Please wait - finding best movies...
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | psycho thrilleramerican horrorsupernaturalblack comedy |
| Themes: | supernatural powerevilpsychopathdeath |
| Mood: | slashercar chaseraingore |
| Locations: | water gunschool buschicago illinois |
| Characters: | slasher killerserial murdererserial killernew studentterrorvillainkillerteacherboyhusband wife relationshippolice |
| Period: | 1990s |
| Story: | psycho terrorevil dollpsycho killerkiller dollpsycho filmtoy factoryhomicidal maniacevil smilevillain not really dead clicheevil spiritpsychopathic killerevil mansadistic psychopathscore employs electronic instrumentsreflection in a car mirror …suffocated with plastic bagreference to hansel and gretelfoster sisterthrown down stairschild smoking a cigaretteelectric knifefoster parentinghiding under the coversreference to pinocchionewspaper manxeroxdisbelieving adultaccused of murderfalse accusation of murderfoster fathertrail of bloodlocked in a closetfoster motherthrown through a windshieldcar phonegruesomefoster parentassembly linechantfoster homemidwestfire alarmbedtime storyliquor storedripping bloodlocked in a roomdigging a gravebutcherybloody violenceorchestral music scorehiding under a bedactress shares first name with charactersewing machinehead bashed inhanging upside downyuppieclimbing through a windowburnt faceelementary schoolhiding in a closetsequel to cult favoritebad guymadmansuffocationframed for murdersevered legpajamassocial workervoodoostabbed in the eyeraised middle fingereye gougingswingthrown through a windowexploding headstabbed in the legshovelbutcherblack humorsevered handpsychonosebleedlifting someone into the airtied to a bedtoygothicburned alivefalling down stairsmaniacdeath of husbandobscene finger gesturethreatened with a knifeneck breakingmurdererbasementlightningdollpossessionbeaten to deathelectrocutionlimousinechild in perilfalse accusationtied to a chairstabbed in the cheststabbed to deaththroat slittingambulancestrangulationbound and gaggedfoot chaseapostrophe in titlesecond partheld at gunpointfalling from heightslow motion scenecar accidentdigit in titlecorpsepunctuation in titlesingingcigarette smokingsequelblood (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | psycho thrilleramerican horrorsupernaturalcult filmparanormal phenomenaslasher flickteen horror |
| Themes: | supernatural powerevilpsychopathdeathmurderprisonmonsterinsanitymurder of a police officer |
| Mood: | slashercar chasegoredarknessbreaking the fourth wall |
| Locations: | forestcemeterysmall townboatwoodslakeamerica |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpoliceteenagerzombiesheriff |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathbutcherybloody violencesequel to cult favoritebad guymadmansevered legbutcher …shovelpsycholifting someone into the airgothicmaniacneck breakingmurdererelectrocutionstabbed to deathambulancesequelsexcharacter name in titlenumber in titleviolenceflashbacksurprise endingblood splattermasknumbered sequeldemondecapitationflashlightmassacrestabbingsevered headchildlooking at the cameradrowningstalkingunderwatersevered armdismembermentkillingundeadblood spattersplattermass murdermachetemutilationvictimback from the deadmasked manrampagenew jerseystabbed in the headslaughterbody countkilling spreebloodbathmasked killerserial murderbeheadingkillsummer campslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesheart ripped outfemale victimoff screen murdermurder spreeghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | psycho thrilleramerican horrorsupernaturalblack comedyindependent filmcult filmdark comedyparanormalindependent horror |
| Themes: | supernatural powerevilpsychopathdeathmurdersurrealismdrugsghosttorturedeath of motherinsanitysadismamnesia |
| Mood: | slasherraingorehigh schoolnightmaredarkness |
| Locations: | small townairplaneroad trip |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteacherfamily relationshipsfather son relationshipfather daughter relationshipteenagerself mutilationyounger version of characterdeafnessgerman american …evil father (See All) |
| Period: | 1990s1970s1960s1940s1950s |
| Story: | psycho terrorpsycho killerhomicidal maniacevil spiritpsychopathic killerevil mansadistic psychopathgruesomemidwestbutcherybloody violenceburnt facebad guymadmanraised middle finger …thrown through a windowexploding headbutcherpsychogothicburned alivefalling down stairsmaniacmurdererbeaten to deathchild in perilstabbed in the cheststrangulationapostrophe in titlefalling from heightslow motion scenepunctuation in titlesequelbloodf ratedcharacter name in titleviolenceflashbackbare chested maletitle spoken by characterknifefiretitle directed by femaledreamblood splatterrescuedemoncriminalsubjective cameragood versus evilimpalementboxingmapchild abusedrawingshot in the legcharacter repeating someone else's dialoguestatueknocked outkicked in the facescene during end creditsexploding bodykillingundeadchild murderkilling an animalhead buttscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothvictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotch3dparachutemurder of a childslaughterdisfigurementknife throwingdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationstonercameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterlunaticmurder spreeanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hilldream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | psycho thrilleramerican horrorsupernaturalindependent filmcult filmsuspenseparanormal phenomenaslasher flickcanadian horror |
| Themes: | supernatural powerevilpsychopathdeathmurderrevengesuicidekidnappingghostfeartorturedrunkennessdeath of fatherbrutalitydeath of mother …insanityabductiontraumafear of water (See All) |
| Mood: | slasherraingorehigh schoolnightmarebreaking the fourth wallblood and gore |
| Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombielittle girlsheriff …mysterious villain (See All) |
| Period: | 2000s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacvillain not really dead clicheevil spiritpsychopathic killerevil mansadistic psychopathdisbelieving adultgruesomemidwestdripping bloodbutcherybloody violence …hanging upside downburnt facebad guymadmaneye gougingbutchersevered handpsycholifting someone into the airburned alivemaniacneck breakingmurdererelectrocutionchild in perilfoot chasefalling from heightslow motion scenecorpsesequelbloodcharacter name in titleviolenceflashbackphotographexplosionpartysurprise endingpistolshowerfirevoice over narrationdreamblood splatterbrawlmaskcar crashdemondecapitationstabbingimpalementsevered headdream sequenceunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on firecharacter's point of view camera shotcover updeath of childdeath of brotherhigh school studentstalkingpremarital sexcabinsevered armdismembermentkillingundeadsplatterchild murderheroinemass murdermachetecomaragemutilationvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingtorso cut in halfblood on camera lensserial murderbeheadingmysterious manfinal showdownnecrophiliakilldockohiosummer camplockersexual violencestonerslashingdomineering motherflaskcornfielddeputywrist slittingkidnapperchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villaindeformityfemale victimpsychotronic filmbreaking through a doormurder spreemass murdererghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorjason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror |
| Themes: | supernatural powerevilpsychopathdeathmurdertorturebrutalityinsanitysadism |
| Mood: | slashergorebreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerboybrother sister relationshipteenage girlteenage boymysterious villainmysterious killer |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathgruesomebutcherybloody violencebad guymadmanbutcherpsycholifting someone into the air …maniacobscene finger gesturemurdererchild in perilstabbed to deathstrangulationcorpsesequelbloodsexfemale nuditynumber in titlemale nudityviolencebare breastsfemale frontal nuditymasturbationmale rear nudityfemale rear nuditysurprise endingpantiesunderwearblood splattermasklow budget filmsubjective cameradecapitationimpalementsevered headlooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotstalkingpremarital sexcabinloss of motherkillingsexual attractionragemutilationmorguefourth partgrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerserial murdercar troublemysterious manstabbed in the handkillhuman monstersummer campslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderdeformitylunaticmurder of a nude womanmurder spreedisturbed individualgrindhouse filmcrime spreedeeply disturbed persondisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastjason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | american horrorindependent filmcult filmslasher flickteen movieteen horrorindependent horror |
| Themes: | supernatural powerevilpsychopathmurderrevengesurrealismfuneral |
| Mood: | slashergorehigh schoolnightmareavant garde |
| Locations: | cemeterybathtubpolice station |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlalcoholicpolice chaseself mutilation …mysterious villainpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | psycho terrorhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathtrail of blooddripping bloodbutcheryclimbing through a windowburnt facebad guymadmanbutcherpsycho …lifting someone into the airgothicburned alivefalling down stairsmaniacstabbed in the cheststrangulationfoot chasefalling from heightslow motion scenecorpsecigarette smokingbloodviolencebare chested malesurprise endingdreamblood splattermirrorface slaparrestbeddemonjailclassroomtelephonesubjective cameragood versus evildeath of friendhousecoffeeperson on firefirst of seriescharacter's point of view camera shothangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterelectronic music scorehatcrucifixgrindhousevictimstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockserial murdervigilantismloud sex15 year oldfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linegrindhouse filmplant in titlecreepglovehit with a chairface ripped offchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou …s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)
| Subgenre: | psycho thrillerindependent filmcult filmstop motion animationslasher flick |
| Themes: | supernatural powerpsychopathmurderrevenge |
| Mood: | slasher |
| Locations: | chicago illinoiscarelevatorapartmentpolice station |
| Characters: | serial killerboymother son relationshippolice detectivehomeless manwitch doctor |
| Period: | 1980swinter |
| Story: | evil dollkiller dollvillain not really dead clichedisbelieving adulttrail of bloodchanthiding under a bedhiding in a closetframed for murdersevered legvoodoothrown through a windowstabbed in the leglifting someone into the airtoy …gothicburned alivemaniaclightningdollpossessionelectrocutionchild in perilfalse accusationstabbed in the chestfoot chaseapostrophe in titlefalling from heightcorpsepunctuation in titlecigarette smokingbloodknifepistolshootoutshot to deathblood splatterurinationbirthdaycar crashshot in the backsubjective cameradecapitationdeath of friendwidowsubwaysevered headshot in the legperson on firefirst of seriescharacter's point of view camera shotknocked outattempted rapeshot in the shoulderfirst partsevered armdismembermentfreeze frametv newselectronic music scorebabysitterback from the deadbroken legreverse footagetensionchild's point of viewdark humorfalling to deathmental hospitalbody landing on a carblack magicgunfireplanthit with a baseball batpresentstabbed in the handhead blown offhuman monsterwhodunitdepartment storescalpelelectric shockpolice interrogationbitten in the neckbumburnt bodysole black character dies clicheexploding househit with a hammerbreaking through a doorfootprintjewelry storetauntingmuralbandaged handtoy storebitten on the armremadevoodoo dollfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatchesfloursoul transferencegingershot in the hearttwo killersleg blown offanimatronicattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapyhead spinlightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmindependent horror |
| Themes: | evilpsychopathdeathmurderdrugsrapetortureincestbrutalityinsanityexploitationmurder of family |
| Mood: | slashergore |
| Locations: | chicago illinois |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipprostitutemysterious villainmurder of a prostitute |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathgruesomebutcherybad guymadmanstabbed in the eyebutcherpsychomaniacneck breaking …stabbed in the cheststabbed to deathstrangulationbloodfemale nuditycharacter name in titlenudityviolencebare breastsgunsurprise endingshot to deathblood splattershot in the chestlow budget filmmarijuanacriminaldecapitationbisexualvideo camerastabbingdrug dealerchild abusesevered headcontroversypantyhosestalkerattempted rapestalkingdismembermentkillingsplatterfemale stockinged legsragemutilationstabbed in the stomachrapistrampagelow budgetdark humorpsychotronicperversionmurder of a childslaughterabusive fatherbody countkilling spreepervertserial murdervillain played by lead actormysterious mankillhuman monstersexual violenceslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecesoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualgrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmsuspenseb horrorindependent horror |
| Themes: | evilpsychopathdeathmurderfearbrutalityinsanityexploitation |
| Mood: | slashergoredarkness |
| Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipmysterious villainmysterious killer |
| Period: | 1980ssummeryear 1984 |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathgruesomebutcherybloody violenceorchestral music scorebad guymadmanbutcherpsycho …lifting someone into the airgothicmaniacobscene finger gesturemurdererthroat slittingstrangulationsecond partslow motion scenedigit in titlecorpsesequelbloodsexfemale nuditynumber in titleviolencefemale frontal nudityflashbackkissfightnipplessurprise endingpantiestelephone callblood splatterblondecatbikinimaskdead bodynumbered sequelsubjective cameraswimmingdecapitationbramassacreimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotopening action sceneconvertiblestalkinglove interestkissing while having sexkillingsplatterchesschainsawfireplacespearnipples visible through clothingmass murdermacheteragemutilationvillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onekilling spreepsychoticmasked killernude swimmingserial murdercar troublemysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violenceslashingwetting pantshillbillyday in titletow truckparaplegicmultiple murdermasked villainknife murderpitchforksole survivorlunaticpsychotronic filmmurder of a nude womanmurder spreedying during sexgrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicideweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storyjason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult film |
| Themes: | evilpsychopathdeathmurderrevengefearbrutalityinsanitysadismexploitationpolice investigation |
| Mood: | slasherraingorenightmarenightdarkness |
| Locations: | cemeterysmall townwoodsamericabackwoods |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolicemother son relationshipteenagerbrother brother relationshipsheriffmysterious villainmysterious killercountry boy |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcherybloody violenceorchestral music scoresequel to cult favoritebad guymadmanstabbed in the eyeeye gougingbutcher …psycholifting someone into the airmaniacobscene finger gesturemurdererchild in perilthroat slittingdigit in titlebloodsequelsexfemale nuditynumber in titleviolencebare breastsfemale frontal nuditykissdancingchasesurprise endingpantiesblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacreimpalementgravestalkercharacter's point of view camera shotdeath of brotherstalkingdeath of sonkissing while having sexchainsawmachetemutilationbarnstabbed in the stomachgrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanpsychotronicslaughterbody countaxe murdercharacters killed one by onefifth partpsychoticmasked killerserial murdercar troublemysterious manlaundrydefecationhuman monstersummer campcomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violencestabbed in the facemasked villainknife murdercut into piecesfemale victimlunaticpsychotronic filmmurder of a nude womanmurder spreedisturbed individualgrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicideweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmparanormal phenomenaslasher flickteen horror |
| Themes: | supernatural powerevilpsychopathdeathmurderrevengemonsterdrug addictionmurder of a police officer |
| Mood: | slasherraingorehigh school |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationshipmysterious villain |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcherysequel to cult favoritebad guymadmanstabbed in the eyebutcherpsycholifting someone into the airmaniac …electrocutionstabbed to deaththroat slittingstrangulationsequelbloodfemale nuditycharacter name in titlenumber in titleviolencebare chested maleexplosionpantiesblood splattermirrornumbered sequeldemonhallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkaxevideo camerastabbingimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantiescharacter's point of view camera shotattempted rapeunderwaterundeadhypodermic needlemutilationback from the deadmasked manmale underwearrampagenew jerseyblack bradead childdisembowelmentslaughterbody countcharacters killed one by onemasked killerserial murderbeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | psycho thrilleramerican horrorsupernaturalindependent filmcult filmstop motion animation |
| Themes: | supernatural powerevilpsychopathdeathmurderghostfuneralmonsterinsanitysadism |
| Mood: | slashergorenightmare |
| Locations: | barchurchcemeteryschool boy |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherself mutilation …alcoholic fatherevil nurse (See All) |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacvillain not really dead clicheevil spiritpsychopathic killerevil mansadistic psychopathbutcherydigging a gravebloody violenceburnt facebad guymadmanpajamasstabbed in the eye …stabbed in the legbutcherlifting someone into the airtied to a bedfalling down stairsmaniacmurdererbasementdollchild in perilstabbed in the cheststabbed to deathfoot chasefalling from heightslow motion scenedigit in titlecorpsecigarette smokingsequelfemale nuditynumber in titleviolencebondagebare chested malesurprise endingfiredreamblood splatterthongbedrock musicbathroomnumbered sequeldemondecapitationnewspaperstabbingdeath of friendimpalementsuicide attemptnundream sequenceradiotonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phoneskeletonisolationcharacter says i love youkillingundeadsplatterteen angstelectronic music scorecomaragecrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathhypnosisstairsschool uniformdead childjumping through a windowknife fightfogdisfigurementbody countcharacters killed one by onekilling spreesmokeserial murderalleyreturning character killed offohioabandoned housestabbed in the armslashinggroup therapyboy with glassesbody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setmattressgymnasticsmurder spreeghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | psycho thrilleramerican horrortragedyslasher flick |
| Themes: | evilpsychopathdeathmurdersuicidekidnappingrapetorturebrutalitydysfunctional familyinsanitysadismhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | slashergoredarknessblood and gore |
| Locations: | small townstrip club |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyteenagerafrican americanboyfriend girlfriend relationshiphostagepsychiatristsheriff |
| Period: | 1970s |
| Story: | psycho terrorpsycho killerpsycho filmvillain not really dead clichepsychopathic killerevil mansadistic psychopathmidwestdripping bloodbutcherybloody violencebad guymadmanbutcherpsycho …lifting someone into the airmaniacmurdererbeaten to deathchild in perilstabbed in the cheststabbed to deaththroat slittingstrangulationfalling from heightcorpsebloodsexfemale nuditymale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifechasepistolwoman on topbeatingblood splatterremakeshot in the headmaskdead bodytelevisionstrippershot in the backf wordsubjective cameramassacrestabbingimpalementjokecontroversygraveyarddrowningauthorstabbed in the backattackuniformcharacter's point of view camera shotbaseball bathangingshot in the shoulderstalkingpremarital sexloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderrageloss of friendpsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childdark pastbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerhit with a baseball batpervertmexican americanserial murderporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbutcher knifeloss of familyfemale victimmurder spreedying during sexanimal killingmass murdererjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicideweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
It's been eight years since the events in the second film, we now see that Andy is a teenager who has been enrolled in a military school. Play Pals Toy Company decides to re-release its Good Guys line, feeling that after all this time, the bad publicity has died down. As they re-used old materials, …the spirit of Charles Lee Ray once again comes to life. In his search for Andy, Chucky falls into the hands of a younger boy, and he realizes that it may be easier to transfer his soul into this unsuspecting child. Andy is the only one who knows what Chucky is up to, and it's now up to him to put a stop to it. (Read More)
| Subgenre: | black comedy |
| Themes: | supernatural powerdeathself sacrifice |
| Mood: | slashergore |
| Locations: | campfiremilitary school |
| Characters: | serial killerboyhostagebullysecurity guard |
| Period: | 1990s |
| Story: | evil dollkiller dolltoy factoryvillain not really dead clichelocked in a closethiding under a bedhiding in a closetframed for murdersevered legvoodooraised middle fingerblack humorsevered handlifting someone into the airtoy …gothicthreatened with a knifedollpossessionfalse accusationthroat slittingambulancestrangulationbound and gaggedheld at gunpointfalling from heightslow motion scenecorpsecigarette smokingbloodsequelphotographknifechasepistolshot to deathblood splattermachine gunshot in the chestpunched in the faceriflerevolversubjective cameraflashlightmapradiothird partcigar smokingshot in the legshot in the foreheadcharacter's point of view camera shotstorytellingtentamerican flagexploding bodysevered armshot in the armhaunted houselove interestdismembermentheart attackhand grenadeelectronic music scoresergeantcarnivalcolonelcrushed to deathhaircuttarget practicegash in the facepunched in the stomachresurrectiondark humoraccidental killinglipsticklieutenantnewspaper clippingreturning character killed offtv commercialbarberpush upsbunk bedstabbed in the shouldergarbage truckcarouselcut into piecesscythepackagehide and seekpaintballvietnam war veteranstraight razorreturning character with different actorcanteenfunfairhand cut offdartsevered faceyo yomarblearm blown offhit with a golf clubcampfire storypaintball gungarbagemanmilitary exercisepolishing shoestoy companytoy helicoptermilitary cadetplaypen magazinefog machine (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | american horrorsupernaturalcult filmparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | supernatural powerevilpsychopathdeathmurderfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurismbrutality …paranoiasadismpanicmysterious deathshower murder (See All) |
| Mood: | slasherraingorehigh schoolnightmaredarknesspoetic justice |
| Locations: | school busbarschoolswimming poolsmall townbusdesertbaseballstormgay barbus driverabandoned factoryschool bus driver |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteacherboyhusband wife relationshipfamily relationshipshomosexualfather son relationshipmother son relationshipfather daughter relationship …teenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clicheevil spiritpsychopathic killerevil mansadistic psychopathscore employs electronic instrumentsbutcheryburnt facebad guymadmanraised middle fingerbutcher …psycholifting someone into the airgothicburned alivemaniacobscene finger gesturethreatened with a knifemurdererbasementlightningpossessionchild in perilstabbed in the cheststabbed to deathfoot chasesecond partslow motion scenedigit in titlecigarette smokingbloodsequelcharacter name in titlenuditynumber in titlemale nudityviolencemale rear nuditybondagedogbare chested malefightpartyknifechasesurprise endingshowertelephone callfirecryingdreamunderwearblood splatterface slapshotgunwatching tvundressingbikinibare buttsunglassesplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective cameraname in titlemassacrestabbingbasketballimpalementfootballsnakeapologydream sequencebirdcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotkicked in the facescreamdiaryconvertiblegymhigh school studentexploding bodyratcharacter says i love youclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstkilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggay characterlooking at oneself in a mirrorlistening to musicjoggingmutilationmousestabbed in the stomachbarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationserial murdertaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesbroken windowfish tankslashingbroken mirrorbus stopsplit personalitypush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodybreaking a mirrorgrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | american horrorindependent filmcult filmslasher flickteen horror |
| Themes: | evilpsychopathdeathmurderrevengefeardeceptionsurveillancemurder of a police officer |
| Mood: | slashergoresatire |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | slasher killerserial killervillainkillerteenage girlteenage boynursesecurity guardpsychiatristcoroner |
| Period: | 2000s |
| Story: | homicidal maniacpsychopathic killerevil mansadistic psychopathlocked in a roomhanging upside downclimbing through a windowhiding in a closetsequel to cult favoritebad guyraised middle fingerlifting someone into the airmaniacobscene finger gesturethreatened with a knife …neck breakingmurdererlightningelectrocutionstabbed in the cheststabbed to deaththroat slittingambulancestrangulationfoot chasefalling from heightcorpsesequelbloodfemale nudityviolenceflashbacktwo word titlefightknifechasesurprise endingfirecell phoneblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenflashlightaxemontageimpalementinternetsevered headpolice officer killednews reportstabbed in the backcharacter's point of view camera shotproduct placementkicked in the facecollege studentskeletondisappearancesevered armkillingchainsawheavy rainsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormgasolinebody countaxe murdercasual sexcharacters killed one by onekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murdervideo surveillancereturning character killed offold dark househuman monsterabandoned housewebcamwhodunitlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firebreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmslasher flickteen horror |
| Themes: | evilpsychopathdeathmurderdrugsparanoiainsanityabductionalcoholism |
| Mood: | slasherhigh schoolnightmare |
| Locations: | schoolsmall townelevatorkitchentruck |
| Characters: | slasher killerserial killerterrorvillainpolicefamily relationshipsmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlnursepoliceman …security guardalcoholicsecretarymysterious villain (See All) |
| Period: | 1990syear 1998 |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathbloody violencehiding in a closetbad guymadmanstabbed in the legpsycholifting someone into the airmaniac …stabbed in the cheststabbed to deaththroat slittingambulancefalling from heightcar accidentbloodsequelnumber in titleviolenceknifechasepistolmaskbirthdaydead bodyneighborhallucinationtelephonesubjective cameradecapitationgood versus evilhalloweenflashlightwinecandlecaliforniaaxestabbingdeath of friendtoiletweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorrageloss of friendhidingvictimfaked deathmasked manrampagetrappedunderage drinkingdelusionboarding schoolknife throwingbody countaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeyreflectionstolen carserial murderanniversarybeheadingcar troublemysterious manfire extinguisherreturning character killed offgateslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbutcher knifefemale victimmurder spreesittingseventh partmichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | psycho thrilleramerican horrorcult filmsuspenseslasher flickholiday horror |
| Themes: | psychopathdeathmurderjealousyfeartorturevoyeurismmemoryseductionbrutalityobsessionparanoiainsanityblindnesstrauma …madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
| Mood: | slashergorenightdarkness |
| Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpoliceteenagerboyfriend girlfriend relationshipteenage girlpolice officernursedetectivepolicemansheriff |
| Period: | 1970syear 1978 |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacvillain not really dead clichepsychopathic killersadistic psychopathmidwestdripping bloodbutcherybloody violenceburnt facebad guymadmanstabbed in the eye …eye gougingbutcherpsycholifting someone into the airmaniacmurdererbeaten to deathstabbed to deaththroat slittingambulancestrangulationsecond partcar accidentcigarette smokingbloodsequelsexfemale nuditynuditynumber in titlemale nudityviolencebare breastsmale rear nuditytwo word titlekissfemale rear nuditynipplesexplosionknifechasetelephone callfirecryingblood splattershot in the chestblondewatching tvkissingbrawlsecretmaskshootingneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstabbingaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingstabbed in the backprologuescreamingperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapsplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractioncowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolgrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead manslaughterdisfigurementdark pastbody countcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerflat tirefemale stockinged feetdead girlserial murderconfusioncar troublemysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonesuit17 year oldearringnurse uniformslashingdental maskblood stainclinicparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbutcher knifeman on firepool of bloodfemale victimscaremurder spreenude bathingsilhouettegrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidesmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package … - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)
| Subgenre: | american horrorparanormal |
| Themes: | supernatural powerevilpsychopathdeathmurderadulteryescapefuneraldeath of mothersadismmurder of a police officermurder of family |
| Mood: | slashergore |
| Locations: | cemeteryelevatorwheelchaircourtroom |
| Characters: | slasher killerserial killerterrorhusband wife relationshipfamily relationshipsmother daughter relationshippolice officersister sister relationshipaunt niece relationshipbrother in law sister in law relationship |
| Period: | year 1988year 2013 |
| Story: | evil dollkiller dollhomicidal maniacvillain not really dead clichestabbed in the eyeeye gougingstabbed in the legsevered handdollelectrocutionchild in periltied to a chairstabbed to deaththroat slittingfalling from height …slow motion scenecorpsesequelbloodcharacter name in titleviolenceflashbackknifelesbian kisssurprise endingblood splatterwritten by directorcar crashf worddecapitationaxejudgesevered headcharacter repeating someone else's dialoguestabbed in the backelectronic music scorescene during opening creditshome movieduct tape over mouthcameoblack and white scenescene after end creditsevidencedeath of sisteraxe murdernannyclose up of eyesblood on camera lenscartoon on tvbag over headold dark houseblackoutfilm projectoryoung version of characterblood stainwoman in bra and pantieseyeballwrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedstabbed with scissorsdeliverydark and stormy nighthorror iconreference to charles mansondeath by electrocutionkilled in police carmanic laughtermurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult film |
| Themes: | evilpsychopathdeathmurderkidnappingrapetorturetheftinsanitysadismphotographywritingmurder of a police officerrape and murder |
| Mood: | slashergoreneo noir |
| Locations: | barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car |
| Characters: | slasher killerserial murdererterrorvillainkillerpoliceboyfriend girlfriend relationshipwriterhostagewaitresschinese foodshooting a police officer |
| Story: | psycho terrorpsycho filmhomicidal maniacpsychopathic killerevil mansadistic psychopathgruesomebutcherybloody violenceyuppiebad guymadmanbutcherpsychomaniac …murdererstabbed to deathcar accidentcigarette smokingbloodsexfemale nuditynuditymale nudityviolenceone word titlemale rear nuditybare chested malegunfightphotographtitle spoken by characterpistolshot to deathblood splattershot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upgay slurjournalistcalifornianarrationjourneyblack pantiesstabbed in the backon the roadautomobilekillingarsontape recorderragemutilationstabbed in the stomachvictimrape victimrapistmale underwearrampagerednecktensionstabbed in the throatgash in the facedark humorblack brabilliardsperversionrainstormbody countsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertserial murderkillpistol whiphuman monsterpolice officer shot in the chestsexual violenceknocked unconscioushillbillytrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countryabusive boyfriendlunaticmass murdererbreaking a bottle over someone's headcrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartmurder of a policewomandead policewomanheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmslasher flickteen movieteen horrorholiday horror |
| Themes: | evilpsychopathdeathmurderfearcorruptionparanoiamurder of family |
| Mood: | slasherhigh schoolnight |
| Locations: | carsmall towncar theftkitchen knife |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyhusband wife relationshipteenagerteenage girlteenage boyfemale protagonistgirllittle girllittle boy …psychiatristdoctor patient relationship (See All) |
| Period: | 1970s1960syear 1963year 1978 |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathmidwesthiding in a closetbad guymadmanpsycholifting someone into the airmaniac …murdererstabbed to deaththroat slittingstrangulationfalling from heightcigarette smokingfemale nuditynudityviolenceone word titledogguntitle spoken by characterknifesurprise endingshot to deathblood splattershot in the chestwatching tvmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenstabbingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shothalloween costumelong takestalkingfirst parthandgunkillingpot smokingteen angstbulletelectronic music scorebabysittermutilationstabbed in the stomachblockbustergrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endbody countdead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerdead doggothserial murdermental patientyellingclosetkillhuman monstersuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimoff screen murderwetnessmurder spreegrindhouse filmescaped mental patientno endingpayphonelight bulbghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicideescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | psycho thrilleramerican horrorblack comedyindependent filmcult filmdark comedysurvival horror |
| Themes: | evilpsychopathdeathmurderkidnappingdeceptionincestinsanitymental illnesssadismhome invasiongreedcannibalismwealthstarvation …claustrophobia (See All) |
| Mood: | slashergoresatiredarknesssocial satire |
| Locations: | los angeles californiaslum |
| Characters: | terrorvillainboypolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
| Period: | 1990s |
| Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathclimbing through a windowhiding in a closetbad guymadmansevered handpsychogothicfalling down stairsmaniac …basementdollelectrocutionchild in perilcorpsecigarette smokingbloodviolencedogtitle spoken by characterknifepistolshot to deathblood splattershot in the chestface slapshotgunbirthdayflashlightmansionimpalementhousechild abusevanracial slurcharacter repeating someone else's dialoguesuburbdeath of childskeletoncharacter says i love youcult directorterminal illnessfireplacekilling an animalbreaking and enteringscene during opening creditsragemutilationstabbed in the stomachspidergrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordgothpervertserial murderold dark houseschemeevictionhuman monsterlighterfemale psychopathslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A …t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
| Subgenre: | psycho thrilleramerican horrormartial artssuspense |
| Themes: | evilpsychopathdeathmurderescapelonelinesshunting |
| Mood: | slashercar chasegorenightmareblood and gore |
| Locations: | barforesthelicoptersnowbicyclewoodssewer |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship |
| Period: | 1990s2000s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killerevil mansadistic psychopathgruesomebutcherybloody violencebad guymadmansevered legstabbed in the legbutcher …psychomaniacobscene finger gesturemurdererstabbed in the chestthroat slittingstrangulationfalling from heightcar accidentcorpsebloodviolenceflashbackknifechasepistolshootoutshot to deathblood splatterfistfightmachine gunshot in the headcatgunfightbrawlvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingmassacrestabbingdeath of friendbridgeimpalementone man armypolice officer killedshot in the foreheadduelkaratefbifugitivecabinwaterfallsevered armdismembermentsubtitled scenekillingwolfmutilationstabbed in the stomachhunterswat teamvictimhonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesbooby trapknife fightcommandoslaughtercaptureknife throwingdark pastbody countwar veterancharacters killed one by onekilling spreeserial murderfountainpostcardhuman monsterstabbed in the armslashingyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the faceknife murdermilitary trainingmass gravemurder spreeportland oregonsevered footdisturbed individualhoodcrime spreedeeply disturbed personauto theftjumping off a bridgebritish columbiapacific northwestdisturbingkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraybasic trainingbody partsethnic cleansingdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
| Subgenre: | american horrorsupernaturalblack comedyindependent filmmartial artscult filmsuspenseparanormal |
| Themes: | supernatural powerevilpsychopathmurderrevengefuneral |
| Mood: | slasherraingorehigh schoolnightmare |
| Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacevil spiritpsychopathic killerevil mansadistic psychopathdripping bloodbutcheryclimbing through a windowburnt facebad guybutcherlifting someone into the airmaniacmurderer …stabbed in the cheststabbed to deathambulancedigit in titlecorpsecigarette smokingsequelbloodnumber in titlefemale frontal nuditydogbare chested malephotographsurprise endingfiredreamblood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemondeath of frienddinersevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phonekicked in the faceskeletondeath of brothercheerleaderdeath of songlassesunderwatersevered armsleepingkillingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glassesmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreeserial murdervillain played by lead actorreturning character killed offneedlejunkyardohiodefecationold dark housecockroachbugweightliftingfish tankslashingbroken mirrorasthmabody in a trunkafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimmurder spreetime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | psycho thrillersupernaturalsuspenseparanormal |
| Themes: | supernatural powerevilpsychopathdeathmurdersuicidekidnappingmarriagerapeghostprisonfeartortureescapememory …paranoiadrug useinsanitymental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | slasherraingoreneo noirnightmaredarkness |
| Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshippolicefamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipdoctortattoofemale protagonist …nursepolicemanlawyerreference to godsecurity guardpsychiatristsheriffself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killerevil mansadistic psychopathbloody violencebad guymadmanframed for murderpsychogothicmaniacdeath of husband …murdererlightningpossessionfalse accusationthroat slittingfoot chasecar accidentcorpsebloodsexfemale nudityf ratedviolencefemale frontal nudityinterviewflashbackbare chested malegunkissfightphotographexplosionknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamblood splattermirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalflashlightaxevideo camerawomanbridgesuicide attemptprisonerunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellaattempted rapeinjectionpursuitstalkingtrustkillingtherapypizzasyringehypodermic needleheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingdead girlmemory lossintimidationgothserial murdervideo tapemental patientelectricitykillmental breakdownblackoutsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmateman on firetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
| Subgenre: | american horrorcult filmslasher flick |
| Themes: | psychopathdeathmurderabductionexploitation |
| Mood: | slashergoredarkness |
| Locations: | lake |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipteenage girlteenage boylow self esteemmysterious killer |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathgruesomesequel to cult favoritebad guymadmanstabbed in the eyesevered handpsycholifting someone into the airmaniacmurderer …digit in titlesequelbloodsexnuditynumber in titleshowerbikinimasknumbered sequelsubjective cameraaxeimpalementthird partcharacter's point of view camera shotcabinsevered armdismembermentsplattermass murdermacheteragebarnroman numeral in titlegrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughtercharacters killed one by onekilling spreemasked killertorso cut in halfserial murdercar troubledefecationhuman monstersexual violenceslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitypsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastjason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | evilpsychopathdeathmurderfriendshipsurrealismkidnappingrapefeartorturedeath of fatherbrutalitydeath of motherinsanitysadism …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | slashercar chasegorenightmarenightdarknessblood and gore |
| Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyhusband wife relationshippolicefamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriend …brother sister relationshipteenage girlfemale protagoniststudentbest friendfrenchbest friendsmysterious villainmysterious killerdeath of boy (See All) |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcherybloody violencehiding under a bedbad guymadmansuffocationswingbutchersevered handpsycho …maniacdeath of husbandmurdererdollstabbed in the chestthroat slittingbound and gaggedslow motion scenecar accidentcorpsecigarette smokingbloodfemale nudityf ratedviolencebare breastsfemale frontal nudityflashbackmasturbationdoggunphotographknifelesbian kisschasesurprise endingshowertelephone calldreamblood splattermirrorurinationshot in the headshotgunshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightaxemassacrestabbingimpalementhousesevered headscantily clad femalevanon the rundeath of childdeath of brotherpursuitstalkingdeath of sonsleepingeuropekillingblood spattersplatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionmurder of a childslaughterclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotdead dogbeing followedpervertblood on camera lensserial murdertaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a doghuman monsterfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiodeath of familyfeetcut into pieceslesbian subtextbutcher knifefemale victimmurder spreevineyardchainsdriving at nightdisturbed individualgrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmsuspenseslasher flickteen moviemurder mysteryteen horror |
| Themes: | evilpsychopathdeathmurderrevengefearvoyeurismcorruptionbrutalityinsanityhumiliationsadismcrueltytraumamysterious death |
| Mood: | slashergorenightdarknessblood and gore |
| Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpoliceteenagerfriendteenage boypolice officerpolicemanartistmothersheriff …truck drivermysterious villain (See All) |
| Period: | 1970s1950ssummer |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacvillain not really dead clichepsychopathic killersadistic psychopathscore employs electronic instrumentsgruesomedripping bloodbutcherybloody violenceorchestral music scorebutcherpsycho …gothicmaniacmurdererstabbed to deaththroat slittingslow motion scenedigit in titlecorpsesexfemale nuditynumber in titlemale nudityviolencebare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlesurprise endingpantiesbeatingblood splatterfistfightblondebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manaxemassacrestabbingwomandineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticphysical abuset shirtjoyserial murdersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathslashingjacketdying manrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violencesexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowsole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdermurder spreegrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storyjason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gameknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | supernaturalblack comedycult filmconspiracy |
| Themes: | supernatural powerpsychopathdeathmurderloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfearescapewedding …deceptionseductionrobberybrutalityparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
| Mood: | slashercar chasegorepoetic justice |
| Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
| Characters: | serial killerpolicehomosexualteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepriesthostagethiefpolice detective …maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
| Period: | 1990s |
| Story: | evil dollkiller dollhomicidal maniacvillain not really dead clicheaccused of murderfalse accusation of murderburnt facesequel to cult favoritesuffocationframed for murdervoodooraised middle fingerthrown through a windowblack humortoy …gothicmaniacobscene finger gesturelightningdollelectrocutionfalse accusationtied to a chairstabbed in the chestthroat slittingstrangulationheld at gunpointslow motion scenecar accidentcorpsecigarette smokingbloodsequelsexcharacter name in titleviolencebare chested malegunkissfightphotographknifechasesurprise endingpistolfirecryingcell phonebeatingshot to deathblood splattermirrorshot in the chestrescuewatching tvbare buttlettershowdownrock musiccar crashdead bodymarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushmansionmontagebridgeimpalementexploding cardisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roompay phonefugitiveumbrellarace against timeknocked outbaseball batskeletonringscarfishnet stockingsstalkingfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upnewspaper headlinearsoncorrupt copprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttheavy rainsociopathscene during opening creditsragemutilationfourth partspiderphone boothskullbirthmexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingtrailertied feetdead woman with eyes openprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lensharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut updisposing of a dead bodytrailer homeframedmasturbation referencebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victiminnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterhandcuffed to a bedairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersmultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | american horrorsupernaturalindependent filmcult filmsuperheroparanormalstop motion animationslasher flickbody horrorurban fantasy |
| Themes: | supernatural powerevilpsychopathdeathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationbrutalitydepressioninsanity …sadismtrauma (See All) |
| Mood: | slashergorenightmare |
| Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerboyfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationship …doctorfemale protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacevil spiritpsychopathic killerevil mansadistic psychopathgruesomemidwestdripping bloodbloody violencebad guymadmanlifting someone into the air …falling down stairsmaniacmurdererdollpossessionambulancefoot chasefalling from heightslow motion scenecar accidentsequelbloodsexfemale nudityf ratednudityviolencebare breastsflashbackbare chested malegunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodwatching tvbare buttshootingplace name in titlebedcar crashdemonhallucinationgood versus evilflashlightdisguisestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnescreamskeletonstalkingautomobilepremarital sexsevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framewaiterteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingmale objectificationserial murdervillain played by lead actortaking a showergiving birthmental patientmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipoplocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of loverultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book arthand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath …ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmtragedy |
| Themes: | evilpsychopathdeathmurderrevengerapereligionjealousytortureinvestigationangerinsanitygreedmurder investigation |
| Mood: | slasherraingoreneo noir |
| Locations: | hospitalbarhelicopternightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteacherhusband wife relationshippoliceprostitutedetectivephotographerlawyerinterracial relationshiplust …security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All) |
| Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathbad guymadmansevered handpsychotied to a bedgothicmaniacmurdererambulancefoot chase …held at gunpointcar accidentdigit in titlecorpsebloodnumber in titleviolenceone word titleinterviewdogbare chested malephotographtitle spoken by characterchasesurprise endingpantiespistolshootoutshot to deathblood splattershot in the headshotgunarrestinterrogationprostitutionhandcuffsrevolvercriminaldecapitationgay slurflashlightdinersubwaywhite pantiessevered headscantily clad femalehit by a carnews reportshot in the foreheadattempted murderlibrarysadnesstied uptypewriterkillingfreeze framegirl in pantiestv newscard gamepokertape recordersociopathmutilationfbi agentcrucifixloss of wifeblockbusterswat teamrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingbody countboxkilling spreeage differencedead dogserial murderalleycartoon on tvkillhuman monsterspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettimurder spreebarbershopmass murdererinnocent person killedcrime spreestairwellpolice partnerjumping from a rooftopwriting in bloodel trainswatpolice protagonistbreaking down a doorcreepysleeping pillsreference to ernest hemingwaydisturbingfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | independent filmcult filmsuspenseslasher flickaustralian horrorsadistic horror |
| Themes: | evilpsychopathdeathmurderkidnappingrapedrinkingfeartorturedrunkennessescapebrutalityinsanitysadismabduction …exploitationcruelty (See All) |
| Mood: | slashercar chasegorenightdarknessblood and gore |
| Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilationmysterious villainmysterious killer |
| Period: | year 1999 |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathbutcherybloody violencebad guymadmanbutcherpsychomaniacobscene finger gesture …murdererfalse accusationstabbed to deathbound and gaggedheld at gunpointslow motion scenecar accidentcorpsesingingcigarette smokingbloodviolencedogtwo word titlegunkissphotographtitle spoken by characterexplosionpartyknifechasebased on true storysongshot to deathblood splattermirrorshot in the chesturinationshot in the headshotgundrinkvomitingriflesunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightmassacrevideo camerastabbingimpalementcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partdismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencestrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathdrugged drinkreflectionpervertserial murderbarking dogcar troublemysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upsole survivorfemale victimkangaroocar rollovermurder spreemass murdererdriving at nightdisturbed individualgrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
| Subgenre: | psycho thrilleramerican horrorindependent filmcult filmsuspensepsychological horror |
| Themes: | psychopathdeathmurdermarriagemoneyfearfuneraldeceptionvoyeurismdivorcetheftguiltinsanitydatingmental illness …unrequited lovemadness (See All) |
| Mood: | slasherraindarknessbreaking the fourth wall |
| Locations: | churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefpsychiatristsecretarysheriff |
| Period: | 1960syear 1960 |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathfalse accusation of murderbutcherybloody violencebad guymadmanbutcherpsycholifting someone into the airfalling down stairs …maniacthreatened with a knifemurdererbasementstabbed in the cheststabbed to deathcorpsebloodbased on novelviolenceone word titleinterviewflashbackbare chested malephotographsurprise endingshowertelephone callvoice over narrationunderweararrestundressingsecretbathroomjailhallucinationvoyeursubjective cameragood versus evilnewspaperbracaliforniadisguisestabbingwomanwidowtoiletbirdbathold womanstalkerwidowerfirst of seriescharacter's point of view camera shotmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnesstrapfirst partcross dressingkillingprivate detectiveeyeglassesfemale stockinged legsbreaking and enteringlooking at oneself in a mirrorfaintingmutilationblockbusterimpersonationphone boothgrindhousevictimskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathpsychoticfemale stockinged feetimpotenceserial murdervillain played by lead actormysterious mandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricideknife murderfemale victimreclusemurder of a nude womanmurder spreesilhouettefade to blackpeep holedisturbed individualgrindhouse filmcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in … the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensesurvival horror |
| Themes: | evilpsychopathdeathmurderrevengekidnappingtortureescapeinvestigationangerlonelinessobsessioninsanitymental illnesssadism …abductionwritingmadnessmurder of a police officerclaustrophobia (See All) |
| Mood: | neo noirdarkness |
| Locations: | helicoptersnowsmall townwoodswheelchairsnow storm |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillernursewriterhostageshooting a police officermysterious killerbaby killer |
| Story: | psycho killerhomicidal maniacvillain not really dead clichepsychopathic killersadistic psychopathgruesomebutcherybloody violencebutcherpsychomaniacobscene finger gesturemurdererbasementslow motion scene …car accidentbloodbased on novelviolenceone word titlegunfighttitle spoken by characterknifesurprise endingbeatingshot to deathshot in the chestshotgunrescuecar crashsubjective camerastabbingwomansearchduelattempted murderauthorcharacter's point of view camera shotisolationpigtypewriterkillingsociopathragemutilationcaptivevillainesspsychologydesperationvictimfemale killerbroken legrampagetensionthunderfanfight to the deathmedicationmurder of a childhighwaydark pastpsychoticnewspaper clippingphysical abuseintimidationserial murdernovelold dark househuman monsterfemale psychopathslashingblizzardfemale villainevil womanmatchidolmurderesspsychological torturereclusepsychotronic filmsledgehammercreepmysterious strangerscrapbooktauntingdeeply disturbed personbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killerweirdocreepychild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backdark and stormy nightdrive in classicbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womanmeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolmale victimserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | psycho thrilleramerican horrorblack comedysuspensesuperherotragedysurvival horrorteen horrorpsychological thriller |
| Themes: | psychopathdeathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeceptionvoyeurismdeath of father …brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
| Mood: | slashergoreneo noir |
| Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerhostagesecurity guardpsychiatrist …uncle niece relationshippolice dog (See All) |
| Period: | 2010s |
| Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathlocked in a roombloody violencebad guypsychomaniacmurdererbasementambulancesecond part …held at gunpointcorpsebloodsequelviolenceone word titleflashbackdogbare chested maledancingtitle spoken by characterpartyknifechasesurprise endingpantiescell phoneshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingriflebirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightdeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkinglaptoploss of fathersuspicionkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countcharacters killed one by onekilling spreechloroformtorso cut in halfhit with a baseball batserial murdervillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite brafemale victimschizophrenicmolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | american horrorindependent filmsuspenseindependent horrorsadistic horrorslasher horrorhorror b movie |
| Themes: | evilpsychopathdeathmurdertortureescapebrutalityinsanitysadismhome invasionexploitationcrueltymurder of a police officer |
| Mood: | slashergorenightblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | serial killerterrorvillainkillerhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlhostagethiefself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All) |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcheryhead bashed inclimbing through a windowbad guystabbed in the eyebutcherpsychofalling down stairsmaniacthreatened with a knife …neck breakingelectrocutionchild in periltied to a chairstabbed in the cheststabbed to deathfoot chaseheld at gunpointslow motion scenecorpsecigarette smokingbloodfemale nuditycharacter name in titleviolencebare breastsfemale frontal nudityflashbacktwo word titlefightnipplesknifelesbian kisssurprise endingpistolbeatingblood splattermirrorshotgunpunched in the faceshowdowncar crashdead bodyhandcuffsgood versus evilsurvivalgay slurflashlightstabbingimpalementhousescantily clad femalehit by a cardangerscreamingdebtscreamactor shares first name with characterisolationtrapfirst partex convictblood spattercrime bosskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinebody countboxcharacters killed one by onebloodbathpsychoticmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderbarbed wiremysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidslashingself defensecigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathgrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | psycho thrillerblack comedyindependent filmcult filmsadistic horror |
| Themes: | evilpsychopathdeathmurderfriendshiprevengesuicidekidnappingrapebetrayalfeartortureescapedeceptionseduction …angerdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
| Mood: | gorenightmareambiguous ending |
| Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
| Characters: | serial killerterrorvillainhusband wife relationshippolicefamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitute …police officernursehostagetough guymaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | homicidal maniacpsychopathic killerevil manbutcherybad guymadmansevered legthrown through a windowstabbed in the legbutchermaniacobscene finger gesturethreatened with a knifeneck breakingmurderer …basementbeaten to deathelectrocutionchild in periltied to a chairstabbed in the cheststabbed to deaththroat slittingstrangulationbound and gaggedfoot chasesecond partheld at gunpointslow motion scenecorpsecigarette smokingsequelbloodviolenceflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nudityphotographtitle spoken by characterexplosionknifechasepantiespistolshowerfireshootoutwoman on topbeatingdreamshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescuepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownriflebeerdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalgay slurambushaxedeath of frienddrug dealerimpalementcocainefemale pubic hairwhite pantiescultdream sequenceanti herodouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runstabbed in the backscreamingclownpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigchickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterdeath of protagonistpunched in the chestjumping through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murderergrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
| Subgenre: | black comedycult filmcoming of agesuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof |
| Themes: | psychopathdeathmurderfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcebrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All) |
| Mood: | slashergoresatirehigh schooldarkness |
| Locations: | school busforestsmall townwoodskitchenpolice station |
| Characters: | slasher killerserial killervillainkillerhusband wife relationshippolicefamily relationshipsfather son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boy …female protagonistsheriffsingle fatherself referential (See All) |
| Period: | 1990s |
| Story: | villain not really dead clicheclimbing through a windowhiding in a closetframed for murderstabbed in the leglifting someone into the airfalling down stairsthreatened with a knifeelectrocutionfalse accusationtied to a chairstabbed in the cheststabbed to deaththroat slittingambulance …bound and gaggedfoot chaseheld at gunpointfalling from heightslow motion scenecar accidentcorpsecigarette smokingbloodf ratedviolenceone word titlebare chested maletitle spoken by characterpartyknifechasesurprise endingpistolfirecell phoneshot to deathblood splattershot in the chestblondeface slapshot in the headrescuepunched in the facewatching tvcomputercatarrestmaskshowdownbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalflashlightcaliforniadisguisedeath of friendweaponbrunetteno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partcult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machineteen angstrevelationnipples visible through clothingloss of virginityheroinegroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killermedia coveragenews reporterintestinesanniversaryyellingdirector cameohigh school teacherhomagevideo storediscoverypopcornwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | psycho thrilleramerican horrorblack comedyindependent filmcult filmsuspensetragedyslasher flicksurvival horrorteen horrorindependent horror |
| Themes: | evilpsychopathdeathmurderfriendshipkidnappingfeartortureescapebrutalityparanoiadysfunctional familyinsanitysadismexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | slasheravant gardedarknessambiguous ending |
| Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostageself mutilation …truck driverself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | psycho filmhomicidal maniacevil smilepsychopathic killerevil mangruesomebutcherybloody violencebad guymadmanswingbutcherpsycholifting someone into the airgothic …maniacthreatened with a knifemurdererbeaten to deathtied to a chairstabbed in the chestbound and gaggedfoot chasefalling from heightcorpsebloodviolencephotographknifechasesurprise endingvoice over narrationbeatingblood splatterurinationblondecamerawritten by directorvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalflashlightambushmassacredeath of friendimpalementdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravedangerscreamingattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigtied upfirst partchickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckchainsawropegroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murdercar troublehysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned housefarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airgrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinghell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorrohaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | evilpsychopathdeathmurderrevengesuiciderapetortureinsanitycannibalismrape and revenge |
| Mood: | slashergore |
| Locations: | desertwaternew mexico |
| Characters: | slasher killerserial killerterrorvillain |
| Period: | year 2007 |
| Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbloody violencebad guymadmanpsychomaniacbeaten to deathstabbed in the cheststabbed to deathfalling from heightcorpse …sequelfemale nuditynuditybare breastsfightexplosionsurprise endingpistolfirelickingshot to deathblood splattershot in the chestremakeshot in the headriflenumbered sequelf wordgood versus evilsurvivalgay slurstabbingarmyimpalementtrainingstabbed in the backkicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathbroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countaxe murderkilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesserial murdergiving birthhuman monsterstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancydeformitypsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit …h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
| Subgenre: | psycho thrillertragedy |
| Themes: | evilpsychopathdeathmurderrevengesuicidekidnappingrapetorturedeath of fatherbrutalitydeath of mothersadismdeath of wifecannibalism …self sacrificemadnessmurder of familyghost town (See All) |
| Mood: | slashergorehorror movie remake |
| Locations: | desertcavegas stationsuv |
| Characters: | serial killerterrorvillainkillerfamily relationshipsbrother sister relationshipteenage girlteenage boybaby |
| Period: | year 2006 |
| Story: | homicidal maniacvillain not really dead clichepsychopathic killerevil manbloody violencebad guymadmansevered legstabbed in the legburned alivemaniacmurdererstabbed in the chestfoot chasefalling from height …car accidentbloodviolencedogsurprise endingpistolblood splattershot in the chestshot in the headshotguncar crashrevolveraxeimpalementexploding carsevered headcontroversyshot in the foreheadstabbed in the backperson on firevacationbaseball batamerican flagglassesfirst partsevered armdismembermentkillingsplatterclaim in titlekilling an animalmutantragemutilationwalkie talkievictimrapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headdeath of sistertrailerminebody countaxe murdermutationkilling spreedeath of loved onemannequinserial murderhysteriacrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesdeformitystupid victimheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
| Themes: | evilpsychopathdeathsuicideghostdrunkennessbrutalityinsanityexploitationhomelessnessmurder of a police officerdeath of daughter |
| Mood: | slasherraingorenightmaredarkness |
| Locations: | hospitalhelicopterstrip club |
| Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
| Story: | homicidal maniacpsychopathic killerevil mansadistic psychopaththrown through a windshieldbloody violencehead bashed inbad guymaniacneck breakingmurdererstabbed in the cheststabbed to deaththroat slittingstrangulation …second partheld at gunpointslow motion scenecar accidentcorpsesingingsequelbloodfemale nuditynumber in titleviolencefemale frontal nudityinterviewflashbackfemale rear nuditypartychasepistolbeatingdreamblood splattershot in the chesturinationshotguncameramaskbookvomitingcar crashcafehallucinationstripperf worddecapitationhalloweenflashlightbandstabbingdeath of friendimpalementexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackhalloween costumescarstalkingglassesprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybody countbroken armaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderbeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violenceslashingdental maskfilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facefemale victimpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsedemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession …escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
| Themes: | psychopathdeathmurderfeartorturelonelinessbrutalityobsessiondepressiondrug useinsanitysadismunrequited lovephotographychildhood trauma …psychological trauma (See All) |
| Mood: | slashergoreneo noir |
| Locations: | restaurantlos angeles californiasex in public |
| Characters: | serial killerterrorvillainkillerhomosexualmother son relationshiptattooprostitutephotographermysterious villain |
| Period: | 1980s2010s |
| Story: | psychopathic killerevil manreflection in a car mirrorthrown through a windshielddripping bloodhiding in a closetbad guysuffocationsevered legmaniacthreatened with a knifestabbed in the cheststabbed to deathstrangulationbound and gagged …foot chasecorpsebloodviolenceone word titlethreesomeflashbackfemale rear nudityphotographknifecell phoneblood splatterurinationremakecomputercameravomitingcar crashbathroomneighborhallucinationvoyeursubjective camerawinecocainesubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguestabbed in the backkicked in the facetragic eventstalkingsevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetnervous breakdowndead woman with eyes openmisogynymannequinwoman in bathtubserial murdervillain played by lead actorconfusionstabbed in the handhuman monstersubway stationsexual perversionslashingbroken mirrorwoman in bra and pantiesballerinatattooed womanmeat cleaverextreme violencetied up while barefootknife murderfemale victimstrangled to deathschizophrenicbreaking through a doormurder of a nude womanmurder spreeonline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deathscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanhiding under a carmirror above bedlip piercingnasal spray (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
| Subgenre: | psycho thrillerslasher flick |
| Themes: | evilpsychopathdeathmurderrevengetorturedrunkennessbrutalitydeath of mothermurder of a police officer |
| Mood: | slashergoredarknesshorror movie remake |
| Locations: | school busforestmotorcycleboatbathtubbicyclewaterwoodspolice carlakecampfiretunnelbackwoodssex in a tent |
| Characters: | serial murdererterrorvillainkillerpoliceafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlsheriffasian americanmysterious villainblonde girlgirl nudity |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil mansadistic psychopathgruesomedripping bloodbad guysevered legstabbed in the eyestabbed in the legpsychoburned alive …maniacstabbed in the cheststabbed to deaththroat slittingstrangulationdigit in titlecorpsebloodfemale nuditynuditynumber in titleviolencebare breastsfemale frontal nuditymasturbationdogbare chested malesex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topblood splatterurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingdecapitationflashlightbracandletoplessaxemassacrevideo camerastabbingdeath of friendimpalementsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscampcovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headhit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carbody countaxe murdercharacters killed one by onearrowburned to deathpsychoticmasked killermannequinplantserial murdervillain played by lead actorbeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captiveday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimold housenakedsilhouettestupid victimjerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
Renai is interrogated by a police detective about the supernatural events in the house. While the police investigate the house, the Lambert family temporarily moves to the old house of Lorraine Lambert. Renai is haunted by a woman in white and Josh has a strange behavior at home. Meanwhile Lorraine …seeks out Elise's partners Specs and Tucker expecting to find answers. (Read More)
| Subgenre: | supernatural |
| Themes: | psychopathmurdersuicideghostinvestigation |
| Mood: | nightmare |
| Locations: | hospitalpolice station |
| Characters: | serial killerboyhusband wife relationshippolicefather son relationshipmother son relationshipbrother brother relationshipbabypolice detectivegrandmother grandson relationship |
| Period: | 1980syear 1986 |
| Story: | homicidal maniacevil spiritevil manhiding in a closetbad guythrown through a windowstabbed in the legmaniacbasementpossessionchild in perilstrangulationbound and gaggedfoot chasesecond part …corpsesequelnumber in titleflashbackphotographknifesurprise endingface slappunched in the faceinterrogationpianodemonflashlightvideo cameranonlinear timelinechild abusecharacter repeating someone else's dialogueknocked outhaunted housecross dressingsyringescene during opening creditsgas masktitle at the endfemale doctordark pastlanternnewspaper clippingmannequinhit with a baseball batclose up of eyesfire extinguisherapparitiontaserhuman monsterseancepiano playingyoung version of characterwhisperingmediumvhshit with a hammerdicebreaking through a doorvcrabusive mothertoothhidden roomdollhousered lightgrand pianovhs tapestartledhit with a frying panwearing a sound wireout of body experiencetranquilizerbaby monitorlucid dreamabused childabandoned hospitalrocking horsemetronomeimposterbookcasebone sawbreaking through a wallother worldtea kettleattacked with a knifetooth ripped outboy dressed as a girlfalling chandelierwooden chestsurgical tooltalking dollpipe wrenchmoving furniturestabbed with a needletooth falling outbarricading a doorroshambo (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
| Subgenre: | black comedyindependent filmmartial artspost modernhorror spoof |
| Themes: | deathmurderrevengekidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheftbrutality …paranoiacelebrityhome invasioncourage (See All) |
| Mood: | slashergoresatirenightmare |
| Locations: | barswimming poolhelicopterlos angeles californiaapartmentpolice stationpolice car |
| Characters: | serial killerkillerpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officerdetectiveactorhostageactresssecurity guardpolice detectivefilm director …ex boyfriend ex girlfriend relationshipdeath of girlfriendself referentialpregnant from rape (See All) |
| Period: | 1990s2000s |
| Story: | villain not really dead clichecar phonehiding in a closetsequel to cult favoriteraised middle fingerstabbed in the legfalling down stairsobscene finger gesturethreatened with a knifebasementbeaten to deathfalse accusationtied to a chairstabbed in the cheststabbed to death …throat slittingambulancestrangulationbound and gaggedfoot chaseheld at gunpointfalling from heightcar accidentdigit in titlecorpsecigarette smokingsequelbloodf ratednumber in titleviolencedogbare chested malefightphotographpartyknifechasesurprise endingpistolshowercell phonebeatingshot to deathblood splatterfistfightshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretmaskshowdownsunglassesbirthdaycar crashhallucinationhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalflashlightjournalistambushmansiontoiletno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguestabbed in the backcostumescreamingrace against timecover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationpremarital sexsuspicionactingcult directorstrong female charactereavesdroppinganswering machineentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingfemale reportercharacters killed one by onekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimwrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
| Subgenre: | psycho thrilleramerican horrorsupernaturalindependent filmcult filmsuspensetragedyparanormalparanormal phenomenacanadian horror |
| Themes: | supernatural powerpsychopathdeathmurderlovesurrealismsuiciderapechristmasfearinvestigationdeceptiondeath of motherparanoiablackmail …death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All) |
| Mood: | slasherneo noir |
| Locations: | hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck |
| Characters: | serial murdererserial killervillainteacherhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorpolice officernursephotographerbabylittle boy …psychiatristsnipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilation (See All) |
| Period: | world war two1980s1970swinterseeing the future |
| Story: | homicidal maniacpsychopathic killerbad guysevered handgothicmaniacmurdererlightningchild in perilstabbed in the chestambulanceheld at gunpointfalling from heightslow motion scenecar accident …corpsebloodfemale nuditybased on novelflashbackkissphotographtitle spoken by characterexplosionchasesurprise endingpistolfireshootoutdreamshot to deathblood splattershot in the chestrescuewatching tvbattlegunfightletterriflecar crashhandcuffsrevolvertelephonef wordreportergood versus evilflashlightmansionpoliticianman with glassesassassinationunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treeshot in the shoulderscarbodyguardtragic eventisolationpremarital sexcharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmancold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlerheavy rainsociopathcomamutilationexploding buildingloss of wifepress conferencegrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderteachingswastikacrutchesroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks … on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
| Subgenre: | independent filmcult filmsuspensefairy talepost modernpsychological thriller |
| Themes: | supernatural powerdeathmurdersurrealismkidnappingfearescapefuneralmonsterfilmmakingdeceptiondeath of fatherbrutalityparanoiacourage …near death experience (See All) |
| Mood: | slashergorenightmare |
| Locations: | hospitalswimming poolcarcemeterylos angeles californiawaterwheelchairtrucksinging in a cartruck accident |
| Characters: | serial killervillainboyhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshippolice officernurseactorpriesthostageactresssecurity guarddirector …maidfilm directorself referentialcoroner (See All) |
| Period: | 1990s |
| Story: | car phonehiding in a closetpajamasstabbed in the eyeeye gougingstabbed in the legnosebleedlifting someone into the airburned alivedeath of husbandneck breakinglimousinechild in perilstabbed in the cheststabbed to death …strangulationfoot chasefalling from heightslow motion scenecar accidentcorpsesequelbloodviolenceinterviewexplosionknifechasesurprise endingfirecell phonedreamblood splatterblonderescuepaintingvomitingshowdownsunglassesrunningbedcar crashdemonhallucinationtelevisiontelephonegood versus evilambushcaliforniamansionstabbingdeath of friendwidowsnakebrunetteno opening creditsdream sequencehit by a cartonguenews reporttransformationcoffeeparkattempted murderstalkercharacter repeating someone else's dialoguescreamingperson on firecharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodyactor playing himselfanswering machineelectronic music scorewoundhypodermic needleslow motioninjurybabysittermorguehollywood californiajumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setfilm settitle at the endalternate realitydisfigurementfemale doctordemonic possessionfilm actorburned to deathnannymedia coverageyellingmovie actorspecial effectsstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationdirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All) |
It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k …illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)
| Subgenre: | american horrorindependent filmcult filmslasher flickholiday horror |
| Themes: | evilpsychopathmurderpanic |
| Mood: | slashergore |
| Locations: | schoolcarsmall townpolice stationrooftop |
| Characters: | slasher killerserial killerteenagerteenage girlgirlsister sister relationshipmysterious villaincrying girl |
| Period: | 1980syear 1988 |
| Story: | psycho killerhomicidal maniacvillain not really dead clichepsychopathic killerevil manfoster sisterelementary schoolmadmanlifting someone into the airfalling down stairsmaniacelectrocutionthroat slittingambulancefalling from height …digit in titlesequelbloodcharacter name in titlenumber in titledoggunknifesurprise endingshot in the chestmasknumbered sequelsubjective cameragood versus evilhalloweenflashlightimpalementanimalpart of serieshit by a carpolice officer killedcharacter's point of view camera shothalloween costumepickup truckfourth parthitchhikingrampagepump action shotgunchild's point of viewseven word titlemanhuntpower outageatticbody countcharacters killed one by onekilling spreemasked killerdead dogserial murderreturning character killed offhuman monstertrick or treatingalarmteasingkiss on the lipsmatchillinoismasked villainknife murderoff screen murdermurder spreecrime spreeescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecesmall town sheriffmichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldjumpsuitthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclegirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All) |
The killer doll is back! Glen, the orphan doll offspring of the irrepressible devilish-doll-come-to-life Chucky and his equally twisted bride Tiffany. When production starts on a movie detailing the urban legend of his parents' lethal exploits, Glen heads for Hollywood where he brings his bloodthirs …ty parents back from the dead. The family dynamics are far from perfect as Chucky and Tiffany go Hollywood and get rolling on a new spree of murderous mayhem; much to gentle Glen's horror. Chucky can't believe that his child doesn't want to walk in his murdering footsteps, and star-struck Tiffany can't believe that the movie will star her favorite actress, Jennifer Tilly, who soon becomes an unwitting hostess to this new family in more ways than one... (Read More)
| Subgenre: | black comedymartial arts |
| Themes: | evilmurderkidnappingpregnancyescapefilmmaking |
| Mood: | slashergore |
| Locations: | hospitalcemeterylos angeles californiaengland |
| Characters: | serial killerkillerpolicefather son relationshipmother son relationshipactressdirector |
| Period: | 1990s2000syear 1998 |
| Story: | evil dollkiller dollvillain not really dead clichegothicobscene finger gesturedollpossessionlimousinebound and gaggedslow motion scenecar accidentsequelfemale nuditycharacter name in titleviolence …masturbationsurprise endingshowerface slapreenactmentvomitingsubjective cameradecapitationstabbingdream sequencebirthday partyfired from the jobperson on fireauditionscreamratsevered armloss of mothertwindismembermentoccultcampinterracial romancedisembowelmentsexual humoraxe murderfifth partchauffeuracidwetting pantspatricidepaparazzihollywood signdarkroomartificial inseminationsanta claus suitventriloquistset on firehermaphroditereference to britney spearsnightiecandy barreference to martha stewartincantationimmoralitytwo killersvixenvictim invited to dinneranimate dollevil versus evilmultiple birthturkey bastertwelve step programreference to john waters (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com