couple reaches China, they meet their son Alex O'Connell, who has discovered the tomb of Han, and Evelyn's brother Jonathan Carnahan. The O'Connells are betrayed by their friend Prof. Roger Wilson, who is associated with General Yang. Yang wants to serve Emperor Han, so he resurrects the mummy and they head for Shangri-La. The guardian of Han's tomb (and Zi's daughter) Lin tells them that the only ways to destroy Han are to prevent him from reaching Shangri-La or by stabbing his heart with a cursed dagger. (Read More)
| Subgenre: | martial artssuspensesword and sorcerysword and fantasy |
| Themes: | heromonster |
| Characters: | warrioraction hero |
| Story: | sword fightcouplearmyfightingswordfightviolenceexplosionpistolshootoutfistfightmachine gunbattlegunfightbrawl …showdownhand to hand combatcombatkung fuambushcolon in titlemixed martial artsdisarming someoneone man armyduelone against manybattlefieldspeargun fukickboxingadventurershieldseven word titledual wielddynamitesword dueltombmummyquick drawstandoffsix shootertommy gunspin off from filmshoulder holstermp 40 machine gun (See All) |
| Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
| Themes: | redemptionmagicheromurderdeathloverevengesurrealismkidnappingmarriagebetrayalfearescapemonsterdeception …angerobsessionsupernatural powerguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
| Locations: | churchforestsnowvillagewoodscastlecampfire |
| Characters: | soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy |
| Story: | sword fightarmysecond partswordfightsequelcharacter name in titlebloodviolenceflashbackbare chested malekissexplosionknifechase …surprise endingvoice over narrationbeatingcorpsefistfighthorsemirrorshot in the chestface slapshot in the headrescueslow motion scenepunched in the facebattlebrawlshowdownhand to hand combathallucinationrivercombatsubjective cameragood versus evilorphancandleambushaxemassacremountainmontagebridgeimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirddisarming someoneone man armychild in perilfictional wardouble crosskingcreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
| Subgenre: | martial artssword and sorceryswashbucklersword and fantasy |
| Themes: | heromurdermarriagebetrayalescapedeath of fathertime travel |
| Locations: | snowdesert |
| Characters: | soldiertough guywarrioraction hero |
| Story: | sword fightingsword fightarmyswordviolenceflashbackkisstitle spoken by characterexplosionchasehorsebattleshowdownhand to hand combatcombat …kung fugood versus evilfoot chaseorphanassassinambushaxemountaincolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armyfictional warkingprincesson the runone against manyfugitivebrotherprincestylized violencestrong female characterdestinybow and arrowcountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandcrossbowseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomsword duelblack magicdaggerframed for murderunclepalaceswordsmanparkourfortresssorcereradopted sonmacguffinrobesword and sandaltitle in titleempirecorrupt officialsubterraneanshot with a bow and arrowarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All) |
The murderous Bride is back and she is still continuing her vengeance quest against her ex-boss, Bill, and taking aim at Bill's younger brother Budd and Elle Driver, the only survivors from the squad of assassins who betrayed her four years earlier. It's all leading up to the ultimate confrontation …with Bill, the Bride's former master and the man who ordered her execution! (Read More)
| Subgenre: | martial artscult filmblack comedy |
| Themes: | samurairedemptionmurderdeathloverevengemoneybetrayalpregnancybrutalityguiltexecutiondyingblindnessvengeance …justicephilosophyforgivenessregret (See All) |
| Mood: | goreneo noirbreaking the fourth wallpoetic justice |
| Locations: | barrestaurantcemeterydesertstrip clubmexicocampfirebrothel |
| Characters: | father son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipprostitutefemale protagonistteacherpriestwarriorhitmanteacher student relationshipemployer employee relationshippimp …uncle niece relationshipsamurai swordsuper herogirl fightwedding singer (See All) |
| Period: | 2000s |
| Story: | sword fightkillkatanasecond partswordfightsequelf ratedcharacter name in titlebloodviolenceflashbackguncigarette smokingtitle spoken by character …surprise endingpistolfirevoice over narrationcryingcell phonecorpseblood splatterfistfightshot in the chestblondeshotgunwatching tvbrawlshootingshowdownrifletearshand to hand combatdead bodycafebathroomclassroomcombatstripperkung fuflashlightassassinmassacrewomancocaineinternetsnakenonlinear timelineno opening creditsanti herodisarming someonecoffinassassinationfemme fatalegraveyardracial slurpaintrainingflash forwardgravepoisontough girlinjectionmartial artistsplit screenvigilantehatesyringemartial arts masterloyaltyhead buttheroinebridehonormonkaction heroinepresumed deadfemale warriorretirementpromisesufferingkatana swordhit in the crotchmentoreye gougingwedding dresseye patchsword dueltragic herosurprise after end creditsfemale assassincartoon on tvreturning character killed offburied alivekendoparalysisimperative in titlestuffed animalhomageflutepregnancy testtrailer homegoldfishpoisoningrhyme in titlefemale heroeyeballkindnessrespecttreacherytragic lovebouncerrighteous ragebloodsheddeath of title characterdigging a graveone woman armyreference to supermanretributionshot through a doorsnake bitereference to batmanneo westernmentor protege relationshiptragic villainmacericehitwomancobrapretending to be deadchopsticksmoral ambiguitydark heroineshaolinorganistheadstonedeath of petshot in the kneebuddhist templerenegadewinkwuxia fictioncode namevenomtoilet bowlcantonesefemale murdererreference to spidermanglass of waterwarrior womanmaster apprentice relationshipspit in facepoison dartstraight edge razortruth serumhelplessnesspregnant brideeye ripped outholding head underwaterhead in toiletblindedsnake charmermother child reunionperth australiael paso texasduologymagpieshaolin templetragic heroinecostumerintentional goofwedding rehearsalroll callwedding chapelsheathshot back to backhitlistswordsmanshipbarstow californiadeath by snakebitewoman wearing an eyepatchgasping for airblack mambahattori hanzoreference to annie oakley (See All) |
A young boy stumbles into a mysterious girl who floats down from the sky. The girl, Sheeta, was chased by pirates, army and government secret agents. In saving her life, they begin a high flying adventure that goes through all sorts of flying machines, eventually searching for Sheeta's identity in a … floating castle of a lost civilization. (Read More)
| Subgenre: | cult filmsuspensesteampunk |
| Themes: | magicfriendshipsurrealismkidnappingescapemilitary |
| Mood: | anime |
| Locations: | airplanefarmcastlestormtunnelairship |
| Characters: | villainmother son relationshipboygirlsoldierlittle girllittle boy |
| Story: | shogunlegendarmyflashbackchasepistolfistfightrescuebattlefalling from heightinterrogationrobotorphansearchprincess …on the runtreereuniontied upgeneralsecret agentchesspirategrenadeflyingraceladdercolonelcaptureminelaughingfamily secretgovernment agentpigeonflightlevitationstonemegalomaniaccloudcrystalwalesminerpigtailsyoung boyjewel thiefpendantfloatingwearing sunglasses insidemultiple english dubsfreight trainjewel thefttrain wreckgun fightmining townancient civilizationgliderminerallost civilizationmagical stonefemale piratecar on train tracksindustrial revolutionfloating cityfeeding pigeonsmysterious objectblue skyfrying an eggfalling from the skyfeeding birdslost continentcarrying a girllost technology (See All) |
A year has passed by since the Pevensie children stepped through the wardrobe. In Narnia, centuries have passed since the defeat of the White Witch. Now the foursome are sent back to Narnia to find that everything was destroyed and the Narnia they once knew is gone forever. They come to aid the youn …g Prince Caspian, who is leading a group of Old Narnians to wage war against his malicious uncle Miraz, who rules Narnia with an iron fist. Will they succeed? When will Aslan return? (Read More)
| Subgenre: | sword and sorcerysword and fantasychrist allegory |
| Themes: | magicheromonster |
| Locations: | forestsnow |
| Characters: | villainteenagerteenage girlteenage boysoldierwarriorwitch |
| Period: | winter |
| Story: | sword fightarmyswordbased on novelviolencebased on bookcombatbased on filmqueenwolfbow and arrowspearhelmetspin offwitchcraft …villainessknightlionwar violenceevil womansorcerysorceressspin off from filmteenage heroshot with a bow and arrowepic battlesteel helmetteenager fighting adultaction adventure gameminotaurlong sword (See All) |
1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god …s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)
| Subgenre: | martial artsblack comedysword and sorcerysword and fantasy |
| Themes: | redemptionmurderdeathloverevengekidnappingbetrayalghostprisondrunkennessescapemonsterdeceptionfaithdeath of wife …self sacrificemurder of familygreek mythology (See All) |
| Mood: | gorenightmaremyth |
| Locations: | trainforestsnowvillageearthwalled city |
| Characters: | mother son relationshipfather daughter relationshipsoldierhostagetough guywarrioraction herobullyuncle nephew relationshipex soldier |
| Story: | sword fightlegendarmyfightingswordfightcharacter name in titlebloodviolenceone word titleflashbackdogbare chested malefemale rear nuditytitle spoken by character …partyknifefirecorpseshot to deathblood splatterhorseshot in the chestshot in the headrescueslow motion scenepunched in the facebattlefalling from heightbased on comicshowdownhand to hand combatjailhallucinationcombatshot in the backdecapitationgood versus evilorphanbased on comic bookambushaxemassacremountaindisguisemontagethroat slittingimpalementstabbed to deathprisonerstabbed in the chestmapsnakenonlinear timelinebrunettesevered headno opening creditsone man armychild in perilfictional wardouble crosskingcreatureshot in the legprincesstrainingstabbed in the backperson on fireattackstorytellingstatuetentknocked outkicked in the facetough girllightningopening action scenefarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenarysevered armshot in the armgeneralbare chested male bondagekillingbattlefieldprincestylized violencecivil warrockpiratetraitorgolddestinywolfbow and arrowhead buttspearhelmetjail cellvandalismfraudlossclubtorchfateaction heroineanimal attackfalse identitycrushed to deathfemale warriorfull moonadventurershieldhaunted by the pasttarget practicesufferingpastdual wieldstabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswampstabbed in the leghit on the headexploding headdark herolionaerial shotdungeonknife fightsoulcaptureknife throwingstabbed in the eyekingdomtragic herodaggerpalacecrowdrugged drinkstrongmangiant monstermegalomaniacstabbed in the armadventure herotavernbased on graphic novelsword and sandalstabbed in the shoulderteamworkchainedshot in the throatarcherrighteous ragestabbed in the facetragic pastdeath of familywarlordpsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greecegiant animalepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendreflaming arrowtyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhead on a stakehurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
| Subgenre: | martial artscult filmtragedysword and sorceryepicsword and fantasy |
| Themes: | magicheromurderdeathlovefriendshiprevengekidnappingpregnancytortureescapeweddingmonsterdeceptionmemory …death of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeancecourage (See All) |
| Mood: | rain |
| Locations: | forestvillagewoodsfarmlakecastle |
| Characters: | villainfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guywarrioraction herouncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | sword fightleavekillarmyswordfightbloodviolenceflashbackkissexplosionknifechasefirecrying …blood splatterfoodhorserescueslow motion scenebattlefalling from heightbookshowdowntearshand to hand combatrunningneighborcombatsubjective cameragood versus evilsurvivalwinecandleaxemassacremountainstabbingthroat slittingbridgeeatingmixed martial artsprisonermapdisarming someonefictional warkingprincessnecklaceduelgravelibraryattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralbattlefieldchild murderdestinybow and arrowspearmachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardmedieval timespridedungeoncapturearmorraidsiegelieutenantkingdomsword duelblack magictelekinesissmokedaggerimprisonmentcrowheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldsword and sandalheirclimbing a treetitle in titleflamearcherdeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekshot with a bow and arrowbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
Peter Parker is an unhappy man: after two years of fighting crime as Spider-Man, his life has begun to fall apart. The girl he loves is engaged to someone else, his grades are slipping, he cannot keep any of his jobs, and on top of it, the newspaper Daily Bugle is attacking him viciously, claiming t …hat Spider-Man is a criminal. He reaches the breaking point and gives up the crime fighter's life, once and for all. But after a failed fusion experiment, eccentric and obsessive scientist Dr. Otto Octavius is transformed into super villain Doctor Octopus, Doc Ock for short, having four long tentacles as extra hands. Peter guesses it might just be time for Spider-Man to return, but would he act upon it? (Read More)
| Subgenre: | martial artssuperhero |
| Themes: | herorevengesurrealismgangsterjustice |
| Mood: | poetic justice |
| Characters: | villaindoctortough guywarrioraction heropolice shootout |
| Story: | handsfightingfightcharacter name in titleviolencechasepistolfistfightmachine gunshotgunbrawlshowdownhand to hand combatkung fuscientist …good versus evilnew yorkdisarming someoneone man armychild in perilone against manyevil manstreet shootoutbased on filmvigilantestylized violenceflyingcopsuper villainmarvel comicssecret identityvigilantismlizardvigilante justicesuperhuman strengthmasked herosecret lovemasked superherowebmasked vigilanteevil scientist (See All) |
In an ancient time, predating the pyramids, the evil king Memnon is using the psychic powers of his sorceress Cassandra to fortell his great victories. In a last ditch effort to stop Memnon from taking over the world, the leaders of the remaining free tribes hire the assassin Mathayus to kill the so …rceress. But Mathayus ends up getting much more than he bargained for. Now with the help of the trickster Arpid, tribal leader Balthazar and an unexpected ally, it's up to Mathayus to fufill his destiny and become the great Scorpion King. (Read More)
| Subgenre: | martial artssword and sorcery |
| Themes: | magicherobetrayalwrestling |
| Locations: | desertcitycave |
| Characters: | boythieftough guywarrioraction herohorse thief |
| Story: | sword fightkillfightingswordfightcharacter name in titleviolenceexplosionknifethree word titlefirefistfightrescuebattlebrawl …falling from heightshowdownhand to hand combatanimal in titlecombatassassinambushstrangulationaxethroat slittingimpalementmixed martial artssnakesevered headno opening creditsdream sequencedisarming someoneone man armyfictional warkingduelpoisonopening action scenewaterfallcross dressingbattlefielddestinyspearspin offskullvisiontelescopeexplosivesandresistancedual wieldinventorhit in the crotchknife throwingraidsiegedead boyrescue missionsword duelarrowdaggerprequelpalacecamelswordsmanspit in the facemusclemanstrongmanparkourarcherystabbed in the armcrystalscorpionpatricideanttyrantsword and sandaltitle in titlebowharemarm wrestlingsorceressurnancient egyptvalleyclairvoyantshot with a bow and arrowcobraflaming arrowsandstormcatapultfalcongunpowderclairvoyanceswordplayantiquityfire antgrappling hookrubygongsinkholeoasisprecognitionseerflaming swordsoothsayerwrestler as actorarrow in backreference to sodompoisoned arrowarrow catchingarrow in the backgomorrahgomorrahitenear death survivorprequel to sequelacadianarrow in one's backwall of firelima syndrome (See All) |
This theatrical movie based on the television series (which was also based on a popular multiform robot toyline) did not go over very well at the box office. The movie takes place in 2005, twenty years after the television series, and chronicles the efforts of the heroic Autobots to defend their hom …eworld Cybertron from the evil Decepticons. Both factions are seething with anger, and that hatred has blinded them to a hideous menace headed their way. That hideous menace is the colossal planet known as Unicron, who has been ready to consume anything that stands in its way. The only thing that can stop Unicron is the Autobot Matrix of Leadership, which is possessed by the Autobots and which the Decepticons, through Unicron's orders, plan to take away from them. (Read More)
| Subgenre: | independent filmmartial artscult filmtragedy2d animationchrist allegory |
| Themes: | redemptionheromurderdeathfriendshipkidnappingbetrayaltortureescapedeceptionsadismfaithexecutionhopecruelty …courageself sacrificetechnologynear death experiencespace travelfuture wardestruction of planet (See All) |
| Mood: | animedarkness |
| Locations: | traincarhelicoptermotorcyclecityshiptruckouter spacelaboratoryspace stationspace battlespace fight |
| Characters: | villainfather son relationshipsoldieralienwarriorself destruct |
| Period: | 2000sfuture21st centuryyear 2005 |
| Story: | sword fightingsword fightweaponswordfightsequelviolencegunexplosionchasesurprise endingsongshootoutcorpseshot to death …fistfightshot in the chestrescuecomputerbattlegunfightbrawlshowdownhand to hand combatrobotcombatscientistdecapitationgood versus evilspysurvivalbased on comic bookambushaxedisguisedeath of friendmixed martial artssevered headchild in perilhit by a carfictional wardouble crossspaceshipunderwater scenecreaturetransformationbased on tv serieselectrocutionrace against timetankmanipulationexploding bodydarkufobattlefieldmoonpickup truckmissileropedestinydestructionflyingelectronic music scoreheroinejail cellspacecraftplanetfaked deathmind controllasergenocidehonorend of the worldcrushed to deathback from the deadandroiddinosaureaten alivepresumed deadfemale warrioralien invasionfloodtelescopebraveryfight to the deathdual wieldhatredresurrectionshopping mallprophecypsychotronicfather figurecapturesports carlaser gunbased on toytracking deviceheroismunderdogfemale soldiergiant robotreturning character killed offkendojunkyardfemale fightergiant monsteracidcrownbased on cartooncrash landingfighter jetspace shuttleresponsibilityspace warlightsaberslingshothigh techalien contactoctopusalien planetexploding shipshapeshiftingstarshipchosen onefamous linethronekiller robotleadershipmessiahbombardmentalien technologyhuman in outer spaceplanet earthsquidcircular sawcoronationexploding planeescape podswordplayoutrunning explosiontransforming robotmissile launcherrobot as menacerobot as pathosrobot versus robotcassette playertalking robotwarrior raceevil robotalien robotrobot suitalien civilizationfuturistic aircraftactor voicing multiple charactersalien worldsentient robotmoon baseautobotfuturistic caroptimus prime the characterdecepticonexo suittransformer robotbumblebee the charactermegatron the charactermock trialspeaking in rhymemechanical lifeformalien spacecraftautobot versus decepticonhuman allypsychadelic imagerobot dinosaurfemale autobotfemale transformerironhide the charactertentacled alienarcee the charactercybertron the planetdinobotliving planetmatrix of leadershipultra magnus the character (See All) |
Ten years after the invasion of Naboo, the Galactic Republic is facing a Separatist movement and the former queen and now Senator Padme Amidala travels to Coruscant to vote on a project to create an army to help the Jedi to protect the Republic. Upon arrival, she escapes from an attempt to kill her, … and Obi-Wan Kenobi and his Padawan Anakin Skywalker are assigned to protect her. They chase the shape-shifter Zam Wessell but she is killed by a poisoned dart before revealing who hired her. The Jedi Council assigns Obi-Wan Kenobi to discover who has tried to kill Amidala and Anakin to protect her in Naboo. Obi-Wan discovers that the dart is from the planet Kamino, and he heads to the remote planet. He finds an army of clones that has been under production for years for the Republic and that the bounty hunter Jango Fett was the matrix for the clones. Meanwhile Anakin and Amidala fall in love with each other, and he has nightmarish visions of his mother. They travel to his home planet, Tatooine, to see his mother, and he discovers that she has been abducted by Tusken Raiders. Anakin finds his mother dying, and he kills all the Tusken tribe, including the women and children. Obi-Wan follows Jango Fett to the planet Geonosis where he discovers who is behind the Separatist movement. He transmits his discoveries to Anakin since he cannot reach the Jedi Council. Who is the leader of the Separatist movement? Will Anakin receive Obi-Wan's message? And will the secret love between Anakin a… (Read More)
| Subgenre: | conspiracymartial artstragedyepicspace opera |
| Themes: | samurairevengekidnappingmarriagetortureescapeweddingmonsterinvestigationseductionangerdeath of motherspace travel |
| Mood: | rainnightmarecar chase |
| Locations: | desertshipouter spacecavebar brawlspace battle |
| Characters: | mother son relationshipafrican americanteenage boytough guywarrioraction heroteacher student relationshiphuman versus robot |
| Period: | future |
| Story: | sword fightkillweaponarmyfightingswordfightnumber in titleviolencekissexplosionchaseshootoutfistfightbattle …gunfightbrawlfalling from heightshowdownhand to hand combatrobotcombatdecapitationgood versus evilassassinambushmassacredisguisemixed martial artsdinerdisarming someonefictional warspaceshipcreatureduelspiritualityattacktough girlbodyguardthreatsevered armloss of motherlove interestbattlefieldhateassassination attemptwoundmass murderheavy rainbeardspacecraftcaucasianplanetjumping from heightforbidden lovelasercgihonorbar fightandroidgun battlecannoneaten alivedual wieldprophecyfather figuresenatorjumping through a windowyoung lovehologrambounty huntersword duelwilhelm screamclonetelekinesislaser gunwedding ceremonylevitationkendoteenage lovewar violencegiant monsterstepfathertwo man armyfruitstar warsbearded maninfatuationarenaresponsibilityasteroidlightsaberrainingfamous scoregrassshapeshiftingcloningvictorychosen onewoman in dangeralien racechildhood sweetheartmessiahsenateangrylaser beamthe forceblueprintjedi knightsurprise attackescape podassembly lineteenage rebellioncloakwuxia fictionone armed manteenage romancespace westerngalactic warjediangry mandroidsecret marriageinvented languagestepbrotherfree falllaser cannonwar against machinesdesert planetclosing eyes of dead personpolitical manipulationhumanoid robotrevenge killingface woundwarp speeddeath starhuman versus machinehuman cloningchangelingvillain escapesbad guys wingunshipdeath rayhuman clonespaceportrobot soldierleitmotifforce lightninghuman malehuman femalemechanical handastromech droidectogenfood trayforeshadowgladiatorial combatinsectoid alienjedi mind trickrain fightsith lordectogenesisfate of the universer2 d2recapitationgood becoming evilprotocol droidloss of handtrayflying creaturejedi younglingmale clonemistaking reality for dreamsense of danger (See All) |
Down these mean streets a man must come. A hero born, murdered, and born again. When a Rookie cop named Denny Colt returns from the beyond as The Spirit, a hero whose mission is to fight against the bad forces from the shadows of Central City. The Octopus who kills anyone unfortunate enough to see h …is face who has other plans. He's going to wipe out the entire city. The Spirit tracks this cold hearted killer from the city's rundown warehouses, to the damp catacombs, to the windswept waterfront all the while facing a bevy of beautiful women who either want to seduce, love or kill the masked crusader. (Read More)
| Subgenre: | cult filmsuperhero |
| Themes: | samuraiherodeathsurrealismsuicidefuneraldeath of fathermurder of a police officergreek mythology |
| Mood: | breaking the fourth wall |
| Locations: | snowcemetery |
| Characters: | villainfather daughter relationshipdoctorpolice officerdetectivelove trianglecoronershooting a police officer |
| Story: | killkatanaswordfightfemale nuditycharacter name in titlebloodflashbackkissfemale rear nuditycigarette smokingtitle spoken by characterexplosionvoice over narrationbeating …corpseshot to deathshot in the chestshot in the headcatfalling from heightmaskbased on comicscientistshot in the backreporterfoot chaseassassinbased on comic bookstabbingimpalementstabbed in the chesttied to a chaircoffinunderwater scenepolice officer killedfemme fatalenecklaceelectrocutionknocked outkicked in the faceinjectionexploding bodypolicewomanthreatened with a knifefalse eyelashestwinvigilantehenchmanfalling down stairshand grenadecard gamegrenadekilling an animalreference to adolf hitlerwoman with glasseshatsevered handfrogwomanizerback from the deadthugdiamondsevered fingerkatana swordhit in the crotchimmortalitypolice officer shotshadowhealingbulletproof vestknife throwingpassionate kisssecret identitysurgeondc comicsshot multiple timesfemale assassinnarrated by characterswastikarobberpolice officer shot in the chestsuper strengthsuit and tieparkouracidkittenhit by a truckswimming underwatermuggingteethpondcrime fightersaltclose up of eyesevered footanti heroinelocketmasked superherohead ripped offbelly dancerrentbullet proof vestpoker gamerevolving doorfedorapolice commissionerchildhood sweetheartglovenazi uniformjumping from a rooftopsuit of armorvasenecktiesliced in twodrinking bloodthrowing starshurikenchestextreme closeupfemale star appears nudefalling through a windowarm blown offwoman in a towelvirtual sethara kiriangel of deathfirefightscubaparasolbusiness suitstorm drainmilitary dress uniformarch villaintabby catjumping between buildingspants falling downbarefoot mansabercamera shot of a woman's legsreference to herculespolice officer shot in the neckhand from gravehelicopter gunshipdomino maskjumping on a moving vehiclethigh bootpushed out a windowunarmed heroribcagewhite ratnazi symbolclose up of lipscolor redcopiergolden fleecerising from the gravehole in a fence (See All) |
During the reign of the Tang dynasty in China, a secret organization called "The House of the Flying Daggers" rises and opposes the government. A police officer called Leo sends officer Jin to investigate a young dancer named Mei, claiming that she has ties to the "Flying Daggers". Leo arrests Mei, …only to have Jin breaking her free in a plot to gain her trust and lead the police to the new leader of the secret organization. But things are far more complicated than they seem... (Read More)
| Subgenre: | martial artstragedywuxia |
| Themes: | heromurderdeathrevengemarriagerapebetrayaljealousyprisondrinkingtorturedrunkennessescapeseductioncorruption …death of fatherpovertyblindnesswealth (See All) |
| Locations: | forestsnowwatervillagewoodschinacampfirebrothel |
| Characters: | husband wife relationshippolicesingersoldierpolice officerdancermusicianlove trianglewarriorlust |
| Story: | sword fightingsword fightarmyswordfightsexnuditynumber in titlebloodviolencekissdancingsingingchasesurprise ending …firecryingsonghorserescueslow motion scenedrinkbattlearrestsecretshowdowntearshand to hand combatcombatspyassassinambushthroat slittingprisonerhouseassassinationdouble crossdueltreestabbed in the backfugitivecharacter's point of view camera shotpassionflowerspursuitgovernmenthorse ridingtied upgeneralmagical realismtruststylized violenceflirtingcaptainbow and arrowflyingspearwoundmachetecaptiverebelrebellionfollowing someonehonoraction heroineshieldtrappedwindbraverykatana swordstabbed in the throatbathingbooby trapsword duelsecret identitydaggerswordsmanemperordrumdeputyautumnstar crossed loversromantic rivalrytragic lovedoublecrossbrothel madamimperialismblind girljail breakshowgirlwire fumatchmakerdutyswordplaybamboowuxia fictionswordswomanancient chinapatrolcaptive womanfalling treerebel armytug of warvisually impaired persongreen dressyoung loverstang dynastypavillion9th centurycorrupt governmentwoman with long hairfalling horse (See All) |
Philipe Gastone, a thief, escapes from the dungeon at Aquila, sparking a manhunt. He is nearly captured when Captain Navarre befriends him. Navarre has been hunted by the Bishop's men for two years, ever since he escaped with the Lady Isabeau who the Bishop has lusted after. Navarre and Isabeau have … a curse that the Bishop has placed on them that causes Navarre to be a wolf during the night and Isabeau to be a hawk during the day. Navarre insists that Philipe help him re-enter the city to help him kill the heavily guarded Bishop. (Read More)
| Subgenre: | sword and sorcerysword and fantasy |
| Themes: | magicmurderdeathloveprisondrinkingescapetheftevilprison escapereligious tolerance |
| Mood: | rain |
| Locations: | churchforestsnowwatercastlecampfiretunnelsewer |
| Characters: | dancerpriestthiefhorse actor |
| Story: | sword fightingsword fightkillswordfightbloodviolencekissdancingtitle spoken by characterchasecryingdreamfoodhorse …rescuebattlefalling from heighttearsrunningjailprayerrivercombatswimmingaxemountainimpalementstabbed to deathprisonerstabbed in the chestchildbirdfictional wartransformationcursefugitivemissionpassionrabbithangingpursuitcrossreunionunderwatergardenbattlefieldicewolfbow and arrowspearelectronic music scoreslow motionquestjail cellmousehuntersheepknightmonkcrossbowdark heromedieval timesdungeonrainstormarmorkingdomhorseback ridingspellsunsetpickpockettowershot with an arrowdiggingwellsunrisebishopcathedralstar crossed loverstragic loveinnhorse and wagonhawkchurch belleclipsetalking to selfbear traphuman becoming an animaldawnladyfalconfalling through iceanimal traplovers reunitedpicking a lockkilled with a swordlock pickrider horse relationshiparrow in chesttalking to goddrawbridgecorrupt priestgirl horse relationshipbell ringingbareback ridingdrainenchantmenttrapperduskriding barebackblack horsesword throwingevil spellluteplanetary alignmentwoman horse relationshipboy horse relationshiptransformfemale horse riderleg hold trapandalusianbird of preyman horse relationshipspeaking in rhymegirl riding a horsestabbed with an arrowstabbed with swordtalking to a horsehooded cloakfalconerfalling from a towerblack knightcastle ruinscow skulltrained horseturned into a birdtwo riding a horse (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
| Subgenre: | independent filmcult filmsupernaturaldark fantasyurban fantasy |
| Themes: | redemptionmurderdeathrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerbrutalitysupernatural power …death of motherparanoiapanicapocalypseabortionnear death experiencesupernatural powers (See All) |
| Mood: | gorenightdarkness |
| Locations: | trainswimming poolairplanebathtubelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
| Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boywitchrussian …pregnant womanself mutilation (See All) |
| Period: | 1990s2000s20th century21st centuryyear 1992 |
| Story: | sword fightmodern daylegendarmyswordfightfemale nuditybased on novelbloodviolenceflashbackdogtwo word titlebare chested malefemale rear nudity …photographtitle spoken by characterexplosionknifechasesurprise endingvoice over narrationcell phonebeatingcorpseblood splatterhorserescueslow motion scenepunched in the facebattlearrestbrawlbare buttshowdownsunglassesneighborsubjective cameradecapitationgood versus evilfoot chaseflashlightambushconcertaxebridgeimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murdercursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingpsychotronic filmimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollopening creditsnight watchface blown off (See All) |
Set against the coming of Christianity, this is the story of the last hero: in 507, a monstrous troll wreaks havoc in the mead hall of the Danish king, Hrothgar. He offers rewards for the death of Grendel, so Beowulf, a great and boastful Geat warrior, arrives with his thanes. Beowulf sets aside his … armor and awaits the monster; a fierce battle ensues that leads to Beowolf's entering the watery lair of Grendel's mother, where a devil's bargain awaits. Beowulf returns to Herot, the castle, and becomes king. Jump ahead many years, and the sins of the father are visited upon Beowulf and his kingdom. The hero must face his weakness and be heroic once again. Is the age of demons over? (Read More)
| Subgenre: | cult filmtragedysword and sorceryepiccomputer animationcgi animationadult animation |
| Themes: | redemptionmagicheromurderdeathfriendshiprevengesuicideinfidelityadulterydrinkingdrunkennessfuneralmonstermemory …seductioncorruptionbrutalityobsessioncannibalismvengeancecourageinheritancemythology (See All) |
| Mood: | gore |
| Locations: | beachchurchforestseashipcastlecaveoceanstorm |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipsingersoldierpriestwarriorchristianitymermaiddeath of herohuman versus monster |
| Story: | sword fightlegendarmyswordfightsexfemale nuditycharacter name in titlemale nudityviolenceone word titlefemale frontal nuditybare chested malekisstitle spoken by character …singingchasesurprise endingfirebeatingdreamcorpseblood splatterslow motion scenereenactmentbattlebrawlfalling from heightdemoncombatdecapitationgood versus evilmassacrestabbingdeath of friendthroat slittingbridgeimpalementstabbed to deathapologysevered headno opening creditsritualkingcreatureduelgravecursebeaten to deathstabbed in the backperson on fireactor playing multiple rolesdragonsadnessratsevered armqueendismembermenthatepowergoldloyaltybow and arrowburned alivespearquestfametold in flashbackmutilationdenmarktreasurebuttocksgiantservanthonorburialanimal attackeaten alivecelebrationpromisedwarfshieldfight to the deathloss of sonstabbed in the throatprophecystabbed in the headswampstabbed in the legdisembowelmentheartslaughterarmordisfigurementstabbed in the eyebroken armkingdomloss of husbandtragic herosevered legdaggersinshamereflectionnecrophiliavikingshot with an arrowarcherycrownstabbed in the armfortressburnt facetaverncrushed headtrollseductressstabbed in the shoulderbleeding to deathheirarchermartyrclawritedeformityheart ripped outburning buildingsailing shiploinclothexpressionismcustomrewardarm ripped offillegitimate sonbased on poemleadershipfeastsagabattle axefalling off a cliffhornaxe in the headsliced in twoorigin of herotreasure cheststabbed in the sidedanishfuneral pyrecoronationburned bodyfire breathing dragonfake bloodtorn in halfconquestnude fightlairchildlessnessmotion capturedeath by firesplit in twodesecrationdark agesfleethospitalityhero worshipcandlestickweaknesswenchavariceretellingspear through chestswimming competitionsword throwingdeath by swordnorsestabbed in chestwinged dragontrampled to deathfuneral riteseacoastancient sworddragon riderraider6th centuryragnarokhuman versus dragontest of characterrafterbare backburning churchburning citymonster childhuman fallibilityold englishbeast's heart (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village … council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
| Subgenre: | martial artscult filmfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
| Themes: | redemptionmagicherofriendshiprevengesurrealismkidnappingbetrayaladulteryescapemonstersadismcourageforgivenessbook of magic |
| Mood: | rainpoetic justice |
| Locations: | forestsnowboatvillagefarmlakecastlecampfireroad movie |
| Characters: | villainfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boywitch …self discoverycrying babybaby girl (See All) |
| Story: | sword fightkillarmyswordfightcharacter name in titlebloodone word titledogkissdancingtitle spoken by characterknifechasecrying …horsepunched in the facecatbattlefalling from heightmaskbookshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightlifting someone into the airloss of friendhidingvillainessanimal attackgoatapplefemale warrioradventurerdwarfshieldfairywizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggercrowhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
In stifling Edwardian London, Wendy Darling mesmerizes her brothers every night with bedtime tales of swordplay, swashbuckling, and the fearsome Captain Hook. But the children become the heroes of an even greater story, when Peter Pan flies into their nursery one night and leads them over moonlit ro …oftops through a galaxy of stars and to the lush jungles of Neverland. Wendy and her brothers join Peter and the Lost Boys in an exhilarating life--free of grown-up rules--while also facing the inevitable showdown with Hook and his bloodthirsty pirates. (Read More)
| Subgenre: | martial artsswashbucklersword and fantasy |
| Themes: | magicheromurderdeathfriendshipbetrayaljealousyfearangerlonelinesstheftadoptioncouragefirst love |
| Locations: | schoolsnowbathtublondon englandwatershipcastlejunglestormcity of children |
| Characters: | villainfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteachergirlstudent …thieftough guynative americanaunt niece relationshipaunt nephew relationshipmermaidboy hero (See All) |
| Period: | 1900s |
| Story: | sword fightweaponfightingswordfightcharacter name in titlebased on novelviolencedoggunkisstitle spoken by charactervoice over narrationcryingrescue …slow motion scenebattlelettershootingshowdownhand to hand combatbedislandclassroomcombatbound and gaggedgangambushmixed martial artsman with glassesno opening creditschilddisarming someoneone man armydrawingduelattempted murderone against manydangerpoisonstorytellingtough girlskeletonglassestrapunderwaterclassrecord playericepirategoldcaptainbow and arrowflyinghead buttheroinelifting someone into the airhattreasurehidinggossipteddy bearfemale tied upcannonbarefoottelescopechild's point of viewfairychild protagonistrowboatlostrivalshadowyoung lovegrowing upsword duelparrotwilhelm screamnannyclose up of eyesflagswordsmangatecrocodiletween girladventure heroboy with glasseshanging upside downbankerfencingcloudwhistlingfeathersiblingmusketsewingcomettop hathookshot with a bow and arrowflintlock riflenightgownflintlock pistolsolar systemwire fubig ben londonchild heromale tied upreference to cinderellapleadingchild in dangerteepeehook for handplay fightvictrolamake believepirate captainnightshirtwooden swordsaint bernard dogpulling hairflying boygirl in dangerwalking the plankjolly rogerskull and crossbonesboy in dangerfantasy landflying shipblushingmagical dustthimblecrowingfairy dustbarefoot boy (See All) |
In 1431, the Kingdom of Ayutthayan conquers the territory of Sukhothai expanding their lands to the East. The noble Lord Siha Decho is betrayed by his Captain, Rajasena, and is murdered together with his wife. However their son Tien is saved by one loyal soldier and left alone in the woods...
| Subgenre: | martial artscult film |
| Themes: | herodeathrevengebetrayalyouthvengeancemythology |
| Locations: | villagejungle |
| Characters: | boytough guywarrioraction herofather |
| Period: | 15th century |
| Story: | sword fightkatanafightingsecond partfightsequelnumber in titlebloodviolenceflashbackbare chested malechasebeatingdigit in titleblood splatter …fistfightslow motion scenebattlebrawlshowdownhand to hand combatnumbered sequelcombatkung fuorphanambushmixed martial artsdisarming someoneone man armyone against manymissionmartial artistbare chested male bondagestylized violencespiritmartial arts masterbow and arrowelephantcaptivechop sockyslavebuddhistkatana swordfight to the deathmeditationmedieval timesoutlawbuddhismsword duelstick fightbanditkung fu fightingfighterkung fu classiccrocodiletestoutlaw gangyoung manmiddle agesbo staffmuay thaibuddhashot with a bow and arrowyoung boybeefcake martial artssequel by name only1400s (See All) |
The mega corporation Omni Consumer Products is still bent on creating their pet project, Delta City, to replace the rotting city of Detroit. Unfortunately, the inhabitants of the area have no intention of abandoning their homes simply for desires of the company. To this end, OCP have decided to forc …e them to leave by employing a ruthless mercenary army to attack and harass them. An underground resistance begins and in this fight, Robocop must decide where his loyalties lie. (Read More)
| Subgenre: | independent filmmartial artssuperherodystopiapunkcyberpunk |
| Themes: | herosuicidechristmasgangsterbrutalitypolice brutality |
| Mood: | neo noircar chase |
| Locations: | churchhotelhelicopterurban settingpolice stationabandoned factoryhotel fightshootout in a churchshootout in a police station |
| Characters: | policepolice officerpolicemantough guywarrioraction heropolice shootout |
| Period: | futurenear future |
| Story: | sword fightleavearmyfightingfightsequelcharacter name in titlenumber in titlebloodviolenceexplosionknifechasesurprise endingpistol …shootoutblood splattermachine gunshotgunbattlegunfightbrawlshowdownhand to hand combatrobotcombatkung fudecapitationassassinambushname in titlemixed martial artsexploding carman with glassesdisarming someoneone man armypolice officer killedthird partone against manyorganized crimeninjatough girltankstreet shootoutneck breakingsemiautomatic pistolsilencerstylized violenceak 47uziexploding buildingsevered handpart of trilogyrebellionmexican standoffgun fusocial commentaryandroidgun battlecannoncyborgpump action shotgunswitchbladeexplosivekatana swordexploding headyakuzatough copcorporationsword duellasersightflamethrowergrenade launcherdesert eaglereturning character killed offkendomolotov cocktailtimebombfemale fighterdetroit michiganquick drawurban decaybayonetmaverick copcrime fightermain character shotresistance fighternight vision gogglesreturning character with different actorpolicewoman killingkiller robotmixed caps in titlemegacorporationcorporate crimeflame throwerrogue coppolice vigilantismsequel to cult filmjet packrelocationpart stop motionstabbed with a bayonetexploding tankrebel armyautomatic pistolpirate broadcastingrobocopcorporatismturf wargun shot out of handhumanoid cyborgbullet catchinghuman versus cyborgpg 13 sequel to r rated franchiseflying cyborgpolice cyborgcorporatization (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | redemptionmagicmurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneral …monsterdeceptionrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | legendarmyfightingswordfightcharacter name in titlebloodviolenceflashbackdogbare chested maletitle spoken by characterexplosionknifechase …surprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandrivercombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgeimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
| Subgenre: | martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation |
| Themes: | redemptionmurderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessescapemonsterdeceptionbrutalitysupernatural powercelebrity …sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All) |
| Locations: | new york citybarchurchforestelevatorvillagewoodsouter space |
| Characters: | villainfather son relationshiptattoobrother brother relationshipbrother sister relationshipzombiesoldieralienhostagetough guywarrioraction heroalcoholiccousin cousin relationshipfather …alien monster (See All) |
| Story: | sword fighthandsweaponarmyfightingswordfightsequelcharacter name in titleviolenceflashbacktwo word titlebare chested maletitle spoken by characterexplosion …knifechasesurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightbookbased on comicshowdownheld at gunpointbeerhand to hand combatdemonrivercombatdecapitationgood versus evilsurvivalfoot chasebased on comic bookambushname in titleaxemassacremountainbasketballbridgeimpalementstabbed to deathmixed martial artsprisonerstabbed in the chesttied to a chairsevered headdisarming someoneone man armyfictional wardouble crossspaceshipunderwater scenecreaturefemme fatalethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningopening action sceneskeletonbraceletscene during end creditsmanipulationspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadbattlefieldprincestylized violencestrong female characterhenchmanapplausedestinywolfdestructionbow and arrowflyingracehead buttspearelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplanetblockbustereccentriccamprebeljumping from heightclubskullrebellionknightlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footageshieldcameohaunted by the pastvisionbootsbraveryfight to the deathdual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fightwisecrack humorhologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All) |
Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse …d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)
| Subgenre: | martial artscult filmstop motion animationchrist allegorylow comedydieselpunk |
| Themes: | redemptionmagicheromurderdeathlovefriendshipkidnappingtortureescapegangstersadismcrueltyjusticestarvation |
| Mood: | gorepoetic justice |
| Locations: | airplanenightclubwatervillagejunglecampfireindiaairplane accidentnightclub shootoutmine car |
| Characters: | villainfather son relationshipchildrensingerboywarrioraction heroamerican abroad |
| Period: | 1930s |
| Story: | sword fightsecond partswordsequelcharacter name in titlebloodviolencebare chested malekisschasepistolfireshootoutfistfightblonde …face slaprescuegunfightfalling from heightriflerivercleavagebridgeprisonerstabbed in the chestsnakecultdisarming someoneone man armyargumentcursedangerperson on firepoisonevil manskeletonhangingstreet shootouttraplove interestmonkeyoccultcard gamebow and arrowspearballoonheroinegothiclifting someone into the airslaveryroyaltyelephanttempleblockbusterfemale singerpart of trilogyhonorcompassionmexican standoffcrushed to deathslaveeaten alivebarefootadventurerreverse footagediamondsevered fingerbraveryseven word titlewhipfalling to deathinsectfather figureairplane crashbooby trapheartfallmusical numbersexy womantuxedominepassionate kissvoodooprequelpalaceleather jacketheroismyellingbrainwashingspit in the facehuman sacrificecrocodilebugcomic reliefroller coasterforeignerraftadventure herofalling into watertriadlavaarcheologysoupunsubtitled foreign languagetyrantmacguffineyeballchild kidnappingkindnessfriends who live togetheralligatorperfumefamous scorearcheologistrighteous rageoutlaw gangshrineheart ripped outtommy gunsecret passagebanquetchosen oneexploding airplaneimmolationlifting person in airheart in handtap dancingfedorahinduismbeetlecaged animalchild laborgross out humorantidoteshacklesscreaming in fearfaminestudio logo segues into filmchild driving cartyrannychild actorindiana jonesemaciationrickshawhand through chestlifting male in airbolt action riflebritish empirevoodoo dollrope bridgeconveyor beltmine shaftbelchshanghai chinawinkriver rapidschild driving a carbelchingburpcremated remainsburpingdeath trapgongsprayed with wateryawningsuspension bridgeplaying pokerturntablebritish colonialcheating at cardsprequel and sequelhallucinogeniclive chickenfemale dancervictim invited to dinnermusical sequence in non musical worksleddingthompson sub machine gunbeating heartlife raftreligious ceremonyeating brainsopening champagneflying batjourney shown on a mapkalimedium breastsyawnore cartwhite tuxedosplitsyear 1857ancient ritualcliffhangingeaten by a crocodilegrindstoneriding an elephantinnocent deaths avengedred carnationthuggeewhite dinner jacket (See All) |
Martial arts legend Huo Yuanjia became the most famous fighter in all of China at the turn of the 20th Century. Huo faced personal tragedy but ultimately fought his way out of darkness and into history, defining the true spirit of martial arts. His self-discovery, and the choices he made, inspired h …is nation. The son of a great fighter who did not wish for his child to follow in his footsteps, the bullied Huo Yuanjia resolves to teach himself how to fight - and win. Years of training enable him to ace match after match in his home region of Tianjin. But as his fame as a martial arts master grows, so does his pride. After an ill-advised fight leads to another master's death, members of Huo's family are slain in revenge. Grieving and ashamed, Huo wanders the country in shock. Near death, he is rescued by women from an idyllic village, and is offered simple kindness and generosity that help him heal and regain his equilibrium over a period of several years. Huo realizes that the future of martial arts lies in sportsmanship and not brutality, and he rejoins society to apply what he has learned. Returning to Tianjin, Huo takes steps to come to terms with his past and restore his family's name. His evolving, graceful Mizong (Missing) Fist method of fighting brings Huo renewed success, and he forms the progressive Jingwu Sports Federation. Taking note, duplicitous members of the Foreign Chamber of Commerce engineer a Shanghai tournament pitting Huo against four fighters, each repres… (Read More)
| Subgenre: | martial artscult filmtragedychrist allegory |
| Themes: | redemptionheromurderfriendshiprevengeadulterygamblinghopechildhood |
| Mood: | archive footage |
| Locations: | restaurantrural settingchina |
| Characters: | father son relationshipmother son relationshiptough guywarrioraction herobest friendlittle girlchinese |
| Story: | sword fightlegendfightingswordfightcharacter name in titlebloodviolencesurprise endingbased on true storybeatingblood splatterfistfightbrawlshowdown …hand to hand combatcombatkung fumixed martial artsdisarming someoneone man armycoffinduelone against manygravekaratebusinessmanwidowerfantasy sequencepoisonopening action scenemartial artistcontestunderwaterloss of mothergrandmotherchild murderstylized violenceteamartial arts masterspearboxercompassionchop sockykickboxingkatana swordfight to the deathexiledeath of protagonistpridebetsword dueltragic herostick fightpatriotismblindmain character diespeasantkung fu classickung fu masterflutebeggarloss of daughteridealismasthmafencingwagerkindnessresponsibilityvanitykickboxerbo staffwu shumartial arts tournamentfinancial crisisshanghaimessiahturn of the centuryswordplaydisciplecalligraphywuxia fictionlancerapierrice fieldhousehold servantbirthday dinnergodsontai chi swordtianjin chinachamber of commercewooden platform (See All) |
In this continuation to the adventure of the demon superhero, an evil elf breaks an ancient pact between humans and creatures, as he declares war against humanity. He is on a mission to release The Golden Army, a deadly group of fighting machines that can destroy the human race. As Hell on Earth is …ready to erupt, Hellboy and his crew set out to defeat the evil prince before The Golden Army can destroy humanity's existence. (Read More)
| Subgenre: | martial artssuperheroparanormal phenomenasteampunkparanormal investigation |
| Themes: | herodeathsuicidechristmaspregnancydrunkennesswrestlingabductionapocalypsefalling in loveself sacrificenear death experience |
| Locations: | new york city |
| Characters: | father son relationshipfather daughter relationshipbrother sister relationshipbabyaction herogerman |
| Period: | 1950s |
| Story: | sword fightarmyfightingsecond partfightsequelcharacter name in titlebloodviolenceflashbacktitle spoken by charactersingingsurprise endingpistolshower …shootoutfistfightshot in the chestface slapbattlegunfightbrawlfalling from heightbookbased on comicshowdownhand to hand combatdemondecapitationgood versus evilbased on comic bookimpalementmixed martial artsstabbed in the chestmapsevered headno opening creditsanti heroone man armychild in perilfictional warcreaturecigar smokingone against manystabbed in the backprologueperson on fireskeletonsplit screenfilm within a filmthreatened with a knifesevered armtwinprincespearmutantroman numeral in titlenosebleedrebellioncrushed to deatheaten alivehit in the crotchgash in the facesuper villainstabbed in the headexilechristmas evethrown through a windowsoulbody landing on a carexploding helicopterauctionelfblood on camera lensoutcastremorsecrownquitting a jobpatricidesuperhero teamtrollgoblinhead cut offshot through the mouthblacksmithnorthern irelandgoggleshead ripped offregenerationunwed pregnancyresignationarm ripped offmultiple time framesstabbed in the mouthtumorcut armstabbed in the footfederal bureau of investigationturned to stoneson murders fatherpyrokinesisreference to the wizard of ozthrown through a glass doorangel of deathdark horse comicsteeth knocked outtooth fairytruceinterspecies romancenazi experimentsecret government organisationindestructibilityoccult detectiveowning many catswebbed fingersaquatic humanoidbreathing apparatushumanoid demon (See All) |
While Andy is away at summer camp Woody has been toynapped by Al McWiggin, a greedy collector and proprietor of "Al's Toy Barn"! In this all-out rescue mission, Buzz and his friends Mr. Potato Head, Slinky Dog, Rex and Hamm springs into action to rescue Woody from winding up as a museum piece. They …must find a way to save him before he gets sold in Japan forever and they'll never see him again! (Read More)
| Subgenre: | martial artscult filmcomputer animationcgi animation |
| Themes: | redemptionherofriendshipkidnappingescapethefthopegreedadoption |
| Mood: | nightmarecar chase |
| Locations: | airplaneairportelevatorouter space |
| Characters: | villainhusband wife relationshipfriendbabytough guysingle motherlittle boyself referential |
| Period: | 1990s |
| Story: | fightingsecond partfightsequelnumber in titleviolencedogchaseshootoutdreamdigit in titlefistfightmirrorrescueslow motion scene …battlegunfightbrawlfalling from heightshowdownnumbered sequelapologyno opening creditskaratesuburbcowboymistaken identitydollopening action scenetragic eventsevered armdestinyloyaltyflyinghattoyblockbusterjumping from heightvisitpart of trilogylaserdinosauranthropomorphismbroken armlaser gunbloopers during creditsohiocartoon dogpenguinrace carcartoon violencefriends who live togethertour guideoverweightcollectorclawstealthchoicereference to abraham lincolnhopelessnesssuper nintendocomic herotoy storesecond in trilogytoy comes to lifebarbie dollcgi filmbattering ramconveyor beltbarbielicense platepiggy bankyard saleprospectorshot with a laser gunself fulfillmentchicken suitmr potato headanthropomorphic toycancellationetch a sketchcartoon penguintroll dollbuzz lightyeartraffic coneairplane cargoslinky dogsqueeze toy (See All) |
Based on Gail Carson Levine's award winning novel, this is the story of Ella, a young woman who was given a "gift" of obedience by a fairy named Lucinda. She must obey anything anyone tells her to do. When her mother passes away, she is cared for by her thoughtless and greedy father who remarries a …loathsome woman with two treacherous daughters. This modern-day, fantasy Cinderella story features fairies, ogres and elves...as well as a hero in the guise of Prince Charmont, whom Ella falls in love with. Unlike Cinderella though, she must depend on herself and her intelligence to get her through her troubles and find Lucinda in order for her "curse" to be broken! (Read More)
| Subgenre: | martial artsfairy taleswashbucklerrock musical |
| Themes: | herodanceweddingracismtheftmythology |
| Locations: | castle |
| Characters: | family relationshipsfather daughter relationshipstepmother stepdaughter relationship |
| Story: | sword fightmodern dayyoung womanswordbased on novelviolencedancingchasefistfighthorsearrestbrawlshowdownhand to hand combatkung fu …foot chasesnakebrunettedisarming someonecursetied upprincestrong female characterspearassassination attemptquestslaverygiantclubstrong female leaddamsel in distressfairydiscriminationdungeonwedding receptionstick fightelfhorseback ridingspellfemale herofemale martial artistchainedlong brown hairogrecinderellacomic violenceserpentcoronationmild violencefairy godmotherobediencestepsister stepsister relationshipcauldronprince charmingfan clubgiant womanhall of mirrorsmagical bookexpression taken literallyroyal ball (See All) |
U.S. Marshal deputy John Kruger is one of the toughest Marshals, his methods are to "Erase" The identities of his witnesses he is assigned to protect. Meanwhile, a woman named Lee Cullen who works for a corporation named Cyrez performed an undercover job for the FBI to unveil a top secret weapon whi …ch uses an electromagnetic pulse to dispatch targets. Cyrez discovered this about Lee and are now out to kill her, Kruger's job is now to protect Lee so she can testify against Cyrez. But, when Kruger was assigned to perform a job with another Marshal named Robert Deguerin, he discovers that Deguerin is behind some kind of scam that will involve the EM Gun, which will change hands to a Russian criminal if Kruger does not stop them, Kruger must not only protect Lee's life but his own. (Read More)
| Subgenre: | conspiracymartial arts |
| Themes: | heromurderdeathsuicidekidnappingbetrayalgangsterdeceptioncorruptionbrutalitymafia |
| Mood: | goreneo noirnight |
| Locations: | trainhelicoptertrucksan francisco californiausagay barcar bombhospital fight |
| Characters: | villainfather son relationshiphostagetough guyaction herohitmansecurity guardsnipersniper riflerussian mafiabetrayal by friend |
| Period: | 1990s20th centuryyear 1996 |
| Story: | handskillweaponcharacter name in titlebloodviolenceone word titleguncigarette smokingexplosionknifechasesurprise endingpistolfire …shootoutshot to deathblood splattermachine gunshotgungunfightfalling from heightshootingshowdownhand to hand combatrevolvershot in the backspyfoot chaseassassinbound and gaggedambushnew yorkcaliforniastabbingexploding carone man armydouble crosson the runone against manykaratefbiopening action scenebodyguardexploding bodywitnessneck breakingtied upsemiautomatic pistolsevered armsilencerespionagewashington d.c.crime bossmachismoidentitytraitoruzisabotageassassination attemptheroinelifting someone into the airblockbusterfaked deathlaserbroken leggun battleeaten alivepresumed deadpump action shotgunwoman in jeopardycameocynicismdual wieldzoogunshot woundspyingbody landing on a carlasersightlaser gundrugged drinkmob bossdesert eagleyellingstabbed in the handpistol whiptreasonarms dealerquick drawcrocodileglockdouble barreled shotgunsawed off shotgununsubtitled foreign languagecdski maskbody bagalligatorshot through the mouthmafia bossshot in the footrogue agentexploding housewoman shotwitness protectionrookiegas explosionx rayed skeletonprotectionshoulder holsterskydivingleaving homecorporate crimegarroteu.s. marshaldefibrillationcold blooded murderwitness protection programadvanced technologytwentieth centurysecurity guard killedcar hit by a traingas leaksecurity guard shotx ray visioncomputer systemsecurity agentrailgunexperimental weaponloading dockdead woman on the flooragent killedhouse burning (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com