Please wait - finding best movies...
Karen, a single mother, gifts her son Andy a Buddi doll for his birthday, unaware of its more sinister nature. A contemporary re-imagining of the 1988 horror classic.
| Subgenre: | slasher flick |
| Themes: | artificial intelligencesuicidemurder |
| Mood: | horror movie remakegore |
| Characters: | suicide by jumpingslasher killerpolice detectivesingle mothermother son relationship |
| Story: | black white friendshipreference to mickey rooneybreaking a legdriverless carreference to medusacat scratchreference to tupac shakurdisgruntled employeehedge trimmerreference to zorrocreepy dollafro americanwoman wrapped in a towelhorror icontoy company …hearing impairedgarbage chutetoy factorytable sawsingle momcustomer servicereference to ebaydeaf childreference to robin hoodanimatronictape over mouthreference to draculadecapitated headkiller dolllatin americanstrong womanhearing aidoff screen murdertoy storeface ripped offrebootbloody violencein the closetevil dollgrindhouse filmpsychotronic filmpet catdead catcharacters killed one by onebody counttied feetstabbed in the neckremote controlwoman in jeopardysingle parentstabbed to deathf wordapostrophe in titlewatching tvpunched in the faceremakepunctuation in titleknifesingingtwo word titleviolenceblood (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
| Themes: | deathpsychopathsupernatural powerevil |
| Mood: | goreraincar chaseslasher |
| Locations: | chicago illinoisschool buswater gun |
| Characters: | slasher killerhusband wife relationshippoliceboyteacherserial killerkillervillainterrorserial murderernew student |
| Period: | 1990s |
| Story: | toy factorykiller dollbloody violenceevil dollbody countstabbed to deathapostrophe in titlepunctuation in titlesingingbloodsequelcigarette smokingcorpsedigit in titlecar accident …slow motion scenefalling from heightheld at gunpointsecond partfoot chasebound and gaggedstrangulationambulancethroat slittingstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturemaniacfalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedpsychosevered handblack humorbutchershovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderpsycho killerpsychopathic killersuffocationbad guymadmanhiding in a closetevil spirithomicidal maniacclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a beddigging a gravesadistic psychopathlocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonegruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentsfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
After the events of Seed of Chucky, Nica, a young woman forced to a wheelchair since birth, has to regroup her sister, Barb and her brother-in-law, Ian for a funeral after the death of her mother. While dealing with Barb, Ian, along with their 5-year-old daughter, Alice; Nica receives an odd package … - a creepy doll. After people start showing up dead, the fearless Nica soon suspects that the creepy doll is much more than just a doll. (Read More)
| Subgenre: | paranormalamerican horror |
| Themes: | murderdeathadulteryescapefuneralpsychopathsupernatural powerdeath of mothersadismevilmurder of a police officermurder of family |
| Mood: | goreslasher |
| Locations: | cemeteryelevatorwheelchaircourtroom |
| Characters: | slasher killerfamily relationshipshusband wife relationshipmother daughter relationshippolice officerserial killersister sister relationshipterroraunt niece relationshipbrother in law sister in law relationship |
| Period: | year 1988year 2013 |
| Story: | creepy dollhorror iconkiller dollevil dollstabbed to deathf wordknifebloodviolencecharacter name in titlesequelflashbacklesbian kisssurprise ending …corpseblood splatterslow motion scenewritten by directorfalling from heightcar crashdecapitationaxethroat slittingtied to a chairjudgesevered headchild in perilcharacter repeating someone else's dialoguestabbed in the backelectrocutiondollelectronic music scorescene during opening creditssevered handhome movieduct tape over mouthcameoblack and white scenestabbed in the legscene after end creditsevidencedeath of sistereye gougingstabbed in the eyeaxe murdernannyclose up of eyesblood on camera lenscartoon on tvbag over headold dark houseblackouthomicidal maniacfilm projectoryoung version of characterblood stainwoman in bra and pantieseyeballwrongful convictionparaplegicsixth partstabbed in the facedirect to video sequel to theatrical moviehandicappedvillain not really dead clichestabbed with scissorsdeliverydark and stormy nightreference to charles mansondeath by electrocutionkilled in police carmanic laughtermurder disguised as suiciderat poisonsunflowerjump scaremurdered priestpolice officer throat slitanimate dollvictorian houseelectronic music score in style of orchestral music scorenanny campoisoned food (See All) |
A teenage girl, trying to enjoy her birthday, soon realizes that this is her final one. That is, if she can figure out who her killer is. She must relive that day, over and over again, dying in a different way each time. Can she solve her own murder?
| Subgenre: | slasher flickblack comedyteen horror |
| Themes: | suicidemurderdeathinfidelityjealousyextramarital affairtime travel |
| Mood: | slasher |
| Locations: | hospitalcar explosioncar on fire |
| Characters: | slasher killerhomosexualfather daughter relationshipmother daughter relationshipdoctorfemale protagonistpolice officerserial killerkillersecurity guardteacher student relationshipsuicide by hangingteacher student sexpolice officer taken hostage …blonde asianasian girlteacher student affairsex with a studentasian boybaby mask (See All) |
| Story: | horror iconin the closetgrindhouse filmpsychotronic filmcharacters killed one by onestabbed to deathf wordknifebloodviolencefemale nuditymasturbationgunkissfemale rear nudity …explosionpartychasethree word titlesurprise endingcryingcell phoneshot to deathmaskbirthdaycollegefoot chasethroat slittingdinerstabbed in the chestexploding carpolice officer killednews reportpublic nuditymini skirtbaseball batcollege studentamerican flagstalkingmurdererlove interestarsonbirthday cakecloseted homosexualcrying womanflatulenceteddy bearparking garagefemale killermasked manstealing a carmobile phoneplot twistblack brahit on the headtitle at the endalternate realitycasual sexglobal warmingmasked killerholding handsprequelparking lothit with a baseball batleather jacketserial murderfinal showdownhiding in a closetrepeated scenetwist endingsuit and tiealarmblonde womanmini dresstelevision newsfemale friendshipyoung womanescaped convictsororityfriendship between girlspartial female nuditybaseball capshort skirtfemale villainmercedes benzcollege campusmusic boxmasked villainfart jokevending machinetime loopyoung adultmurder victimsurprise partyred herringknife held to throatdeja vudriver's licensealternate timelinemystery killerdyed hairmultiple outcomesfemale studentdoctor's officeescaped prisonerrepeated eventdorm roomcupcakeco edhospital gowntime warpdead teenagerrun over by a carfalling out a windowhit by a bustime travelercar alarmgay pornbare midriffcheating on wifehanged by the necksurprise birthday partybell towermiddle fingerdisco ballcurly hairmarried mandying repeatedlypower cutpointing a gun on someonebirthday cardhighway patrolsorority houseblowing out candles on a birthday cakesorority girlcollege roommatedeath in titleman murders a womanteacher student romancehooded sweatshirtreference to harry houdinishooting a womanmontage with pop songempty gunlong haired mancake in the facesmashing a car windowblowing out a candlehair curlerschocolate milksmashing a windowstood uptrapped in a time loopbloody knifemobile telephonereference to janis joplinrunning mascaracutting own hairloose womanshort dresskilled on birthdaysetting a car on firehead traumapoisoned to deaththroat slitwhite boardhit on the head with a hammeropening creditspoisoned foodreliving the pastfemale flatulenceknife held to someone's throatbirthday candleboarded up windowpulled over by policekiss on the neckpushed through a windowthe morning afterarizona desertfemale college studenthair curlernight walkreference to ghostbusterscrush on teachereternal recurrenceknife held to one's throatthrown against a wallfat shaminggirl in jeopardyhalter topreference to bill murraywalking alone at nightwatching a gay porn videowatching gay porn (See All) |
Detective Matt Gibson chases the psychotic Detective Mark Hoffman while Jigsaw's widow Jill Tuck tries to kill him as assigned by her husband. However he escapes and Jill meets Gibson and offers to sign an affidavit listing the murders committed by Hoffman. In return, she requests protection. Meanwh …ile, the prominent Jigsaw survivor and leader of a support group Bobby Dagen is abducted with his wife and friends and forced to play a mortal game to save himself and his beloved wife. (Read More)
| Themes: | deathrevengekidnappingfeartorturedeceptiondeath of wifepolice brutalitypolice investigationpolice corruptionrevenge murder |
| Mood: | gore |
| Locations: | barpolice station |
| Characters: | police detectivehusband wife relationshipboyfriend girlfriend relationshipdoctorpolice officerlawyerlove triangleinterracial relationshipself mutilationcoroner |
| Period: | 2010s |
| Story: | horror iconevil dollgrindhouse filmcharacters killed one by onebody countstabbed in the neckwoman in jeopardystabbed to deathknifebloodviolencenumber in titlesequelinterviewflashback …bare chested maleexplosionsurprise endingpistolcell phonecorpsedigit in titleshot to deathblood splattermachine gunshot in the chestshotgunslow motion scenefalling from heightmaskheld at gunpointbombnumbered sequelshot in the backcleavageimpalementtied to a chairdream sequencehit by a carpolice officer killednews reportconfessiondrug addictcharacter repeating someone else's dialoguekeyelectrocutiondollknocked outmanipulationneck breakingcharacter says i love yousevered armcorrupt copburned alivemass murdercagesurvivorkicked in the stomachvideotapefraudswat teamcovered in bloodcrushed to deathredneckstabbed in the throat3 dimensionalgash in the facejunkiepolice officer shotthrown through a windowdisembowelmentbooby trapblood on shirte mailracisteye gougingstabbed in the eyecaneburned to deathlyingtorso cut in halfshot through a windowintestinesreturning character killed offjunkyardblindfoldedpolice officer shot in the chestskinheadx raygroup therapyfemale lawyershot in the eyeheld captivemale protagonistsawaudio cassettebody baghanged manextreme violencefemale police officercut into piecessupport grouptape3d in titlemass murderersevered footpolice officer shot in the headwoman's neck brokensoundseventh partpolicewoman killingarm ripped offtrail of blooddeath by hangingbear trapstabbed in the mouthbook signinghidden roomlawnmower3 dstabbed in the sidetricyclewriting on a wallprosthetic limbcircular sawsafe houseinternal affairslast of seriesthrown through a windshieldabsurd violencegame of deathwhite supremacistprosthetic legpublicistpublic executioncaught in a lieelectric fencepolice officer stabbedrotting corpsetooth pullingskin rippingkilled by a propellerbolt upright after nightmarepig mask8 trackboyfriend girlfriend conflicteye surgeryhung from a hookjaw ripped offman murders a womantooth extractionbulletproof glassprosthetic armhead crushing3d sequel to 2d filmwriting on mirrortape deckpolice officer neck brokenwriting on a mirroreyes sewn shutlocked in a bathroomskin torn offbuzzsawcauterizationleft to diewoman leading a man onsupergluemale antagonistpolice internal affairsself help gurufish hookkilled with a lawnmowerexposing fraudreference to the fbiexploding warehousestitching one's own woundloose endsplexiglastight blouse (See All) |
After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh …erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)
| Subgenre: | slasher flickb movie |
| Themes: | murderdeathrevengevoyeurismmurder of a police officer |
| Mood: | gorerainslasher |
| Locations: | barcemeterypolice stationroad triptexas |
| Characters: | slasher killerfather son relationshipbabylawyerkillerinterracial relationshipsheriffcousin cousin relationshipmayoryounger version of character |
| Period: | 1990s1970s |
| Story: | horror icontape over mouthgrindhouse filmpsychotronic filmcharacters killed one by onestabbed to deathremakebloodfemale nuditynuditybare breastssequelfemale frontal nudityflashbackbare chested male …photographpantiespistoltopless female nudityshootoutcorpseshot to deathblood splattershot in the chestshot in the headshotgunslow motion scenecar crashdead bodyvoyeurshot in the backcleavagehalloweenfoot chasebound and gaggedmassacremansionstabbingimpalementstabbed in the chestsevered headscantily clad femalehit by a cargraveyardnecklaceshot in the foreheadblack pantiescharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on fireknocked outkicked in the facescarfemale removes her clothesdismembermentcorrupt copbralessgirl in pantieschainsawfalling down stairssupermarketrevelationscene during opening creditsbarnstabbed in the stomachsevered handcarnivalhitchhikermasked manduct tape over mouthpump action shotguninterracial romancebra and pantiessevered finger3 dimensionalpool tablescene after end creditssevered legchainfifth partmasked killertorso cut in halfmarijuana jointliving deadreturning character killed offmolotov cocktailgateplaying pooldouble barreled shotguninterracial kissnude girlhead bashed indeputywoman in bra and pantiesferris wheelwoman wearing only a man's shirtcrotch grabgraphic violencedeath of grandmothercheating boyfriendslaughterhousecut into pieceshit with a hammerhouse firebonehatchetvinylwoman wearing black lingerieangry mobtrail of bloodshot through a wallhidden doorwine cellarmidnight moviesevered faceduct tape gagbreast kissingchain link fencechainsaw murderblack man white woman relationshipwoman undressing for a manmeat grinderhung from a hookachilles tendon cuthacked to deathdead body in a freezerleatherface3d sequel to 2d filmopen graveskinningwearing human skinadopted girlretconstabbed with a pitchforkblood trailblack man white woman kissblack man white woman sexgroup photographhiding in a coffin (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is …the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
| Subgenre: | slasher flickpsycho thrilleraustralian horrorteen horror |
| Themes: | murderdeathtorturefuneralbrutalityyouthabusecampingghost town |
| Mood: | horror movie remakegoreslasher |
| Locations: | churchforestsmall townroad tripcampfire |
| Characters: | slasher killerboyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshipserial killerpriesttough guyinterracial relationshipvillainsheriff |
| Story: | characters killed one by onebody countstabbed in the neckstabbed to deathknifeviolencebloodmale nuditymale rear nuditybare chested malefighttitle spoken by characterchasethree word titlesurprise ending …pantiesfirecryingcell phonecorpseshot in the chesturinationface slapshot in the headshotgunundressingbare buttvomitinglingeriedecapitationgood versus evilbravideo cameradeath of friendimpalementstabbed in the chestchild abusesevered headscantily clad femalebeaten to deathstripteaseperson on firetentkicked in the facebaseball batinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowlifting someone into the airgroup of friendsloss of friendamerican footballhidingfloridarednecksevered fingercrossbowgash in the facetitle appears in writingscissorsstabbed in the legred pantiestank topcar troublegroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingsdeformitywrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
| Themes: | murderdeathtorturepsychopathbrutalitysupernatural powerinsanitysadismevil |
| Mood: | goreslasherbreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | slasher killerbrother sister relationshipteenage girlteenage boyserial killerkillervillainterrormysterious villainserial murderermysterious killer |
| Period: | 1980s |
| Story: | bloody violencegrindhouse filmcharacters killed one by onebody countstabbed in the neckstabbed to deathbloodviolencesexfemale nuditynumber in titlemale nuditybare breastssequelfemale frontal nudity …masturbationmale rear nudityfemale rear nuditysurprise endingpantiescorpseunderwearblood splattermasklow budget filmsubjective cameradecapitationstrangulationimpalementsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturekillingmaniacsexual attractionlifting someone into the airragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carkilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderdeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherycrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou …s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)
| Subgenre: | slasher flickindependent filmcult filmpsycho thrillerstop motion animation |
| Themes: | murderrevengepsychopathsupernatural power |
| Mood: | slasher |
| Locations: | carelevatorapartmentpolice stationchicago illinois |
| Characters: | police detectivemother son relationshipboyserial killerhomeless manwitch doctor |
| Period: | 1980swinter |
| Story: | animatronickiller dolltoy storeevil dollapostrophe in titlepunctuation in titleknifebloodcigarette smokingpistolshootoutcorpseshot to deathblood splatterurination …falling from heightbirthdaycar crashshot in the backsubjective cameradecapitationfoot chasedeath of friendwidowstabbed in the chestsubwayfalse accusationsevered headchild in perilshot in the legperson on fireelectrocutionfirst of seriescharacter's point of view camera shotpossessiondollknocked outlightningattempted rapeshot in the shoulderfirst partsevered armdismembermentfreeze framemaniactv newsburned aliveelectronic music scoregothicbabysitterlifting someone into the airtoyback from the deadbroken legreverse footagetensionchild's point of viewdark humorfalling to deathmental hospitalstabbed in the legthrown through a windowbody landing on a carsevered legvoodooblack magicgunfireframed for murderplanthit with a baseball batpresentstabbed in the handhiding in a closethead blown offhuman monsterwhodunitdepartment storescalpelelectric shockpolice interrogationbitten in the neckbumburnt bodysole black character dies clichehiding under a bedexploding househit with a hammerbreaking through a doorvillain not really dead clichefootprintjewelry storetauntingmuraltrail of bloodbandaged handbitten on the armremadevoodoo dollchantfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatchesfloursoul transferencegingershot in the hearttwo killersdisbelieving adultleg blown offattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapyhead spinlightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | suicidemurderdeathrevengerapetorturepsychopathinsanityevilcannibalismrape and revenge |
| Mood: | goreslasher |
| Locations: | desertwaternew mexico |
| Characters: | slasher killerserial killervillainterror |
| Period: | year 2007 |
| Story: | bloody violencegrindhouse filmpsychotronic filmbody countstabbed to deathf wordremakefemale nuditynuditybare breastssequelfightexplosionsurprise endingpistol …firelickingcorpseshot to deathblood splattershot in the chestshot in the headfalling from heightriflenumbered sequelgood versus evilsurvivalgay slurstabbingarmyimpalementstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplattermaniacropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murderkilling spreenude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancydeformitysadistic psychopathsledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
| Subgenre: | independent filmmartial artssuspenseconspiracycorporate conspiracy |
| Themes: | artificial intelligencesuicidemurderdeathrevengekidnappingbetrayalfearescapeinvestigationdeceptionangerbrutalityparanoiasurveillance …panic (See All) |
| Mood: | car chase |
| Locations: | forestwoodskitchenfarmlakelaboratoryresearch station |
| Characters: | boyfriend girlfriend relationshipdoctorhostageinterracial relationshippsychiatristchinesesuicide by hangingbabe scientistfemale scientistgeneticist |
| Period: | near future |
| Story: | characters killed one by onetied feetstabbed in the neckstabbed to deathf wordpunched in the faceknifebloodviolencecharacter name in titleone word titleinterviewflashbackbare chested malefight …title spoken by characterchasesurprise endingpistolshowercell phonebeatingcorpseblood splatterfistfightcar accidentmirrorshot in the chestshot in the headrescuecomputercamerabrawlshowdownrifleheld at gunpointhand to hand combatbedinterrogationriversciencekung fuscientistshot in the backfoot chasebedroomassassinambushstrangulationdeath of friendimpalementmixed martial artsdinerstabbed in the chestman with glassesdisarming someonedouble crossdrowningshot in the foreheadlatex glovesattempted murdertreecharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backkaratesuitcasecover upknocked outkicked in the faceshot in the shoulderinjectionisolationlaptopneck breakingsuspicionthreatened with a knifedirectorial debutsubtitled scenetrustfalling down stairssabotagerevelationhead buttelectronic music scorehypodermic needlelooking at oneself in a mirrorcatfightmutantjoggingcooksecurity camerabeardkicked in the stomachpsychologistcompassionfemale killerandroidpresumed deadfull moonrampagestealing a carblood on facefight to the deathgash in the faceevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiercorporationmutationkilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerstabbed in the armclimbing through a windowhired killergenetic engineeringmercy killingwoman kills a mandeath of boyfriendexperiment gone wrongfilmed killinghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagebitten in the throatwoman's neck brokendeoxyribonucleic acidthroat rippingcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | slasher flickindependent filmcult filmsuspenseaustralian horrorsadistic horror |
| Themes: | murderdeathkidnappingrapedrinkingfeartorturedrunkennessescapepsychopathbrutalityinsanitysadismevilabduction …exploitationcruelty (See All) |
| Mood: | gorecar chasenightslasherdarknessblood and gore |
| Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | slasher killerhusband wife relationshipdoctorsingerserial killerhostagekillervillainaustralianterrorself mutilationmysterious villainserial murderermysterious killer |
| Period: | year 1999 |
| Story: | bloody violencegrindhouse filmcharacters killed one by onebody counttied feetstabbed to deathf wordknifesingingtwo word titlebloodviolencedoggunkiss …cigarette smokingphotographtitle spoken by characterexplosionpartychasebased on true storysongcorpseshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backswimminggay slurflashlightbound and gaggedmassacrevideo camerastabbingimpalementfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufokillinggaragemaniacpickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffmineopening a doorsexual assaultkilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upsole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcheryexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.
| Subgenre: | slasher flickblack comedyconspiracydeadpan comedy |
| Themes: | murderdeathdeceptionpsychopathdeath of fatherdeath of motherhome invasiondeath of wifepanicinheritance |
| Mood: | goreslasher |
| Characters: | mother son relationshiphusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipserial killeraustralian |
| Story: | bloody violencecharacters killed one by onestabbed in the neckstabbed to deathpunched in the faceknifetwo word titleviolencebare breastsbare chested malecigarette smokingsurprise endingtopless female nuditycell phonecorpse …shot to deathblood splatterslow motion sceneneighborshot in the backfoot chaseflashlightwineaxemansionthroat slittingimpalementstabbed in the chestno opening creditspolice officer killedshot in the foreheadargumentcharacter repeating someone else's dialoguebeaten to deathstabbed in the backcollege studentshot in the shoulderdeath of brotherbasementtrapclaim in titlefireplaceheroinemachetefaintingcovered in bloodmasked mancamera shot of feetcrossbowdark humorkicked in the crotchtitle appears in writingstabbed in the headsibling rivalryjumping through a windowthrown through a windowbooby trapdeath of sistertitle at the endstabbed in the eyelooking at self in mirroraxe murderarrowmasked killermale in showerclose up of eyesman cryingshot through a windowwoman cryingfamily reunionbroken windowstabbed in the armhired killerhead bashed inwoman in bra and pantiespatricidecrashing through a windowman punching a womancollege professordeath of boyfriendstabbed in the shoulderstabbed in the facehiding under a bedmasked villainmatricidefilm starts with sexbutcher knifesole survivorwedding anniversaryflash camerafratricideleg woundsaying gracethroat cutbrickwoman wearing black lingeriejumping out a windowwoman punching a manstabbed multiple timeswriting in bloodstabbed in the footbig familybitten handrich familystartledloud musichit with a frying panmale in a showerno cellphone signalcleaversurvivalistblenderthrown through a glass doorfacial cutfamily portraithit in the throatstabbed with a screwdrivervictim invited to dinnervicodinclotheslinedvictim fights backpiano wirestabbed with a glass shardlooking under a bedstepping on a nailbreaking a lightbulb (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo …od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
| Subgenre: | ghost storyparanormal activity |
| Themes: | suicidemurderdeathfriendshipreligionghostpregnancyweddinginvestigationpsychopathsupernatural powerevilhome invasioncrueltytrauma …self sacrificedevilpolice investigationnear death experience (See All) |
| Mood: | nightdarknessmoving |
| Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
| Characters: | suicide by jumpingpolice detectivehusband wife relationshippoliceafrican americanfrienddoctorfemale protagonistnursedetectivepolicemanbabypriestchristianreference to god …little girlkillerchristianitycatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girl (See All) |
| Period: | 1970syear 1969year 1970 |
| Story: | creepy dollhorror iconkiller dollevil dollpsychotronic filmwatching tvpunched in the faceknifebloodviolencef ratedcharacter name in titleone word titleflashbackfight …photographtitle spoken by characterchasebased on true storytelephone callfirecryingshot to deathblood splattershot in the chestslow motion scenecamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditsdrawingchild in perilritualnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementhaunted housesacrificegraffitiblood spattercouplerecord playeroccultspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynedeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifereference to charles mansonscratchstab woundwatching someone sleepprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.
| Subgenre: | independent filmpost modern |
| Themes: | murderdeathkidnappingvoyeurismpsychopathinsanityhumiliationhome invasionmurder of family |
| Mood: | horror movie remakebreaking the fourth wall |
| Locations: | kitchen |
| Characters: | family relationshipshusband wife relationshipboyserial killerhostage |
| Story: | tied feetremote controlstabbed to deathremakeknifeviolencebloodbondagedogchasesurprise endingpantiescryingcell phonecorpse …shot to deathblood splattershot in the chestface slapshot in the headshotgunvomitingvoyeurprayertelevisioncleavagebound and gaggedwhite pantiesscantily clad femaleacronym in titlechild in perillooking at the cameradrowningtalking to the camerapainproduct placementlong takefemale removes her clothestied upgirl in pantiesmaniackilling an animalnipples visible through clothingeggsociopathlifting someone into the aircaptivesocial commentarybroken legball gagpunched in the stomachdark humorhousewifemurder of a childtitle at the endbetbroken armduct tapedead dogbarking dogbag over headforced to stripdockdead animalfemale removes her dressdead childrengolf clubsailboatsailingdegradationdouble barreled shotgunmind gameteasingwetting pantsupper classwoman in lingeriecountry housetied up while barefootpsychological torturewoman smokerleg woundcat and mousebloody body of a childeggsglovechild with a gunno survivorshair dryerchild killergolden retrieverraincoatgolf ballcarpetpliersgolferno musicduct tape gaghit with a golf clubmurderer duoremake by original directorlifting a male into the airchain link fencechild shot in the headsummer houseweird behaviorwading in waterrewindcar stereoanti violencerandom violencebroken eggsail boatbound hand and footwire cuttersleg splintmurdered pet (See All) |
Five twenty-something friends become holed up in a remote cabin. When they discover a Book of the Dead, they unwittingly summon up dormant demons living in the nearby woods, which possess the youngsters in succession until only one is left intact to fight for survival.
| Subgenre: | supernatural |
| Themes: | suiciderapesupernatural rape |
| Mood: | horror movie remakegorerain |
| Locations: | forest |
| Characters: | father daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipself mutilation |
| Story: | dead catcharacters killed one by onestabbed in the neckf wordremaketwo word titleviolencebloodflashbackphotographlesbian kissshowerfireblood splattershot in the chest …shotguncar crashdemondeath of friendimpalementstabbed in the chestno opening creditsdrawingshot in the legnecklacedrowningshot in the foreheaddrug addictcharacter repeating someone else's dialoguebeaten to deathperson on firecharacter's point of view camera shotknocked outshot in the shoulderinjectioncharacter says i love yousevered armshot in the armsubtitled scenechainsawsyringekilling an animalmachetegroup of friendssevered handcovered in bloodrape victimclockpromisegash in the faceshot in the facestabbed in the legscene after end creditstitle at the endh.p. lovecraftdemonic possessionchaincellarfemale in showersurprise after end creditsdead dogblood on camera lensstabbed in the handburied alivebag over headhead blown offstabbed in the armwellbroken mirrordouble barreled shotgunburnt facehead bashed incabin in the woodsdripping bloodshot in the handstabbed in the shouldersole black character dies clicheextreme violencestabbed in the facecrowbarhit with a hammersole survivorarm cut offtrapdoorhouse firesevered footimmolationzippo lightergrave diggingtrail of bloodalternate versionstabbed in the mouthnail guncrushed by a carremake of american filmbitten handbroken handfilicidedrug withdrawaldefibrillationhit with a rifle butthead cut in halfvomiting blooddriving in the rainremake of cult filmsplit headglass shardincantationbox cutterchainsaw murderboiling waterstabbed with glassanimate treemultiple versionsslip and fallbook of the deadremake of cult favoriterecovering drug addicttwitchingbloody knifehit with a crowbaroldsmobileattacked by a plantelectric knifegroup of fivelocked in a cellarstabbed with a needledemonic undeadshower with clothes onroast beefbreaking mirrorraped by treesregistered nursechained to a treeunrated version available (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | slasher flickindependent filmcult filmteen horroramerican horror |
| Themes: | murderdeathrevengefeardeceptionpsychopathsurveillanceevilmurder of a police officer |
| Mood: | goresatireslasher |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | slasher killerteenage girlteenage boyserial killernursekillersecurity guardvillainpsychiatristcoroner |
| Period: | 2000s |
| Story: | characters killed one by onebody countstabbed to deathf wordwatching tvknifetwo word titlebloodviolencefemale nuditysequelflashbackfightchase …surprise endingfirecell phonecorpseblood splatterfistfightmirrorcomputercameraundressingbrawlfalling from heightmaskshowdownsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
| Subgenre: | slasher flickindependent filmteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
| Themes: | murderdeathfriendshiprevengesurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic …self sacrificenear death experience (See All) |
| Mood: | satirespoofhigh schoolparodyslasherambiguous ending |
| Locations: | hospitalforestwoodssinging in a car |
| Characters: | slasher killerhomosexualteenagermother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlserial killernursehostagekillermother …ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All) |
| Period: | 1980syear 1986year 1987 |
| Story: | grindhouse filmpsychotronic filmcharacters killed one by onebody countstabbed to deathf wordknifetwo word titleviolenceflashbackbare chested malecigarette smokingdancingexplosionchase …three word titlesurprise endingpantiesfirecell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurdecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastgeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphoneburn victimcar rolloverstupid victimclimbing out a windowwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
| Subgenre: | black comedy |
| Themes: | murderdeathfriendshipbetrayaldrunkennessguilt |
| Mood: | horror movie remakegoreslasher |
| Locations: | kitchenfire truck |
| Characters: | father son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend |
| Story: | characters killed one by onestabbed in the neckwoman in jeopardypunched in the faceremakeknifeviolencebloodfemale nudityfemale frontal nuditymale rear nuditybare chested malefemale rear nudityparty …chasesurprise endingpantiesshowerfirecell phonecorpseblood splattermirrorshot in the chestblondeshotgunslow motion scenebare buttsecretvomitingheld at gunpointlingeriecollegehallucinationhandcuffsvoyeuralcoholcleavageflashlightstrangulationaxeambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunstabbed in the throatironygash in the facestabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiesdead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | slasher flickindependent filmcult filmsuperherosupernaturalparanormalstop motion animationbody horroramerican horrorurban fantasy |
| Themes: | murderdeathfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism …eviltrauma (See All) |
| Mood: | gorenightmareslasher |
| Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | slasher killersingle mothermother son relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killer …nursebabyartistreference to godlittle girlwaitresskillerlittle boyalcoholicvillainterrorfathercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | horror iconbloody violencegrindhouse filmpsychotronic filmcharacters killed one by onebody countwatching tvknifebloodviolencesexfemale nudityf ratednuditybare breasts …sequelflashbackbare chested malegunfemale rear nudityphotographpartychasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenebare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalegay stereotypeasylumfifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmersadistic psychopathwet clothescut handmurder spreefetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classicfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
| Subgenre: | slasher flickindependent filmcult filmblack comedysuspensefish out of waterteen moviesurvival horrorteen horrorpsychological thriller |
| Themes: | murderdeathfriendshiprevengekidnappingfeartortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism …couragehuntingmurder of a police officerwildernessnear death experience (See All) |
| Mood: | goreslasher |
| Locations: | forestbathtubwoodspolice cartruckcavegas station |
| Characters: | slasher killerteenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilation |
| Period: | 2000s |
| Story: | latin americancharacters killed one by onebody countstabbed to deathknifeviolencebloodsexcigarette smokingexplosionchasesurprise endingpistol …firecryingcell phonebeatingcorpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolineaxe murdersevered legarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichewatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
This urban nightmare chronicles several days in the life of Caine Lawson, following his high-school graduation, as he attempts to escape his violent existence in the projects of Watts, CA.
| Subgenre: | independent filmcult filmcoming of ageblack comedyteen movie |
| Themes: | murderdeathlovefriendshiprevengedrugsmoneybetrayalprisonpregnancyfeardrunkennessescapegangsterrobbery …angerpsychopathdeath of fatherbrutalitydeath of motherparanoiahumiliationexecutionhopedyingvengeancepolice brutalitynear death experience (See All) |
| Mood: | goreneo noirhigh schoolarchive footageaffection |
| Locations: | hospitalcarlos angeles californiaurban settingpolice stationgas stationinner city |
| Characters: | police detectivesingle mothermother son relationshipfamily relationshipshusband wife relationshippoliceteenagerafrican americanfriendboyfriend girlfriend relationshipbrother brother relationshippolice officerdetectivemuslimcousin cousin relationship …grandfather grandson relationshipgrandmother grandson relationshippolice chasepolice dog (See All) |
| Period: | 1990s1970s |
| Story: | latin americansingle parentf wordwatching tvpunched in the faceknifebloodviolencenumber in titleflashbackdogbare chested malegunfightcigarette smoking …partychasethree word titlesurprise endingpistolvoice over narrationshootoutbeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenearrestgunfightbrawlshootingvomitingheld at gunpointbeersunglassesinterrogationhandcuffsrevolvercriminalshot in the backsurvivalfoot chasegay slurorphanflashlightgangcaliforniadeath of frienddrug dealercocaineprisonerhouseno opening creditsanti herochild in perilcontroversyracial slurflash forwarddrug addictorganized crimecharacter repeating someone else's dialoguebeaten to deathproduct placementlightningstreet shootoutshot in the shoulderlong takehigh school studentloss of fatherpremarital sexthreatened with a knifedirectorial debutloss of motherprofanityshot in the armheroinhatecrime bossmachismouzicard gamepokerstreetheavy rainslow motiontold in flashbackjail cellroman numeral in titlekicked in the stomachvideotapecovered in bloodparking garagehonorstreet lifehomicidedrug dealingdrug overdosethugswitchbladestealing a carunderage drinkingdual wieldhatredconvenience storeescape attemptblack and white scenebible quoteghettoblood on shirtrainstormbarbecuerelease from prisonjuvenile delinquentethnic slurhustlerdesert eaglemarijuana jointgraduationstorehigh school teachercar drivingpistol whipfemale teacheroverdosekoreanvulgarityurban decaypolice interrogationn wordshot in the handsubmachine gundrive by shootingcarjackingblaxploitationtragic endingshrinefade to blackdreadlockssocial decayattempted robberygangstaslow motion action scenechild swearingchild with a gungangsta griphoodlumchop shopdominoesdrive thrudeath of cousinconvenience store robberyurban violencemuslim convertice cream vanblack slangwatts riotschevrolet impala convertible (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | slasher flicktragedypsycho thrilleramerican horror |
| Themes: | suicidemurderdeathkidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismevilhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | goreslasherdarknessblood and gore |
| Locations: | small townstrip club |
| Characters: | slasher killerteenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillervillainpsychiatristsheriffterrorserial murderer |
| Period: | 1970s |
| Story: | bloody violencecharacters killed one by onebody countstabbed to deathf wordremakeknifebloodviolencesexfemale nuditymale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudity …photographtitle spoken by characterchasepistolwoman on topbeatingcorpseblood splattershot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplattermaniackilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbroken armduct tapekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | slasher flickcult filmsuspensepsycho thrilleramerican horrorholiday horror |
| Themes: | murderdeathjealousyfeartorturevoyeurismmemoryseductionpsychopathbrutalityobsessionparanoiainsanityblindnesstrauma …madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
| Mood: | gorenightslasherdarkness |
| Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
| Characters: | slasher killerpoliceteenagerboyfriend girlfriend relationshipteenage girlpolice officerserial killernursedetectivepolicemankillervillainsheriffterrorserial murderer |
| Period: | 1970syear 1978 |
| Story: | bloody violencegrindhouse filmcharacters killed one by onebody countstabbed to deathwatching tvknifetwo word titleviolencebloodsexfemale nuditynuditynumber in titlemale nudity …bare breastssequelmale rear nuditykissfemale rear nuditycigarette smokingnipplesexplosionchasetelephone callfirecryingblood splattercar accidentshot in the chestblondekissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulancestabbingthroat slittingaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapmurderersplattermaniactv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychogrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastdead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerpsycho killerflat tirefemale stockinged feetdead girlserial murderpsychopathic killerbad guyconfusioncar troublemadmanmysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonehomicidal maniacsuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichebutcheryzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The … only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)
| Subgenre: | cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy |
| Themes: | deathherovoyeurismseductionsupernatural powerfaithpolice investigation |
| Mood: | gorespoofnight |
| Locations: | small townnightclub |
| Characters: | single mothermother son relationshippoliceteenagerboyfriend girlfriend relationshipteenage boyserial killerdetectivepolicemanactorvampirevillaingirlfriendparent child relationshipneighbor neighbor relationship |
| Period: | 1980s |
| Story: | bloody violencegrindhouse filmpsychotronic filmwoman in jeopardywatching tvpunched in the facetwo word titlebloodviolencefemale nuditynuditymale nuditymale rear nuditybare chested malegun …title spoken by characterchasesurprise endingpistoltopless female nudityshot to deathmirrorshot in the chestwritten by directorundressingfalling from heightpaintingheld at gunpointneighborvoyeurgood versus eviltoplessimpalementstabbed in the chesthousesevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginsuburbskeletonscarhigh school studentstalkingcrossexploding bodywitnessbasementcharacter says i love youfirst partundeadwerewolffalling down stairswolfburned alivelifting someone into the aircrucifixhunterteenage protagonistreverse footagehypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingvampirismhomosexual subtextvampire hunterblack copghoullifting person in airglowing eyesholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starremadewashed up starstabbed in the heartshort haired femalevampire bitehorror movie remadered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
| Subgenre: | slasher flickindependent filmblack comedysuspensepsycho thrillerpsychological thrillerholiday horrorchristmas horror |
| Themes: | murderdeathrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinesspsychopathobsession …paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
| Mood: | goreneo noircar chaseslasherdarknessone night |
| Locations: | new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice |
| Characters: | slasher killerpolice detectivepolicefemale protagonistpolice officerpolicemanhostagesecurity guardmysterious villain |
| Period: | winter |
| Story: | characters killed one by onebody countwoman in jeopardyf wordpunched in the faceknifebloodviolencenumber in titleone word titledogfightexplosionpartychase …surprise endingtelephone callfirecryingcell phonehigh heelsbeatingcorpsedigit in titleblood splatterfistfightcar accidentmirrorbrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york citysubjective cameracleavagesurvivalfoot chasenewspaperflashlightbound and gaggedwinestrangulationaxevideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootdamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | slasher flickindependent filmcult filmteen movieteen horroramerican horrorindependent horror |
| Themes: | murderrevengesurrealismfuneralpsychopathsupernatural powerevil |
| Mood: | gorehigh schoolnightmareavant gardeslasher |
| Locations: | cemeterybathtubpolice station |
| Characters: | slasher killermother son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationmysterious villain …serial murdererpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | face ripped offgrindhouse filmcharacters killed one by onebody countviolencebloodbare chested malecigarette smokingsurprise endingdreamcorpseblood splattermirrorface slapslow motion scene …arrestfalling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementcellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcheryplant in titlecreepglovetrail of bloodhit with a chairpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic |
| Themes: | murderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruptionpsychopath …death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
| Mood: | gorenightslasherdarkness |
| Locations: | hospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car …cityitalytruck (See All) |
| Characters: | slasher killermother son relationshiphomosexualfather son relationshippolicefather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killerpolicemanmusician …actresskillervillainpsychiatristmaidprofessorjewterrorgermangay friendmysterious villainserial murdererself pity (See All) |
| Period: | 1970s |
| Story: | hearing aidgrindhouse filmpsychotronic filmcharacters killed one by onebody countstabbed in the neckstabbed to deathwatching tvknifesingingtwo word titleviolencebloodflashbackgun …kisscigarette smokingphotographchasesurprise endingtelephone callfiresongshootoutbeatingcorpseblood splattermirrorface slapcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersubjective cameradecapitationsurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationaxestabbingimpalementdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessmutebroken glassmental hospitalbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastfemale reportergay stereotypeliving roomdead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcheryhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classicprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
Class struggle becomes all too real as a young doctor moves into a modern apartment block in suburban 1975 London. Drugs, drink & debauchery dissolve into murder, mayhem and misogyny in this pseudo-post-apocalyptic breakdown of societal norms.
| Subgenre: | dystopia |
| Themes: | suicidemurdersurrealismkidnappinginfidelityrapemoneyadulterypregnancydrinkingdrunkennessextramarital affairparanoiainsanityunfaithfulness …wealthrevolution (See All) |
| Mood: | satire |
| Locations: | london englandelevatorwheelchairpolice car |
| Characters: | suicide by jumpingmother son relationshiphusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorboybrother sister relationshipgirlpolicemandancerbabyactressreference to god …psychiatristmaidfrenchgermanneighbor neighbor relationshipcrying baby (See All) |
| Story: | garbage chuteface ripped offsingle parentstabbed to deathf wordwatching tvpunched in the facebloodviolencesexfemale nuditybased on novelnuditymale nudity …bare breastsflashbackmale frontal nuditymale rear nuditydogbare chested malegunkisscigarette smokingdancingphotographtitle spoken by characterpartyshowertopless female nudityvoice over narrationwoman on topbeatingcorpseshot to deathunderwearfoodhorsemirrorshot in the chestface slapslow motion scenedrinkundressingbare buttfalling from heightshootingpaintinglierock musicdead bodysex standing upreference to jesus christorgyreportersubjective cameraswimmingflashlightbound and gaggedwinecandlestrangulationstabbingmontageeatingcocainestabbed in the chestnonlinear timelineapologysevered headno opening creditschilddream sequencebirthday partyunderwater scenedrowningcoffeeflash forwardcharacter repeating someone else's dialoguestabbed in the backscreamingchampagnecharacter's point of view camera shotmassagedebtgyminjectionfilm within a filmchildbirthgardensleepingrecord playerbirthday cakeeyeglasseswaitershavingsupermarketkilling an animalballoonlooking at oneself in a mirrorlistening to musictape recorderbabysitterrecordingcaught having sexwatching a moviearchitectcrying womanclassical musiccovered in bloodskullapartment buildingrampagerear entry sexnicknamekickingpower outagefalling to deathcigarette lighterbalconybody landing on a carcanebriefcaseinjusticesevered legpipe smokingsunbathingparking lotpillclose up of eyesearphoneshit in the facedefecationkilling a dogrepeated scenepaintsnorting cocainetowerstairwaygolf clubautographname callingblackoutmasseusedegradationfilm cameraseagullknocking on a doorpush upsbankercostume partyanarchynarcissismswimming underwaterwhite briefsgarbagecrotch grabspacaretakerdistrustin medias resgynecologistwoman slaps a manenvironmentalistshopping cartelevator shaftsocial decayman slaps a womanoverhead shottitle spoken by narratorwrenchillegitimate sondocumentary filmmakerpower failurebloody facesevered earsleeping pilldebaucheryapplying makeuppenthousehomophobemedical schoolwhite horselobotomysex on a tablegrocery shoppingdissectiontalking during sexpeepholereference to che guevaradestruction of propertyindoor swimming poolsex with a pregnant womanfainting manbarristergarbage bagrepeated dialoguesticking out one's tonguedead sisterkilling a horsegrowlingterracecat scanpainting a wallstuck in an elevatorclimbing a ladderkaleidoscopemaniamusical quartetreference to lord byronscrubbing a floorcleaning uphusband slaps wifepounding on a doorreference to the united nationsclass warfarewife slaps husbanddoor keytower blockhigh rise apartment buildingtv news reporterchildren's partycovered in paintphysiologyrowing machinedilletantefake angel wingsnote slid under doorlearning to speak frenchsquash the game (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
| Themes: | murderdeathtortureescapepsychopathbrutalityinsanitysadismevilhome invasionexploitationcrueltymurder of a police officer |
| Mood: | gorenightslasherblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | husband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillervillainterrorself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All) |
| Story: | grindhouse filmpsychotronic filmdead catcharacters killed one by onebody countwoman in jeopardystabbed to deathpunched in the faceknifetwo word titleviolencebloodfemale nuditycharacter name in titlebare breasts …female frontal nudityflashbackfightcigarette smokingnippleslesbian kisssurprise endingpistolbeatingcorpseblood splattermirrorshotgunslow motion sceneshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingimpalementstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationpsychocovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampageburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyeboxbloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaintrickcut into piecesjewelsadistic psychopathcut handhouse on firemurder spreedragging a bodyviolent deathbutcheryex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | slasher flickcult filmblack comedysuspenseconspiracypost modernteen movieteen horrorhorror spoof |
| Themes: | murderdeathloverevengebetrayalfeardrunkennessescapeinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism …theatremurder of a police officernear death experience (See All) |
| Mood: | goresatireslasher |
| Locations: | hospitalbicyclepolice stationpolice carfire truck |
| Characters: | police detectivepoliceteenagerboyfriend girlfriend relationshipfemale protagonistpolice officerserial killerdetectivehostagekillerex boyfriend ex girlfriend relationshipself referential |
| Period: | 1990s |
| Story: | characters killed one by onebody countstabbed to deathf wordwatching tvpunched in the faceknifesingingbloodviolencef ratednumber in titlesequelinterviewbare chested male …kisscigarette smokingpartychasesurprise endingpistolcell phonebeatingcorpsedigit in titleshot to deathblood splattercar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenecomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegehallucinationvoyeurtelevisiontelephonereportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo cameraambulancestabbingdeath of friendthroat slittingimpalementstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplayethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | slasher flickcult filmsupernaturalpsycho thrillerparanormal phenomenateen horroramerican horror |
| Themes: | murderdeathprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
| Mood: | gorecar chaseslasherdarknessbreaking the fourth wall |
| Locations: | forestcemeterysmall townboatwoodslakeamerica |
| Characters: | slasher killerpoliceteenagerzombieserial killerkillervillainsheriffterrorserial murderer |
| Period: | 1980s |
| Story: | off screen murderbloody violencebody countstabbed to deathviolencesexcharacter name in titlenumber in titlesequelflashbacksurprise endingblood splattermasknumbered sequeldemon …decapitationflashlightmassacreambulancestabbingsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesheart ripped outfemale victimsadistic psychopathmurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | slasher flickindependent filmcult filmpsycho thrillerteen movieteen horroramerican horrorholiday horror |
| Themes: | murderdeathfearcorruptionpsychopathparanoiaevilmurder of family |
| Mood: | high schoolnightslasher |
| Locations: | carsmall towncar theftkitchen knife |
| Characters: | slasher killerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirlserial killerlittle girlkillerlittle boyvillainpsychiatristterror …doctor patient relationshipserial murderer (See All) |
| Period: | 1970s1960syear 1963year 1978 |
| Story: | off screen murdergrindhouse filmbody countwoman in jeopardystabbed to deathwatching tvknifeviolencefemale nuditynudityone word titledogguncigarette smokingtitle spoken by character …surprise endingshot to deathblood splattershot in the chestfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationstabbingthroat slittingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingmurdererfirst parthandgunkillingmaniacpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbusterpsychogrindhousedead womanmasked manwatching televisioncouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathwetnessmurder spreevillain not really dead clicheescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was … gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)
| Subgenre: | slasher flickcoming of agesuspenseteen movieteen horror |
| Themes: | murderdeathfriendshipdrunkennessdancepsychopathobsessionrivalryhome invasionmurder of a police officermurder of family |
| Mood: | horror movie remakehigh schoolnightmareslasher |
| Locations: | hotelelevatorpolice stationfire truck |
| Characters: | police detectivehusband wife relationshippoliceteenagerfriendboyfriend girlfriend relationshipteenage girlteacherdetectivekilleruncle niece relationshipaunt niece relationshipdeath of girlfriend |
| Story: | characters killed one by onestabbed to deathremakeknifeviolencebloodmale nudityflashbackmasturbationdancingtitle spoken by characterpartychasepistolshower …cell phonecorpseshot to deathblood splattermirrorshot in the chestslow motion scenehallucinationsurvivalorphanstrangulationaxedisguiseambulancedeath of friendthroat slittingbridgestabbed in the chestjokedream sequencepolice officer killednews reportlimousinestalkervirginclownrace against timekicked in the facedeath of childhigh school studentstalkingthreatened with a knifeloss of loved oneswat teampsychologistrapistbarefootcrime scenehaunted by the pastfloodunderage drinkingevacuationpedophileblood on shirtmurder of a childone dayuncleengagement ringparentsdjpervertauntgraduationfire extinguisherhiding in a closethigh school teacherpedophiliacomic relieftrashflaskescaped convictbody in a trunkmtvpromdeath of boyfriendgarbagemugshothiding under a beddeath of familychild molesterstupid victimbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderclicheflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove …r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
| Subgenre: | slasher flicksuspensebody horroramerican horrorsadistic horrorspanish horrorcanadian horror |
| Themes: | suicidemurderfeartorturedeceptioncannibalism |
| Mood: | gorerainnightmareslasherblood and gore |
| Locations: | new york cityboatvillagejungleamericarain forest |
| Characters: | slasher killerfather daughter relationshiptattoolawyervillainterroramerican abroad |
| Story: | bloody violencepsychotronic filmcharacters killed one by onebody countviolencefemale nuditymale frontal nuditymale rear nuditybare chested malelesbian kissthree word titlepistolcell phoneshot to death …blood splattershot in the chesturinationwritten by directorvomitingmarijuanacollegeislandmale pubic haircolor in titlerivershot in the backdecapitationcookingthroat slittingimpalementsevered headdream sequenceritualroommatenecklaceshot in the foreheadcharacter repeating someone else's dialogueprotestcollege studentscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplattermachetemutilationspidercovered in bloodvictimbroken legmasked maneaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endeye gougingslaughterstabbed in the eyebroken armsevered legenvironmentalismcapitalismactivisttorso cut in halfsatellitemarijuana jointbad guykillshot in the neckunited nationshomagehuman monsterflutenaivetyamazonslashingveganantbleeding to deathkiller childextreme violencemiddle classperugraphic violencereference to twittertied up while barefootcamera phonedeforestationignorancesadistic psychopathenvironmentalistbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeast coasteating human fleshfemale genital mutilationman eaterbody partshead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | slasher flickindependent filmcult filmblack comedysuspensetragedypsycho thrillersurvival horrorteen horroramerican horrorindependent horror |
| Themes: | murderdeathfriendshipkidnappingfeartortureescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | avant gardeslasherdarknessambiguous ending |
| Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
| Characters: | slasher killerfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillervillainterrorself mutilationtruck driver …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | reference to zorroreference to draculabloody violencegrindhouse filmpsychotronic filmcharacters killed one by onebody countwoman in jeopardyknifeviolencebloodphotographchasesurprise endingvoice over narration …beatingcorpseblood splatterurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckdamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerafemale victimsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherysocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicgrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
| Themes: | suicidedeathghostdrunkennesspsychopathbrutalityinsanityevilexploitationhomelessnessmurder of a police officerdeath of daughter |
| Mood: | gorerainnightmareslasherdarkness |
| Locations: | hospitalhelicopterstrip club |
| Characters: | mother son relationshipfather daughter relationshiptattoosingerserial killerpsychiatristsniper riflecoroner |
| Story: | tape over mouthbloody violencecharacters killed one by onebody countstabbed to deathf wordsingingviolencebloodfemale nuditynumber in titlesequelfemale frontal nudityinterviewflashback …female rear nuditypartychasepistolbeatingdreamcorpseblood splattercar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperdecapitationhalloweenflashlightbandstrangulationstabbingdeath of friendthroat slittingimpalementstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackevil manhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzamaniacsurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murderkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murdererwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv …ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
| Subgenre: | slasher flickindependent filmcult filmblack comedydark comedystop motion animationdark fantasygross out comedyamerican horrorsupernatural horror |
| Themes: | murderdeathrapeghostdancesupernatural powersadismevilsupernatural rapebook of evil |
| Mood: | goreslasherone night |
| Locations: | forestcarwoodssinging in a car |
| Characters: | friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism |
| Period: | 1980s |
| Story: | decapitated headgrindhouse filmpsychotronic filmcharacters killed one by onestabbed to deathremakeviolencebloodfemale nuditykissthree word titlesurprise endingfireblood splattershot in the head …shotgunwritten by directorshootingbooklow budget filmcollegedemonriversubjective cameradecapitationaxestabbingbridgesnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapesevered footcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
| Subgenre: | slasher flickcult filmcoming of ageblack comedysuspenseconspiracypost modernteen movieteen horrorpsychological thrillerhorror spoof |
| Themes: | murderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All) |
| Mood: | goresatirehigh schoolslasherdarkness |
| Locations: | forestsmall townwoodskitchenpolice stationschool bus |
| Characters: | slasher killerfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistserial killervillain …sheriffsingle fatherself referential (See All) |
| Period: | 1990s |
| Story: | characters killed one by onesingle parentstabbed to deathf wordwatching tvpunched in the faceknifeviolencebloodf ratedone word titlebare chested malecigarette smokingtitle spoken by characterparty …chasesurprise endingpistolfirecell phonecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenecomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonesubjective camerasurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragestrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportermasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | slasher flickindependent filmcult filmpsycho thrillerparanormal phenomenateen horroramerican horror |
| Themes: | murderdeathrevengemonsterpsychopathsupernatural powerevildrug addictionmurder of a police officer |
| Mood: | gorerainhigh schoolslasher |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | slasher killerteenage girlteenage boyzombiepolice officerserial killerkillervillainteacher student relationshipterrormysterious villainserial murderer |
| Period: | 1980s |
| Story: | off screen murdercharacters killed one by onebody countstabbed to deathviolencebloodfemale nuditycharacter name in titlenumber in titlesequelbare chested maleexplosionpantiesblood splattermirror …numbered sequeldemonhallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationaxevideo camerastabbingthroat slittingimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetromurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | slasher flickindependent filmcult filmsuspensepsycho thrillerteen moviemurder mysteryteen horroramerican horror |
| Themes: | murderdeathrevengefearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
| Mood: | gorenightslasherdarknessblood and gore |
| Locations: | carmotorcycleboatwaterwoodsrural settingpolice carlaketruck |
| Characters: | slasher killerpoliceteenagerfriendteenage boypolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driver …mysterious villainserial murderer (See All) |
| Period: | 1970s1950ssummer |
| Story: | off screen murderbloody violencegrindhouse filmcharacters killed one by onebody countstabbed to deathviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekiss …female rear nuditynipplesthree word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manaxemassacrestabbingwomanthroat slittingdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterlens flareaxe murderroomkilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowsole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgemurder spreevillain not really dead clichebutcherymurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their … courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
| Subgenre: | black comedyconspiracysupernaturalsurvival horror |
| Themes: | murderdeathrevengesurrealismmarriagemoneybetrayalghostdrinkingfeardrunkennessescapedeceptionseductionsupernatural power …paranoiainsanitysurveillanceunemploymentcourageself sacrificenear death experience (See All) |
| Mood: | horror movie remakegoreone night |
| Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
| Characters: | husband wife relationshipafrican americandoctornursesecurity guardalcoholic |
| Period: | 1990s1930s |
| Story: | stabbed in the neckstabbed to deathf wordwatching tvpunched in the faceremakeknifebloodfemale nudityfightphotographtitle spoken by characterpartychase …surprise endingpistolfirecell phonecorpseshot to deathblood splatterfistfightshot in the chestrescuecomputerdrinkbrawlheld at gunpointsunglassesbirthdaydemonhallucinationsubjective cameradecapitationsurvivalflashlightjournalistambushaxeimpalementstabbed in the chestfalse accusationsevered headdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingelectrocutioncharacter's point of view camera shotknocked outskeletonbasementhauntingsuspicionhaunted houseriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerskullfaked deathpresumed deadmental institutioncameobraveryguestimpostorbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
Forever alone in a crowd, failed comedian Arthur Fleck seeks connection as he walks the streets of Gotham City. Arthur wears two masks -- the one he paints for his day job as a clown, and the guise he projects in a futile attempt to feel like he's part of the world around him. Isolated, bullied and …disregarded by society, Fleck begins a slow descent into madness as he transforms into the criminal mastermind known as the Joker. (Read More)
| Subgenre: | cult filmblack comedystand up comedysuspensedark comedytragedypsychological thriller |
| Themes: | murderdeathloverevengemoneybetrayaldrunkennessescapedancegangsterinvestigationdeceptionangercorruptionloneliness …psychopathdeath of fatherbrutalityobsessiondeath of motherdepressioninsanityhumiliationmental illnessevilabusehome invasionadoptioncrueltyunemploymentwritingrevolutionpolice brutalitymadnessmurder investigationmurder of familychildhood traumapsychological trauma (See All) |
| Mood: | goreneo noirdarknessambiguous endingstand updownward spiral |
| Locations: | hospitalbathtubbuselevatorurban settingapartmentpolice carcitytaxi driver |
| Characters: | police detectivesingle mothermother son relationshippoliceafrican americanpolice officerserial killernursedetectiveinterracial relationshiplittle boyvillainpsychiatristcomedianemployer employee relationship …stand up comedianpolice chaseneighbor neighbor relationshipdysfunctional relationshippolice violencedeath wishrunning from the policedancing in underwear (See All) |
| Period: | 1980syear 1981 |
| Story: | bloody violencepsychotronic filmstabbed in the necksingle parentstabbed to deathf wordwatching tvpunched in the facesingingbloodviolencecharacter name in titleone word titleinterviewflashback …bare chested malegunfightcigarette smokingdancingtitle spoken by characterchasesurprise endingpistoltelephone callfirebeatingdreamshot to deathunderwearblood splattercar accidentmirrorshot in the chesturinationshot in the headslow motion scenewritten by directorarrestmasklettershootingbased on comiclieheld at gunpointrunningcar crashbathroomneighborpianohallucinationrevolvertelevisionfightingcriminaltelephoneshot in the backfoot chasenewspaperorphanbased on comic bookambushdisguiseambulancemontagedinerweaponsubwayjokechild abuseno opening creditsanti herohit by a cardouble crossbathcontroversynews reportshot in the legshot in the foreheadpainconfessionargumentstalkermicrophonedangerportraitbusinessmanclownprotestlocker roomfired from the jobliarfantasy sequencepay phonereadingkicked in the faceopening action scenediarydomestic violencelong takescarpianistbodyguardstalkingthreatisolationsadnessloss of fatherratsuspicionstagemurdererloss of motherprofanitylove interestvigilanteclass differencesgraffitinewspaper headlinekillingmaniacriotinterracialapplausetv newslive broadcastanswering machinemedicinerevelationstreetheavy rainlooking at oneself in a mirrorsociopathfameragevandalismkicked in the stomachassaultmovie theaternosebleedvideotapeblockbusterimpersonationphone boothpsychotv showrape victimfollowing someoneschizophreniasocial commentarymasked manmale underwearblack womanapartment buildingmental institutionrampagedwarftensionface paintsufferingcynicismblood on facehatredkickingmercilessnessironychaosdiscussionrejectionmillionairemental hospitaldelusionescape attemptscissorsmedicationbutlerlaughteraccidental killingsocietyrefrigeratortuxedostabbed in the eyelonerdark pastdressing roomsocial workeropening a doorexistentialismbriefslaughingalienationdc comicsswearingcrowdpsycho killermedia coveragepiano playerserial murdervillain played by lead actorsuffocationmental patientmagic trickface maskalleynotebookoutcastdark secretstreet gangmoney problemsmental breakdownmen's bathroomspiral staircasesubway stationjournalsuit and tiepiano playingstaircasestrikecheering crowdself defensehospital roomflareurban decayinsane asyluminterracial kissanarchynarcissismstrokeadopted sonnihilismstrong languageman kills a womanoffscreen killinggun violenceafrican american womanmale protagonistaltered version of studio logowhite briefstv studiofilmed killingalter egodeath of familybus ridematricideradio newsloss of familyhoodiecockney accentunwanted kissgarbage canreference to batmanweight lossfinger gunsocial decayevil clownextreme close upfictional citystabbed with scissorsstreet vendorabusive motherdeeply disturbed persontragic villainsubway traintv hosttalk show hostreading a lettermental asylumkiller clownmass mediamental disordermoral ambiguitycriminal mastermindel trainapplying makeupcomedy clubstreet performertelling a jokegreen hairburning carfictional talk showsick motherbad mothersmileanti villainhospital visitclown makeupsupervillaininfamybleeped dialoguefemale psychiatristpsychological tormentnickname as titlecharity benefitgarbage bagson murders motherjokerblood on walldancing in the streetorigin storyirrational behaviorsmothered with a pillowstrange behaviorsiren the alarmbanging head against wallquestioned by policeurban violenceill motherbad guy winsclown maskfighting the systemfalse friendcivil unrestback alleycriminally insanepublic transportinner conflictsocial unresttrash bagbloody footprintdysfunctional societymayoral candidateviolent outburstchildren's hospitalpsychological disorderarkham asylumdriven insaneopening creditspublic transitstreet riotlife of crimegotham cityhappy faceexit signkiller as protagonistsubway ridevillain as protagonistco worker co worker relationshipkilling a ratblood spattered faceerratic behaviorsad clownsubway platformsympathetic villainthe jokerwhite paintaccidentally firing a gunhit by a taxireference to wall streetuncontrollable laughterurban decadencedysfunctional personmass protestmurderer as protagoniststreet trashtrash can (See All) |
In the mining town of Harmony, a drilling accident is caused by the son of the owner, Tom Hanniger. The mine collapses, burying six miners alive. The rescue team finds only Harry Warden alive, but in coma, and the other miners murdered by his pickax, and they conclude that Harry killed them to save …oxygen for himself. On Valentine's Day, Harry awakes from his coma in the local hospital, and he kills twenty-two people, including a group of teenagers that are partying in the mine. Harry is killed by the deputy, but the only survivors are Tom Hanniger, his girlfriend Sarah, their friend Axel Palmer and his girlfriend Irene. Ten years later, Tom returns to Harmony after the death of his father. Tom has decided to sell the Hanniger Mine, and finds that Sarah has married Axel, who is now the local sheriff, and they have a son named Noah. On Valentine's Day, Harry Warden also returns, seeking revenge against those that had escaped his pickax in the past, and Tom is accused by Axel and other locals, who in turn makes accusations against Axel. (Read More)
| Subgenre: | slasher flickholiday horror |
| Themes: | murderdeathinfidelitypregnancydrunkennesspsychopathbrutality |
| Mood: | horror movie remakegoreslasher |
| Locations: | hospitalbarsmall townpolice carmoteltunnel |
| Characters: | husband wife relationshippoliceboyfriend girlfriend relationshipserial killerlittle boymaidex boyfriend ex girlfriend relationshiptruck drivermysterious villain |
| Story: | stabbed in the neckstabbed to deathf wordpunched in the faceremakepunctuation in titleviolencebloodnumber in titlefemale frontal nudityflashbackmale rear nuditybare chested malesex scenefemale rear nudity …cigarette smokingexplosionthree word titlesurprise endingpistoltopless female nuditywoman on topcorpsedigit in titleblood splatterfistfightshotgunslow motion scenesecretfalling from heightheld at gunpointcar crashhallucinationshot in the backdecapitationfoot chaseflashlightmassacrevideo camerabridgeimpalementstabbed in the chestchild in perilflash forwardgravelocker roomfantasy sequenceamerican flagpremarital sexsuspicionnewspaper headlinemaniacidentityundergroundrevelationshot in the stomachcomastabbed in the stomachcheating husbandbar fightgas maskgrocery storesevered fingerfight to the death3 dimensionalstabbed in the headbilliardshearteye gougingslaughterstabbed in the eyenude woman murderedpsycho killertorso cut in halfmental patientpolice chiefabandoned houseloud sexwhodunitdouble barreled shotgunvigilante justicehand over mouthactress shares first name with charactercabin in the woodscarnageburnt bodyminervalentine's dayhit with a shovelhiding under a bedheart ripped outschizophrenicbreaking through a doormass murdererbreaking a mirrorstabbed in the mouthwriting in bloodcut armpick axecoal minesmall town sheriffstore clerkcamel toedual identitystabbed in the heartmine shafthead cut in halfmining townnude with a gunvalentinestabbed through the cheststabbed through the chinhole in chestatonal music scorejaw ripped offpugtelevision interviewtotem poleclothes dryerheart shaped box of candyimpaled through eyeshovel through headmine ownerhelmet light (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
| Themes: | murderdeathrevengefearpsychopathbrutalityinsanitysadismevilexploitationpolice investigation |
| Mood: | gorerainnightmarenightslasherdarkness |
| Locations: | cemeterysmall townwoodsamericabackwoods |
| Characters: | slasher killermother son relationshippoliceteenagerbrother brother relationshipserial killerkillervillainsheriffterrormysterious villainserial murderermysterious killercountry boy |
| Period: | 1980s |
| Story: | bloody violencegrindhouse filmpsychotronic filmcharacters killed one by onebody countviolencebloodsexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancing …chasesurprise endingpantiesdigit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyeaxe murderfifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesfemale victimlunaticsadistic psychopathmurder of a nude womanmurder spreedisturbed individualbutcherydeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
The outcast teenager Carrie White is bullied by her classmates at high school. Her mother, Margaret White, is a pious and paranoid woman that sees sin everywhere and the need of self-inflicting punishment. When Carrie has her first period, she does not understand what is happening to her and her cla …ssmates humiliate her in the changing room. The spiteful Chris Hargensen videotapes Carrie with her cell phone and posts it on the Internet. Their teacher Ms. Desjardin punishes the students, but when Chris challenges her, she is suspended and consequently is banned from the prom. Meanwhile, Carrie discovers that she has telekinesis and learns how to control her ability. Sue Snell, one of the girls that tormented Carrie, feels bad and asks her boyfriend Tommy Ross to invite Carrie to go with him to the prom to make up for what she did to Carrie. But Chris and her boyfriend Billy Nolan plot an evil prank with her friends to seek vengeance for Carrie. (Read More)
| Subgenre: | coming of agesuspenseteen movieteen horror |
| Themes: | suicidemurderdeathfriendshiprevengesurrealismrapereligionpregnancyfeardanceangersupernatural powerdeath of motherdepression …redemptionguilthumiliationpoetrybullyingcrueltypanicvengeanceself sacrificenear death experienceregretpsychological trauma (See All) |
| Mood: | horror movie remakegorerainhigh schoolnightmarenight |
| Locations: | hospitalschoolswimming poolcarcemeterysmall townbathtubbicyclewaterpolice cargas stationschool bussex in a carfire truckschool dance …school fire (See All) |
| Characters: | single motherteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorteenage girlfemale protagonistteachernursestudentbullyteacher student relationshipbibleterrorself mutilation …religious fanaticpregnant teenagerreligious zealotself injurymother versus daughterreligious mothervomiting girl (See All) |
| Period: | 2010s |
| Story: | characters killed one by onebody countsingle parentstabbed to deathf wordremakeknifeviolencebloodf ratedcharacter name in titlebased on novelone word titlebare chested malesex scene …kissdancingtitle spoken by characterexplosionsurprise endingshowerfirecell phoneblood splattercar accidentface slapslow motion scenesex in bedvomitingclassroomprayerbedroomflashlightstrangulationmassacreambulancestabbingmontageimpalementstabbed in the chestchild abuseexploding cargraveyardlatex glovesattempted murderlimousinegravelibrarystabbed in the backprologuescreamingsuburblocker roomperson on fireelectrocutionlightninggymamerican flagtragic eventhigh school studentcrosschildbirththreatpigsadnessschoolgirlstagecharacter says i love youthreatened with a knifeclassteenage sexpoemnerdfalling down stairssabotageteen angstdestructionburned alivekilling an animallooking at oneself in a mirrorscene during opening creditslifting someone into the aircrucifixyoutubecovered in bloodfemale killercrushed to deathhomicideearthquakereverse footagepower outagescissorsstabbed in the leglaughterroseaccidental killinglonerclassmatepublic humiliationjuvenile delinquentalienationsurgeonsports cartelekinesistext messaginginterrupted sexteenage pregnancyshynesslevitationstabbed in the handclosetmenstruationoutcastmedical masksurgical maskhigh school teachercafeterialong hairabuse of powerfemale teacherfireballbully comeuppancefemale psychopath17 year oldwhistlecrownstabbed in the armcameramandental maskbroken mirrordomineering motherknocked unconsciousteasingteenage daughterteenage sexualitylocked doorpromnewborn babydeath of boyfriendsewing machinepsychic powerfrightmatricidedeath of title charactercamera phonepool of blooddetentionsledgehammerdisturbed individualwoman wearing black lingerietauntingdeeply disturbed personbucketdutch angletamponstabbed multiple timeswashingfemale in a showerfemale studentcliquemissionary positionsurgical gownhostilityburning houselord's prayerperiodhigh school dancehigh school principalseamstresstwin sistersdead teenagergym classgym teachervillainess played by lead actressthrown through a windshieldcuttingwoman in a bathtubbloody handteenage romancewoman in a towelmenstrual bloodpsionic powerhigh school promlacrosseteen lovefemale bullylesbian slurstretch limousineexploding gasoline stationrepeated scene from a different perspectiveparty dressmultiple stabbingoverprotective parentalternate endingbanging head against wallparanormal phenomenonwhite rosefalling off a bicycleshy girlcruel jokecyberbullyinginferiority complexprom nightteen sexwoman murders a womanprom queenfirst menstruationprom dresscracked mirrorhome birthtroubled teenage girldaughter murders motherhit by a falling objectimax versionstabbing a womanwoman on fireteenage prankstertrampledwomen wearing a one piece swimsuitcollapsing housedeath by falling objectprom kingreference to samsonwomen's locker roommother murders daughtersanitary napkinpig bloodteen pregnancybucket of bloodtragic villainessclothes shoppiggeryreference to tim tebow (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo …vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
| Subgenre: | independent filmcult filmconspiracyb horrorpsycho thrillerpolitical thrilleramerican horrorpolitical conspiracy |
| Themes: | murderdeathpoliticstorturefilmmakinginvestigationpsychopathparanoiaguiltsadismsurveillanceevilexploitationtechnologyclaustrophobia |
| Mood: | neo noirnightslasher |
| Locations: | hospitaltrainsnowcityrooftoptrain stationpennsylvaniacar in water |
| Characters: | slasher killerdoctorprostituteserial killerdetectivephotographerhitmankillervillainserial murderermurder of a prostitute |
| Period: | 1980swinter |
| Story: | grindhouse filmpsychotronic filmcharacters killed one by onebody countwoman in jeopardystabbed to deathwatching tvknifetwo word titlefemale nuditynuditybare breastsfemale frontal nudityflashbackbare chested male …guntitle spoken by characterchasesurprise endingshowerwoman on topcar accidenturinationrescuelingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgepoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessmurdererfireworkscult directorgraffititrustkillingmaniactape recorderrecordingmutilationcaught having sexcrying womanmovie theaterphone boothpsychofroggrindhousevictimparadedead womanmale underwearwatching televisionrampagedamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbriefsdead woman with eyes openkilling spreereckless drivingpsychoticpolitical corruptionpsycho killerfilm industryinterrupted sexserial murderpsychopathic killerbad guymadmantruthsubway stationtelevision newsblackoutmotel roomhomicidal maniacrestroomgovernortv reporterslashingwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathsadistic psychopathtapemurder spreetelevision reporterdisturbed individualbroken bottlewiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepydisturbingred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingdrive in classicwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | slasher flickindependent filmcult filmpsycho thrillerteen horroramerican horror |
| Themes: | murderdeathdrugspsychopathparanoiainsanityevilabductionalcoholism |
| Mood: | high schoolnightmareslasher |
| Locations: | schoolsmall townelevatorkitchentruck |
| Characters: | slasher killermother son relationshipfamily relationshipspoliceteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlserial killernursepolicemansecurity guardalcoholic …villainsecretaryterrormysterious villain (See All) |
| Period: | 1990syear 1998 |
| Story: | bloody violencecharacters killed one by onebody countstabbed to deathknifeviolencebloodnumber in titlesequelchasepistolcar accidentfalling from heightmaskbirthday …dead bodyneighborhallucinationtelephonesubjective cameradecapitationgood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancestabbingdeath of friendthroat slittingtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityevil manactor shares first name with characterstalkingreunionflowersplattermaniacbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingpsychovictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.
| Subgenre: | independent filmcult filmblack comedysuspensepsycho thrillerpsychological thrilleramerican horror |
| Themes: | murderdeathfriendshiprevengeinfidelitydrugsrapechristmasmoneyjealousydrinkingfeartorturedrunkennessescape …weddinginvestigationdeceptionmemoryangerdivorcepsychopathbrutalityparanoiablackmaildrug useinsanitymental illnessrivalryevilabuseexecutionbreak upgreedpaniccannibalismhomelessnessfashionwealthmadness (See All) |
| Mood: | goresatireneo noirslasherambiguous ending |
| Locations: | new york citybarrestauranthelicopterbathtubnightclubtaxiapartmentpolice caroffice |
| Characters: | slasher killerhomosexualpoliceboyfriend girlfriend relationshipprostitutepolice officerserial killerdetectivepolicemanlawyerkillerlustsecurity guardvillainsecretary …terrorcousin cousin relationshipamericanpolice shootoutpolice chasehomeless manserial murdererjewish americanself narrationcheating on one's girlfriendsex with prostitutesex killer (See All) |
| Period: | 1980schristmas party |
| Story: | bloody violencecharacters killed one by onebody countremote controlwoman in jeopardystabbed to deathf wordwatching tvknifetwo word titlebloodviolencefemale nudityf ratedbased on novel …male nuditythreesomefemale frontal nuditymale frontal nuditymale rear nuditydogbare chested malegunsex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplesphotographexplosionpartyleg spreadingchasesurprise endingpantiespistolshowerfirevoice over narrationfondlingcryingcell phoneshootouttitle directed by femalebeatingcorpseshot to deathunderwearblood splatterfoodcar accidentmirrorshot in the chesturinationblondeshot in the headcatcameradrinkundressinggunfightsex in bedthongbare buttheld at gunpointsunglassesrunninglingeriebedcar crashdead bodyinterrogationvoyeurrevolvermanhattan new york citytelephonemenage a troisdecapitationcleavagefoot chasegay slurbrawinenew yorkstrangulationaxevideo cameraambulancestabbingwomanmontageimpalementcocainestabbed in the chestexploding carmodelsevered headscantily clad femaledrawingdouble crosscontroversypolice officer killedvoice overcigar smokingshot in the foreheadbartenderracial slurconfessionattempted murderlimousineblack pantiesbusinessmanscreamingpay phonechampagnesex with shoes onmassagemistaken identitymissing personevil mankicked in the facechristmas treescreamshot in the shoulderfemale removes her clothesdatepigpremarital sexmurdererfirst parthandgunkillingblood spattersplattermaniacprivate detectivesurgerychainsawmachismoeyeglassescloseted homosexualpornographywaiteranswering machinefireplacerevelationmass murderlooking at oneself in a mirrortape recordersociopathscene during opening creditslifting someone into the airragevirusexercisewatching a moviebuttockseccentricgossipimpersonationphone boothpsychocovered in bloodvictimbrooklyn new york cityblack humorrapistschizophreniarealitymale underwearguardrampagebarefootjanitorrear entry sextensiontelescopecouchhatredfitnessimpostorcannibaldark humorbutcherheadphonesescape attemptlaughtersketchslaughterrefrigeratortuxedoduct tapeaxe murderbriefcasenervous breakdownalienationethnic slurkilling spreeworld trade center manhattan new york citysirenpsycho killerdrugged drinkwoman in bathtubpervertserial murdervillain played by lead actorpsychopathic killervideo tapefianceebad guyhysteriamadmanface masklaundrynotebookkilling a dogmisogynisthuman monstermen's bathroomspiral staircasefemale removes her dresssnorting cocainejournalmini dresssexual perversionhomicidal maniacrestroomskyscrapermasseuselaundromatslashingcall girlsplit personalitycredit cardbody in a trunknarcissismreference to donald trumpdance clubwoman in bra and pantiesnihilismyuppiedruggedbathrobebusiness cardoffscreen killingcdeastersense of smellbumpearl necklaceurinalcarnage80s musicsole black character dies clichevanityfur coatsushihomeless personreference to ronald reaganoverhead camera shotrealtorhobopool of bloodfemale bartenderfemale victimlunaticsadistic psychopathcocaine snortingceohedonismvice presidentanimal killingmass murdererdisturbed individualjerkbutcherywalkmaninnocent person killedsuspenderscrime spreehigh societyidentity crisismaterialismstairwellmartinideeply disturbed personserial rapistcityscapekilled during sexbroken engagementcult figureborderline personality disordercorporate executivenail gunwall street manhattan new york cityaxe in the headsex act reflected in mirroranswering machine messageruthlessnessbritish actor playing american characterautomated teller machinebottled watercreepycompact discexercisingspiked drinkraincoatmisanthropeambiguitytwin towerscuisinemultiple personality disordervideotaped sexworld trade centersadisticstockbrokerharvard universitynylonswashroomdissectionover the tophigh risedouble murderdragging a dead bodygory violenceeast coastsickolock of hairstreet walkeraxe murdererchauvinismmanicureunreliable narratorgruesomepornographic videotanning bedfirst lesbian experiencelasciviousnessmistletoemurder confessionbloodlustchainsaw murdermusic fansavagerywall streetsexual experimentationinvestment bankermurdered womanreservationsteroidlistening to music on headphonesvoice imitationyale universitydry cleaningemployee employee relationshiphacked to deathsex maniacbedsheetbrutalmergerreference to ted bundycheating on one's boyfriendoffice jobreference to mikhail gorbachevdecolletagestain27 year oldnarcissistic personality disorderparanoiacsadistic killeranti consumerismfemale victimsfrenzylithiumovercoatinner monologueslashed to deathstuffed toy animalxanaxreference to whitney houstoncouturefeet on deskreference to genesiswhite collarantisocial personality disorderblack nylon stockingsclothes hangerhiding evidencepet pigfalse alibikentucky derbysadistic sexsound systemreference to dorian graycorporate raiderdead body in bathroomreference to ed geinreference to phil collinswoman kicks a manchild of divorcechinese laundryhead in refrigeratorskin caresnorting coketruth taken as a jokecranberry juicepretend telephone callreference to elvis costellorope skippingcoasterharvard business schoolreference to ivana trump (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
| Themes: | murderdeathdrugsrapetortureincestpsychopathbrutalityinsanityevilexploitationmurder of family |
| Mood: | goreslasher |
| Locations: | chicago illinois |
| Characters: | slasher killerbrother sister relationshipprostituteserial killerkillervillainterrormysterious villainserial murderermurder of a prostitute |
| Period: | 1980s |
| Story: | off screen murdergrindhouse filmbody countstabbed to deathviolencebloodfemale nuditycharacter name in titlenuditybare breastsgunsurprise endingshot to deathblood splatter …shot in the chestlow budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcheryexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com