Best popular movies like Conan The Barbarian:

Do you need specific genre & keyword selection to find films similar to Conan The Barbarian?
<< FIND THEM HERE! >>

Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Barbarian (1982)

A village is attacked by the evil ruler of the Snake Cult, Thulsa Doom ('James Earl Jones' (qv)) and his evil warriors, when Thulsa Doom and his warriors kills his parents, a young boy named Conan ('Jorge Sanz (I)' (qv)) is enslaved. Years later, Conan grows up and becomes a mighty warrior and is tr …ained as a fighter. After years as a slave and as a gladiator, Conan is set free. Conan sets out on a quest as he vows to avenge his parents and solve the riddle of steel. Joined by a archer named Subotai ('Gerry Lopez (I)' (qv)), a beautiful thief who falls in love with Conan, Valeria (sandahl Bergman') and a Chinese wizard ('Mako (I)' (qv)), Conan and his companions sets out to rescue Princess Yasmina ('Valerie Quennessen' (qv)), daughter of King Osric ('Max von Sydow (I)' (qv)), from the Snake Cult, and get his revenge on Thulsa Doom and avenge his parents. (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmchrist allegoryalternate historyepicmartial arts
Themes:
self sacrificemurder of mothermurder of fathersamuraimythologyvengeancecannibalismdeath of motherdeath of fatherbrutalityseductionmagicfuneraltortureghost …suicidefriendshipmurderrevengedeath (See All)
Mood:
poetic justicegore
Locations:
townseadesert
Characters:
samurai swordrevenge seekerrevenge motivewitchaction herowarriortough guythiefboymother son relationshipfather son relationship
Story:
hand to hand combatcannibal cultfilm starts with a quotefilm starts with quoteevil sorcerersevered handsnake pitgiant snakefirst of seriespart of serieswarrior racewarrior womansword forgingbroken swordsword and sandal …sword fightingone man armyfinal battlesword duelblack magickatana swordfuneral pyresword fightvoice over narrationrevenge killingsacrificing own life100th century b.c.based on multiple worksman versus beastmute villainhyborian agepaleolithic agebased on pulp magazine10000 b.c.symphonic music scorerobert e. howarddeath of petkilled by a dogman beastavengelotusblueberryhead on a stakepeplummongolmuscleseating human fleshtwo against onereference to friedrich nietzschequoteavengerstone agesteelevil powerancientinterspecies sexserpentstabbed in the mouthalternate versionloinclothcounter culturevultureorchestral music scorequotationprehistoric timeswarlordharemfamous scoregladiatoractual animal killedarcherbarbarianhandmasterhypnotismarenasorcerermegalomaniacstandoffnarratordeath of loved onemusclemannarrated by characterbreak inkendocrucifixionheroismcamelfight to the deathcapturebooby trappsychotronicwizardcannibalseriespart animationwitchcraftmutilationslaverykilling an animalbow and arrowspearathletewolftwenty somethingrunawaybattlefieldsacrificepremarital sexevil manperson on firefemme fataleprincesskingfictional warnarrationanti herosevered headcultsnakestabbed in the cheststabbed to deaththroat slittingimpalementarmyaxename in titlegood versus evildecapitationkung fucombatorgydemonshowdownfalling from heightswordbattleshot in the headface slapblood splatterthree word titlecharacter name in titlefemale frontal nuditybare chested malefemale nuditysex scenebloodfightviolence (See All)

Conan The Barbarian (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Barbarian (2011)

A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.

Subgenre:
sword and fantasysword and sorceryalternate historyepicmartial arts
Themes:
murder of fathervengeancedeath of motherdeath of fatherbrutalitymagictorturesuicidemurderdeathrevengekidnappingjealousypregnancyescape …herosupernatural powercrueltydeath of wifedeath of daughterdeath in childbirth (See All)
Mood:
gore
Locations:
snowboatwoodscastlecampfirewalled city
Characters:
witchaction herowarriortough guythiefboyfather son relationshiphusband wife relationshipfather daughter relationshipsoldiersingle fatheryounger version of characterdancing girl
Story:
hand to hand combatevil sorcererwarrior womansword forgingsword and sandalsword fightingone man armysword duelblack magicsword fight100th century b.c.hyborian agepaleolithic agebased on pulp magazine10000 b.c. …robert e. howardstone ageancientserpentprehistoric timeswarlordarcherbarbariansorcerermegalomaniacmusclemancapturemutilationslaverykilling an animalbow and arrowspearbattlefieldpremarital sexevil manperson on fireprincesskingfictional waranti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementaxename in titlegood versus evildecapitationcombatdemonshowdownfalling from heightswordbattleshot in the headblood splatterthree word titlecharacter name in titlebare chested malefemale nuditysex scenebloodviolencefightmale nudityflashbackexplosionknifechasefireshot to deathfistfighthorseshot in the chestremakerescueslow motion scenemaskbased on comicinterrogationfightingshot in the backfoot chaseassassinbound and gaggedbased on comic bookambushmassacremountaindisguisemixed martial artsnunno opening creditsdisarming someonechild in perilritualunderwater scenecreatureshot in the legdrowningone against manybeaten to deathstabbed in the backkeyattackkicked in the facetough girlscarchildbirthexploding bodyneck breakingtied upthreatened with a knifemercenarywaterfallsevered armfreeze framesingle parenthenchmanpirateburned alivehead buttassassination attempteggcatfightkicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationfemale warriordamsel in distressadventurerdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeondisfigurementeye patchpassionate kissdemonic possessionburned to deathdaggerstick fightpipe smokingpalaceswordsmandriftermonasterystrongmanfireballhuman sacrificeworld dominationshot with an arrowadventure herotaverntentacletestcrushed headslingshothammockchainedfacial scarrighteous rageclawsubterraneanblacksmitharm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipshot with a bow and arrowstarts with narrationhorse chasewagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manbouldercatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionfalling through icerope bridgepoisonedremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonfreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffseeing father murderedvolley of arrowsfall through floorfour against onenatural bridgetied to a wagon wheel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Conan The Destroyer (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conan The Destroyer (1984)

The wandering barbarian, Conan, alongside his goofy rogue pal, Malak, are tasked with escorting Queen Taramis' virgin niece, Princess Jehnna and her bodyguard, Bombaata, to a mystical island fortress. They must retrieve a magical crystal that will help them procure the horn that legends say can awak …en the god of dreams, Dagoth. Along the way, Conan reunites with the wise wizard, Akiro and befriends the fierce female fighter, Zula. Together the heroes face ancient traps, powerful Wizards, plots of betrayal, and even the dream god, Dagoth, himself! (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmalternate historymartial artsindependent filmdark fantasy
Themes:
murdermonsterherowrestling
Locations:
desertcastle
Characters:
action herowarriortough guythiefaunt niece relationship
Period:
1980s20th centuryyear 1984
Story:
hand to hand combatsword and sandalsword fightingone man armysword duelsword fight100th century b.c.man versus beasthyborian agepaleolithic agebased on pulp magazine10000 b.c.robert e. howardstone ageancient …prehistoric timesbarbariankendocamelwizardspearbattlefieldprincessanti herosevered headcultstabbed in the chestthroat slittingname in titlecombatshowdownblood splattercharacter name in titlebare chested malebloodviolencesequelbeatingfistfighthorsemirrorblonderescuepunched in the facebrawlambushmixed martial artsdisarming someonetransformationvirginkeystatueopening action scenewaterfallqueendestinyhead buttmagicianstabbed in the stomachkicked in the stomachback from the deadchokingfemale warriorguardreverse footagedual wieldhit in the crotchknife throwingkingdommutationsequel to cult favoritedaggerstick fightspittingswordsmanhuman sacrificeadventure herochosen onestaffbeefcakekicked in the groinhorse chasesevered earaxe fighthornbreaking glasslast of seriesgodsasian manspear throwingrenegadejapanese manfoolflying kickscratchchoke holdtwentieth centuryaxe throwingstabbed with a spearstatue comes to lifehall of mirrorsvirgin sacrificestabbed with knifeenchanted forestplainsfalse promisescratching someone's facebody slamstabbed with a stickwizards' duelgrabbear hugbloody scratches (See All)

King Arthur: Legend Of The Sword (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
sword and fantasysword and sorcerychrist allegorymartial artscoming of ageblack comedysupernaturaldark fantasyrevisionist history
Themes:
self sacrificemythologydeath of motherdeath of fatherbrutalitymagicfuneralfriendshipdeathrevengemurdersurrealismkidnappingmoneybetrayal …jealousyprisonfearescapemonsterdeceptionrobberyangersupernatural powerparanoiaredemptionexecutionhopedeath of wifepaniccourage (See All)
Mood:
rainnightmaredarkness
Locations:
forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer
Characters:
witchaction herowarriortough guythiefmother son relationshipfather son relationshiphusband wife relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostage …little boymaiduncle nephew relationshipmermaidself doubt (See All)
Story:
hand to hand combatevil sorcerergiant snakeone man armyblack magicfuneral pyrearchersorcerermusclemanslaverybow and arrowspearwolfbattlefieldevil man …femme fatalekingfictional waranti herosevered headsnakestabbed in the cheststabbed to deaththroat slittingimpalementarmyaxegood versus evildecapitationcombatdemonshowdownfalling from heightswordbattleshot in the headblood splattercharacter name in titlebare chested maleviolencebloodfightflashbackdogtitle spoken by characterexplosionknifechasesurprise endingfirebased on bookbeatingcorpseshot to deathfistfighthorseshot in the chestrescueslow motion scenepunched in the facewritten by directorbrawlinterrogationprostitutionbritishislandriverfightingshot in the backsubjective cameraspyfoot chaseorphancandlegangambushstrangulationmassacredisguisemontagebridgemixed martial artsprisonermapnonlinear timelinedisarming someonechild in perilritualunderwater scenecreatureshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagedestructionburned alivehead buttassassination attemptfaintingscene during opening creditshelmetroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downtavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorcoronationcatapultturned to stonebare knuckle fightinggunpowderking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionvenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

Gods Of Egypt (2016) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gods Of Egypt (2016)

Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)

Subgenre:
sword and fantasychrist allegoryepicmartial artsblack comedytragedyaustralian fantasyaustralian science fictionaustralian horrorscience fantasy
Themes:
self sacrificemythologydeath of fatherbrutalityseductionrevengemurderdeathlovesurrealismkidnappingbetrayalfearescapemonster …deceptionsupernatural powerredemptionfaithhopeapocalypseblindnesscouragenear death experienceafterlifeunlikely heroegyptian mythology (See All)
Mood:
poetic justicedarknessaustralian supernatural
Locations:
desertelevatorshipouter spacecavejungleaustralian space travel
Characters:
action herowarriortough guythiefmother son relationshipfather son relationshiphusband wife relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostageex husband ex wife relationshipdeath of girlfriend
Story:
hand to hand combatgiant snakesword and sandalone man armyfinal battlesword fightvoice over narrationwarlordmegalomaniacnarrated by characterbooby trapslaverybow and arrowspearbattlefield …evil mankingfictional waranti herosevered headsnakestabbed in the cheststabbed to deathimpalementarmyaxegood versus evildecapitationcombatorgydemonshowdownfalling from heightswordbattlebare chested maleviolencebloodfightflashbackkissexplosionknifechasesurprise endingfirebeatingcorpsefistfighthorseshot in the chestrescueslow motion scenepunched in the facebrawlbedsurvivalbedroomassassinambushold manmassacremountainbridgemixed martial artsno opening creditsdouble crossunderwater scenecreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatuelightningopening action sceneskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionburned aliveflyingassassination attemptbreaking and enteringquesthelmetelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowcrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorcapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragonhenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Legend Of Hercules (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Legend Of Hercules (2014)

In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr …incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)

Subgenre:
christ allegoryepicmartial artsconspiracy
Themes:
mythologydeath of mothertorturesuicidemurderdeathrevengebetrayalescapedeceptionsupernatural powerunrequited lovehopegreek mythology
Locations:
desertforestvillagewoodsshipcastlecavecampfire
Characters:
action herowarriortough guyfather son relationshipmother son relationshiphusband wife relationshipbrother brother relationshipteachersoldierhostage
Story:
hand to hand combatsword and sandalone man armysword duelsword fightwarlordgladiatorarcherarenafight to the deathslaverybow and arrowspearbattlefieldsacrifice …princesskingsevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmyaxegood versus evildecapitationcombatshowdownfalling from heightswordbattleshot in the headcharacter name in titlebare chested malebloodviolencefightexplosionknifechasesurprise endingfirebeatingshot to deathfistfighthorseshot in the chestslow motion scenepunched in the facewritten by directorbrawlshot in the backambushdeath of friendmixed martial artsno opening creditsshot in the legskinny dippingattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backelectrocutionstatuekicked in the facelightningopening action sceneshot in the shoulderhorse ridingneck breakingthreatened with a knifemercenarywaterfallshot in the armwhippingbare chested male bondagequeenprincestylized violencecaptainheavy rainhelmetkicked in the stomachjumping from heightrebellionforbidden loveanimal attackslavefull moonshieldcrossbowdual wieldstabbed in the throatwhip3 dimensionalegyptstabbed in the legpunched in the chestliondungeonrainstormknife throwingpalacesuper strengthstabbed in the armcommandercheering crowdgoddessstabbed in the shoulderbettingforced marriageshot in the crotchanimal killingrock climbinghusband murders wifeman hits a womanbeefcakeancient greecestabbed in the footorigin of heroflaming arrowtyrannybare knuckle fightingspear throwingdeus ex machinahanged by the neckconquestherculeschariotvirtual setdemi godtunicamphitheaterbound in chainsreference to zeusflaming swordbranding ironcliff divingafrican lionfemale gladiatorgolden eagleblood sportarmy on the march (See All)

In The Name Of The King: A Dungeon Siege Tale (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Name Of The King: A Dungeon Siege Tale (2007)

Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmepicmartial artstragedy
Themes:
vengeancedeath of motherdeath of fathermagictorturefriendshipdeathrevengemurderlovekidnappingpregnancyescapeweddingmonster …herodeceptionmemorysupernatural powergriefgreedadoptiondyingcourage (See All)
Mood:
rain
Locations:
townforestvillagewoodsfarmlakecastle
Characters:
action herowarriortough guyboyfather son relationshipmother son relationshipfamily relationshipshusband wife relationshipfather daughter relationshipfriendbrother sister relationshipsoldiervillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All)
Story:
hand to hand combatwarrior womansword and sandalsword duelblack magicfuneral pyresword fightarchersorcererstandoffheroismcapturewizardwitchcraftbow and arrow …spearbattlefieldprincesskingfictional warthroat slittingarmyaxegood versus evilcombatshowdownfalling from heightswordbattleblood splatterviolencefightbloodflashbackkissexplosionknifechasefirecryingfoodhorserescueslow motion scenebooktearsrunningneighborsubjective camerasurvivalwinecandlemassacremountainstabbingbridgeeatingmixed martial artsprisonermapdisarming someonenecklaceduelgravelibraryattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralchild murderdestinymachetecaptivestabbed in the stomachgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelmedieval timespridedungeonarmorraidsiegelieutenantkingdomtelekinesissmokedaggerimprisonmentcrowpeasantlevitationfarmingshot with an arrowcommanderhanging upside downfantasy worldheirclimbing a treetitle in titleflamedeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekshot with a bow and arrowbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangcatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsedefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All)

Immortals (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Immortals (2011)

Eons after the Gods won their mythic struggle against the Titans, a new evil threatens the land. Mad with power, King Hyperion (Mickey Rourke) has declared war against humanity. Amassing a bloodthirsty army of soldiers disfigured by his own hand, Hyperion has scorched Greece in search of the legenda …ry Epirus Bow, a weapon of unimaginable power forged in the heavens by Ares. Only he who possesses this bow can unleash the Titans, who have been imprisoned deep within the walls of Mount Tartaros since the dawn of time and thirst for revenge. In the king's hands, the bow would rain destruction upon mankind and annihilate the Gods. But ancient law dictates the Gods must not intervene in man's conflict. They remain powerless to stop Hyperion...until a peasant named Theseus (Henry Cavill) comes forth as their only hope. Secretly chosen by Zeus, Theseus must save his people from Hyperion and his hordes. Rallying a band of fellow outsiders - including visionary priestess Phaedra (Freida Pinto) and cunning slave Stavros (Stephen Dorff) - one hero will lead the uprising, or watch his homeland fall into ruin and his Gods vanish into legend. (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmtragedy
Themes:
self sacrificemurder of mothermythologydeath of mothermagictorturedeathrevengemurderfriendshipbetrayalsupernatural powermadnessgreek mythology
Mood:
gorenightmare
Locations:
village
Characters:
action herothiefmother son relationshipfather daughter relationshipsoldiersingle motherinterracial relationshipyounger version of character
Story:
hand to hand combatfilm starts with quotewarrior womansword and sandalfinal battlesword fightvoice over narrationancienthanddeath of loved oneheroismfight to the deathmutilationslaverybow and arrow …spearperson on firekingfictional warsevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmygood versus evildecapitationcombatswordbattleblood splatterbare chested malesex sceneviolenceone word titleflashbackkissfemale rear nudityinterracial sexsurprise endingshowercorpsehorseshot in the chestslow motion scenesubjective cameramixed martial artsno opening creditsdisarming someonejourneycharacter repeating someone else's dialoguevirginstabbed in the backpoisoncharacter's point of view camera shotstatuekissing while having sexwhippingdismembermentsubtitled scenestylized violencetraitorburned aliveloss of virginityquesthelmetloss of friendstabbed in the stomachloss of loved onetemplehammermonkcrushed to deathback from the deadbroken legmasked manslavefemale warriorinterracial romancevisionloss of sonstabbed in the throathit in the crotch3 dimensionalstabbed in the neckresurrectionimmortalitystabbed in the headensemble caststabbed in the legdeath of protagonistexploding headtitle at the endeye gougingcastrationtragic heroatheisttorso cut in halffemale soldierprayingfinal showdowngatemazefemale fighterbeastinterracial kisspremonitioneagleatheisminterracial couplefacial scarbowshapeshiftinghit with a hammertsunamiimmolationhawkknife held to throatepic battletitle spoken by narratorlabyrinthlast standtragic villainsliced in twostabbed in the footlifted by the throatcamaraderieeunuchsevered tongueoracletidal waveminotaurspear throwingreference to socratesencampmentzeustridentreflection in eyetorture devicesuper weapontitanathenachild born of rapeapolloposeidonolympuspart narratedaresson seeing mother murderedsword held to throat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Red Sonja (1985) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Red Sonja (1985)

The tyrant Gedren seeks the total power in a world of barbarism. She attacks and kills the keepers of a powerful talisman just before it is destroyed. Gedren then uses the power of the talisman in her raid of the city Hablac. Red Sonja, sister of the keeper, sets out with her magic sword to overthro …w Gedren. The talisman's master Kalidor follows to protect her. Of course they fall in love - however Red Sonja's power bases on the oath to never give herself to any man... (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmalternate historymartial artsswashbuckler
Themes:
magicrapewrestling
Locations:
castlesea monster
Characters:
action herowarriortough guyfemale protagonist
Story:
hand to hand combatsword duelsword fighthyborian agestone ageprehistoric timesbarbarianmasterstandoffmusclemankendopsychotronicbow and arrowspearbattlefield …fictional warstabbed in the chestdecapitationcombatshowdownswordbattleblood splattercharacter name in titlebare chested malefemale nudityviolencefightbloodkisshorseblondemaskfightingcleavagewomanmixed martial artsdisarming someonedueltough girlscarunderwatersevered armdismembermentlifting someone into the airvillainessaction heroinecrushed to deathfemale warriorguardcrossbowsiegeteleportationbeheadingswordsmanstrongmanadventure heroredheaded womanfencinggirl powerlesbian subtextgiant spiderkiller robotbattle axetalismannipple sliplava stream (See All)

The 13th Warrior (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The 13th Warrior (1999)

In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted  …to combat a terror that slaughters the Vikings and devours their flesh. (Read More)

Subgenre:
sword and sorcerycult filmepicfish out of waterswashbucklerrevisioniststonepunk
Themes:
cannibalismfuneralmurderdeathlovereligiondrinkingfeardeceptiontravelsupernatural powermurder of brothernorse mythology
Mood:
gorerain
Locations:
forestboatwoodscavecampfire
Characters:
warriorboymother son relationshipfather son relationshipfamily relationshipstattooreference to godfacial tattoo
Story:
hand to hand combatcannibal cultsevered handsword and sandalsword fightvoice over narrationbarbariancamelcannibalmutilationbow and arrowspearbattlefieldkingfictional war …severed headsnakeaxegood versus evilcombatdemonswordbattlethree word titleviolencebloodfightbased on novelnumber in titledogfirecorpsehorsedrinkvomitingdead bodyswimmingunderwater scenecreaturelegendpoisonmissiontenthangingdeath of brotherhorse ridingwaterfallsevered armpoetbearsleepingcowdismembermentprincehelmetskulltorchshieldinvasionexilearabeye patchkingdomfortune tellerdaggerfast motion scenetranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectheirperfumefacial scarmiddle agesprophetdiplomatfleeingshot with a bow and arrowretreatbanishmentnoblemanflaming arrowhoneybonesadaptation directed by original authorreference to allahsword and shieldangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All)

Warcraft (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Warcraft (2016)

When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth,  …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)

Subgenre:
sword and fantasysword and sorceryepicdark fantasy
Themes:
self sacrificebrutalitymagicfuneralghostdeathrevengemurderfriendshipsurrealismbetrayalpregnancyfeardrunkennessescape …monsterinvestigationdeceptionangercorruptionsupernatural powersadismexploitationhoperegret (See All)
Locations:
churchforestsnowvillagewoodscastle
Characters:
action herowarriortough guymother son relationshipfather son relationshiphusband wife relationshiptattoobrother sister relationshipsoldierbabyhostagesingle fatherpregnantengineer
Story:
evil sorcerersevered handwarrior racefinal battlesword duelblack magicsword fightvoice over narrationmuscleswarlordsorcerermegalomaniacnarrated by characterfight to the deathcapture …wizardslaverywolfbattlefieldevil mankingfictional waranti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmyaxegood versus evildecapitationcombatdemonshowdownfalling from heightswordbattleshot in the headblood splatterbare chested maleviolencebloodfightbased on novelone word titleexplosionknifechasesurprise endingfirebeatingcorpseshot to deathfistfighthorseshot in the chestrescueslow motion scenepunched in the facearrestbrawlbookinterrogationriversubjective camerasurvivalambushstrangulationmassacremountaindeath of friendprisonermapno opening creditsbirdchild in perildouble crossritualunderwater scenecreaturetransformationduelone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentknocked outkicked in the facetough girllightningskeletonmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled sceneprincestylized violencesingle parenthenchmaneavesdroppingtraitorloyaltydestructionrevelationhead butthelmettold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetblockbustergiantpoolrebelcovered in bloodsheepskullknightmind controlhonortorchburialaction heroineanimal attackcrushed to deathslavefemale warriorfull moonguardbarefootdwarfreverse footageshieldinvasionloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the enddeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationwilhelm screamtelekinesisdaggerexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensanti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationcrowninterracial marriagehead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianpart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreathorse chasemacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagesurroundedgreen skinhordetunicsceptertooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

300: Rise Of An Empire (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

300: Rise Of An Empire (2014)

After its victory over Leonidas' 300, the Persian Army under the command of Xerxes marches towards the major Greek city-states. The Democratic city of Athens, first on the path of Xerxes' army, bases its strength on its fleet, led by admiral Themistocles. Themistocles is forced to an unwilling allia …nce with the traditional rival of Athens, oligarchic Sparta whose might lies with its superior infantry troops. But Xerxes still reigns supreme in numbers over sea and land. (Read More)

Subgenre:
epic
Themes:
death of fatherbrutalitymurderrevengedeathrapebetrayalpoliticsdeceptionredemptionsadismexecution
Mood:
gore
Locations:
seadesertbeachboatshipcaveoceanstorm at seasea battlewalled cityship fire
Characters:
action herowarriortough guyfather son relationshipsoldierpriest
Story:
hand to hand combatsword and sandalfuneral pyresword fightvoice over narrationwarlordarcherstandoffwizardbow and arrowspearbattlefieldperson on firefemme fataleking …anti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmygood versus evildecapitationcombatshowdownfalling from heightswordbattleshot in the headblood splatterfemale frontal nuditybare chested malesex scenebloodviolencenumber in titlebare breastssequelflashbackmale rear nuditydogfemale rear nuditynipplesexplosionknifesurprise endingfiretopless female nuditywoman on topbeatingcorpsedigit in titleshot to deathfistfighthorseshot in the chestrescueslow motion scenepunched in the facebrawlsecond partshot in the backspyorphanambushtoplessmassacredeath of friendmontagenonlinear timelinechild abuseno opening creditsunderwater sceneshot in the legdrowningtransformationtrainingstabbed in the backmoaningtentkicked in the facetough girllightningskeletonfarmershot in the shoulderlong takemanipulationscarexploding bodyneck breakingthreatened with a knifesevered armgeneralwhippingqueenstylized violencetopless womancivil warmachismotraitordestinyburned aliveheavy rainshot in the stomachhelmetelephantvillainessjumping from heightskullrape victimtorchaction heroinecrushed to deathmasked manslavefemale warriorguardshieldfloodface painttarget practiceinvasiondual wieldstabbed in the throat3 dimensionalstabbed in the neckgreecenippleprophecystabbed in the headmentoroilsenatorstabbed in the legrainstormeye gougingknife throwingstabbed in the eyeaxe murdersevered legdaggerprequelpalacecrowfemale soldierblood on camera lenshistorical fictiongreeksex slaveshot with an arrowyoung version of charactercommandernavycornfieldbased on graphic novelman punching a womanswimming underwatercrushed headcowgirl sex positionaltered version of studio logoopen endedexploding shipbreastdeformitychild rapearmy baseathens greecethronesex from behindman slaps a womanburning buildinghunchbackstarts with narrationwoman moaning from pleasurewoman moaningancient greecemoaning womanflaming arrowmessengerman fights a womandefectorkicked in the chesttidal wavestabbed in the crotchantiquityspear throwingsinking shipnaval battlevirtual setdark horse comicsmeleetunicbound in chainsarmadadoggie style sex positionwar roomsex against the wallsea serpentmultiple sex positionssex against a wall5th century b.c.hell hound (See All)

Prince Of Persia: The Sands Of Time (2010) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prince Of Persia: The Sands Of Time (2010)

Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.

Subgenre:
sword and fantasysword and sorcerymartial artsswashbuckler
Themes:
death of fathermurdermarriagebetrayalescapeherotime travel
Locations:
desertsnow
Characters:
action herowarriortough guysoldier
Story:
hand to hand combatsword and sandalsword fightingone man armysword duelblack magicsword fightancientsorcererbow and arrowprincesskingfictional waranti herosnake …armyaxegood versus evilkung fucombatshowdownswordbattleviolenceflashbackkisstitle spoken by characterexplosionchasehorsefoot chaseorphanassassinambushmountaincolon in titlemixed martial artsfalse accusationno opening creditson the runone against manyfugitivebrotherprincestylized violencestrong female characterdestinycountry name in titleraceassassination attemptheroinespin offstrong female leadreverse footageshieldsandcrossbowseven word titledual wieldbased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomdaggerframed for murderunclepalaceswordsmanparkourfortressadopted sonmacguffinrobetitle in titleempirecorrupt officialsubterraneanshot with a bow and arrowarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All)

Hercules (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hercules (2014)

1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god …s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)

Subgenre:
sword and fantasysword and sorcerymartial artsblack comedy
Themes:
self sacrificeghostdeathrevengemurderlovekidnappingbetrayalprisondrunkennessescapemonsterdeceptionredemptionfaith …death of wifemurder of familygreek mythology (See All)
Mood:
gorenightmaremyth
Locations:
trainforestsnowvillageearthwalled city
Characters:
action herowarriortough guymother son relationshipfather daughter relationshipsoldierhostagebullyuncle nephew relationshipex soldier
Story:
hand to hand combatsword and sandalone man armysword fighthead on a stakewarlordarchermegalomaniaccapturebow and arrowspearwolfbattlefieldperson on fireprincess …kingfictional warsevered headsnakestabbed in the cheststabbed to deaththroat slittingimpalementarmyaxegood versus evildecapitationcombatshowdownfalling from heightswordbattleshot in the headblood splattercharacter name in titlebare chested malebloodfightviolenceone word titleflashbackdogfemale rear nuditytitle spoken by characterpartyknifefirecorpseshot to deathhorseshot in the chestrescueslow motion scenepunched in the facebased on comicjailhallucinationfightingshot in the backorphanbased on comic bookambushmassacremountaindisguisemontageprisonermapnonlinear timelinebrunetteno opening creditschild in perildouble crosscreatureshot in the legtraininglegendstabbed in the backattackstorytellingstatuetentknocked outkicked in the facetough girllightningopening action scenefarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenarysevered armshot in the armgeneralbare chested male bondagekillingprincestylized violencecivil warrockpiratetraitorgolddestinyhead butthelmetjail cellvandalismfraudlossclubtorchfateaction heroineanimal attackfalse identitycrushed to deathfemale warriorfull moonadventurershieldhaunted by the pasttarget practicesufferingpastdual wieldstabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswampstabbed in the leghit on the headexploding headdark herolionaerial shotdungeonknife fightsoulknife throwingstabbed in the eyekingdomtragic herodaggerpalacecrowdrugged drinkstrongmangiant monsterstabbed in the armadventure herotavernbased on graphic novelstabbed in the shoulderteamworkchainedshot in the throatrighteous ragestabbed in the facetragic pastdeath of familypsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greecegiant animalepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendreflaming arrowtyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dracula Untold (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula Untold (2014)

At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)

Subgenre:
christ allegorytragedy
Themes:
self sacrificemythologydeath of motherbrutalitysuiciderevengemurderdeathlovesurrealismkidnappingbetrayalfeardeceptionsupernatural power …hopedeath of wifenear death experience (See All)
Locations:
churchforestlondon englandwoodscastlecave
Characters:
action herowarriortough guymother son relationshipfather son relationshiphusband wife relationshipsoldierhostagevampireself mutilationex soldierself healingblood lust
Period:
15th century
Story:
hand to hand combatone man armyblack magicsword fightvoice over narrationwarlordbow and arrowspearwolfbattlefieldevil manperson on fireanti herostabbed in the cheststabbed to death …throat slittingimpalementarmyaxegood versus evilcombatdemonshowdownfalling from heightswordbattleblood splattercharacter name in titlebare chested maleviolencebloodflashbackexplosionknifechasesurprise endingfirebeatingcorpsehorserescueslow motion scenepunched in the facerunningriversubjective cameracandleambushmassacremountainmapno opening creditschild in periltransformationon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingcharacter's point of view camera shottentlightningskeletonshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenefreeze frameprincestylized violencemaniacdestinyburned alivehead buttgothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroburned to deathpigeonprequelbatyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All)

The Huntsman: Winter's War (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Huntsman: Winter's War (2016)

Subgenre:
sword and fantasysword and sorcerymartial artsblack comedysuspensesupernaturalfairy taledark fantasybased on fairy tale
Themes:
magicmurderrevengedeathlovesurrealismkidnappingmarriagebetrayalfearescapemonsterherodeceptionanger …obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All)
Locations:
churchforestsnowvillagewoodscastlecampfire
Characters:
action herowarriortough guythiefsoldierbabyhostagesister sister relationshiplittle girllittle boy
Story:
hand to hand combatone man armyblack magicsword fightvoice over narrationwarlordarchermegalomaniacheroismfight to the deathbooby trapbow and arrowspearwolfbattlefield …femme fatalekingfictional waranti herosnakestabbed in the chestimpalementarmyaxegood versus evilcombatshowdownswordbattleshot in the headface slapcharacter name in titlebare chested malebloodfightviolencesequelflashbackkissexplosionknifechasesurprise endingbeatingcorpsefistfighthorsemirrorshot in the chestrescueslow motion scenepunched in the facebrawlsecond parthallucinationriversubjective cameraorphancandleambushmassacremountainmontagebridgemixed martial artsfalse accusationno opening creditsbirddisarming someonechild in perildouble crosscreaturenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeypowerstylized violencechessiceeavesdroppingtraitorgoldfireplaceburned aliverevelationhead buttassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementaerial shotknife fightdeerpassionate kisskingdomburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmenthappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womantragic lovedeath of familywoman fights a mansorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All)

The Hobbit: The Battle Of The Five Armies (2014) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Battle Of The Five Armies (2014)

After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.

Subgenre:
sword and fantasysword and sorceryepicmartial artshigh fantasy
Themes:
self sacrificeghostrevengemurderdeathlovebetrayalescapedeceptionobsessioninsanitygreed
Mood:
poetic justice
Locations:
towndesertforestsnowboatcastlecavewalled city
Characters:
action herowarriortough guyfather son relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshipsoldiermayor
Story:
hand to hand combatfinal battlesword fightarcherdeath of loved onewizardbow and arrowspearbattlefieldperson on firekingfictional warsevered headstabbed in the cheststabbed to death …throat slittingarmyaxegood versus evildecapitationcombatdemonshowdownfalling from heightswordbattleshot in the headfightviolencebased on novelsequelflashbackdogexplosionknifesurprise endingfirecorpseshot to deathhorseshot in the chestrescueslow motion scenepunched in the facedead bodyhallucinationshot in the backsurvivalambushmountaindeath of friendbridgemapno opening creditschild in perilcreaturethird partnecklacedrowningstabbed in the backfantasy sequencedragonstatuetentknocked outrabbittough girlopening action sceneringdeath of brotherpigmercenarysevered armbearrefugeesubtitled scenestylized violencecivil wariceropegolddestinydestructionhead buttcagehelmetloss of friendloss of loved onetreasurehammercrying womanblockbustergiantjumping from heightpart of trilogyfaked deathknightforbidden lovehonorburialaction heroineanimal attackgoatcrushed to deathpresumed deadfemale warriorbarefootdwarfshielddual wieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathstabbed in the headstabbed in the legsexy womanloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeearcherycrownstabbed in the armeaglewoman kills a manfriends who live togethergoblinstabbed in the shouldercowardraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footcousinarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosoutnumberedfalling through icebridge collapsebell towerelkballadeerorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Eragon (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Eragon (2006)

The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E …ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmepicmartial artsswashbuckler
Themes:
mythologymagicmonsterherocourage
Locations:
castle
Characters:
warriortough guyboysoldier
Story:
hand to hand combatevil sorcerersword and sandalsword fightingsword duelancientsorcererheroismwizardbow and arrowspearbattlefieldkingfictional wararmy …good versus evilcombatdemonswordbattlecharacter name in titlefightbased on novelone word titlebased on bookhorsesecretfightingsubjective cameraambushdeath of friendmixed martial artsdisarming someonedueldragonegghunterknightdwarfsiegekingdomtragic herodaggerstick fightelfadventure herofantasy worldopen endedchosen onestaffteenage heroshot with a bow and arrowfictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All)

The Scorpion King (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Scorpion King (2002)

In an ancient time, predating the pyramids, the evil king Memnon is using the psychic powers of his sorceress Cassandra to fortell his great victories. In a last ditch effort to stop Memnon from taking over the world, the leaders of the remaining free tribes hire the assassin Mathayus to kill the so …rceress. But Mathayus ends up getting much more than he bargained for. Now with the help of the trickster Arpid, tribal leader Balthazar and an unexpected ally, it's up to Mathayus to fufill his destiny and become the great Scorpion King. (Read More)

Subgenre:
sword and sorcerymartial arts
Themes:
magicbetrayalherowrestling
Locations:
desertcitycave
Characters:
action herowarriortough guythiefboyhorse thief
Story:
hand to hand combatsword and sandalone man armysword duelsword fightancientharemmusclemancamelspearbattlefieldkingfictional warsevered headsnake …throat slittingimpalementaxecombatshowdownfalling from heightswordbattlethree word titlecharacter name in titleviolencefightexplosionknifefirefistfightrescuebrawlanimal in titlefightingassassinambushstrangulationmixed martial artsno opening creditsdream sequencedisarming someoneduelpoisonopening action scenewaterfallcross dressingdestinyspin offskullvisiontelescopeexplosivesandresistancedual wieldinventorhit in the crotchknife throwingraidsiegedead boyrescue missionarrowdaggerprequelpalaceswordsmanspit in the facestrongmanparkourarcherystabbed in the armcrystalscorpionpatricideanttyranttitle in titlebowarm wrestlingsorceressurnancient egyptvalleyclairvoyantshot with a bow and arrowcobraflaming arrowsandstormcatapultfalcongunpowderclairvoyanceswordplayantiquityfire antgrappling hookrubygongsinkholeoasisprecognitionseerflaming swordsoothsayerwrestler as actorarrow in backreference to sodompoisoned arrowarrow catchingarrow in the backgomorrahgomorrahitenear death survivorprequel to sequelacadianarrow in one's backwall of firelima syndrome (See All)

Pompeii (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pompeii (2014)

Set in 79 A.D., POMPEII tells the epic story of Milo (Kit Harington), a slave turned invincible gladiator who finds himself in a race against time to save his true love Cassia (Emily Browning), the beautiful daughter of a wealthy merchant who has been unwillingly betrothed to a corrupt Roman Senator …. As Mount Vesuvius erupts in a torrent of blazing lava, Milo must fight his way out of the arena in order to save his beloved as the once magnificent Pompeii crumbles around him. (Read More)

Subgenre:
epicmartial artsmelodramadisaster filmdisaster movie
Themes:
death of motherdeath of fathertorturerevengemurderdeathkidnappingpoliticsprisondeceptionblackmailunrequited lovemurder of family
Locations:
forestlondon englandvillagewoodsship
Characters:
action herowarriortough guyhusband wife relationshipfather daughter relationshipmother daughter relationshipsoldierhostagesister sister relationshipmayor
Story:
hand to hand combatsword and sandalone man armysword fightloinclothgladiatorarenaslaverybow and arrowspearbattlefieldperson on fireprincessanti herosevered head …stabbed in the cheststabbed to deaththroat slittingimpalementarmyaxedecapitationcombatshowdownfalling from heightswordbattlebare chested malebloodfightviolenceone word titleflashbackdogkisstitle spoken by characterexplosionknifechasefirebeatingfistfighthorserescueslow motion scenepunched in the facebrawlorphanwinestrangulationmassacremountainmixed martial artsprisonerchild in perilunderwater scenetrainingattempted murderone against manystabbed in the backrace against timestatuekicked in the facelightningexploding bodyneck breakingloss of fatherthreatened with a knifesevered armloss of motherwhippingbare chested male bondageriotdisasterfalling down stairsdestructionburned aliveheavy rainscene during opening creditshelmetexploding buildingkicked in the stomachforbidden lovefestivaltorchinterracial friendshipcrushed to deathsocial commentaryearthquakeslaveguardshieldfloodblood on facedual wieldstabbed in the throatwhip3 dimensionaltitle appears in writingescape attemptsenatorstabbed in the legpunched in the chestvolcanodeath of sisterdungeontribeknife throwingpassionate kisschainburned to deathbeheadingburied aliveshipwreckvillastabbed in the armemperorlavafilm starts with textstablebritainnatural disasterancient romerighteous ragecorrupt officialdeath of familyexploding shiptsunamianimal killingwavebitecarriagehorse chasemacehorse drawn carriageno survivorsroman empirebuilding collapseromancell matevolcanic eruptionbare knuckle fightingmusculartidal wavespear throwing1st centurychariotcoastal towncelticcolosseumdoomed romancefinger bitten offsinkholehead held underwaterashgiant wavetunicwooden swordamphitheaterbeheadedtogashivslave auctionvolcano eruptionmale bondageforbidden romancepompeiimount vesuviusgolden eaglepyroclastic flowblood on backmuscular physiquemap on screentown in titlewhirlwind romance (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Centurion (2010) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Centurion (2010)

Britain, A.D. 117. Quintus Dias, the sole survivor of a Pictish raid on a Roman frontier fort, marches north with General Virilus' legendary Ninth Legion, under orders to wipe the Picts from the face of the Earth and destroy their leader, Gorlacon.

Themes:
self sacrificefuneraltorturemurderrevengekidnappingbetrayaldrunkennessescapedeceptionhunting
Mood:
gorenightmare
Locations:
forestsnowvillagewoodscavecampfire
Characters:
witchwarriorfather son relationshiptattoosoldierhostageself mutilation
Story:
hand to hand combatsevered handwarrior racesword and sandalfuneral pyresword fightvoice over narrationhead on a stakestabbed in the moutharchernarrated by characterfight to the deathbooby trapkilling an animalbow and arrow …spearwolffemme fatalekinganti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmyaxedecapitationcombatshowdownfalling from heightswordbattleshot in the headblood splatterbare chested malebloodfightviolenceone word titledogtitle spoken by characterknifechasesurprise endingfirecorpseshot to deathhorseshot in the chesturinationslow motion scenepunched in the facebrawlrunningrivershot in the backf wordsurvivalwineambushstrangulationmassacremountainstabbingdeath of friendfishnonlinear timelinefalse accusationchild in perildouble crossshot in the legon the runattempted murderdangerstabbed in the backprologuescreamingattackfugitivepoisontentkicked in the facedeath of childlightningshot in the shoulderscardeath of sonhorse ridingtrapwaterfallgeneralsubtitled scenechild murdertraitorfireplacewhat happened to epiloguehead buttassassination attempthelmetrome italylifting someone into the aircookstabbed in the stomachhunterhidingnosebleedcampjumping from heightcovered in bloodhonortorchanimal attackbar fightbroken legeaten alivefemale warriorfull moonreverse footageshieldface paintteamresistancestabbed in the throatscotlandmanhuntgash in the facestabbed in the neckmuteshot in the facestabbed in the headstabbed in the legexploding headdisembowelmenteye gougingdeerarmorclifftribestabbed in the eyebody countaxe murderrescue missionsevered legcharacters killed one by onearrowburned to deathsuffocationstabbed in the handset upgreekcremationshot in the neckfemale fighterfireballtombstoneshot with an arrowgovernorstabbed in the armslashingemperorcommandershot in the eyetavernfilm starts with textbehind enemy linesblizzardman kills a womanoffscreen killingmushroombritainhead cut offslingshotstabbed in the shoulderbleeding to deathshot through the mouthsole black character dies clicheshot in the throattreacherybladecamouflagerepeated lineancient romefacial scarstabbed in the facearm wrestlingsole survivorcoughing bloodarmy basevalleygreat britainfortthroat cutscottish accentstarts with narrationstrong mandutch anglescrollbegins with texthuthands tiedbattle axefalling off a cliffaxe in the headroman empiredrinking bloodflaming arrowmessengerrescue attemptstabbed in the sidemale camaraderiemass killingromanguerilla warfarebodily dismembermentpunched in the crotchdefectorromatrackerscoutwood carvingsurprise attackscreaming in painshot in the kneestabbed in the crotchman huntoutpostdeath by impalemententrailsriver rapidstrackinglegionwar woundstabbed through the cheststomach ripped openroman soldierwar paintsword and shieldarrow in chestcarvinghead held underwaterleg cut offguerrilla warfarevengenceashaxe in the chestpoisoned drinkaxe throwinghead split in halftunicbound in chainsstabbed with a speartooth knocked outyorkface paintingbegins with historical notescenturionmute womanflipping a coinroman legioncliff divingjumping into a riverrunning into a treewoman warriorstabbed through the mouthanimal carcassprimal screamgolden eagle2nd centuryjumping off clifftauntroman armyhiding under floorboardsstabbed through the backtreating a woundcatching fish by handchild with a knifearmy on the marchhadrian's wallimpaled on a spearthrowing an axe (See All)

Princess Mononoke (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Princess Mononoke (1997)

While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos …hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)

Subgenre:
sword and fantasycult filmchrist allegoryepicmartial artstragedydisneyadult animationdark fantasy
Themes:
samuraimythologyfriendshiploveherodeceptionnatureprejudice
Mood:
goreanime
Locations:
forestjapan
Characters:
samurai swordwarriorhuman animal relationship
Period:
16th century15th century
Story:
hand to hand combatsword duelkatana swordsword fightfamous scorekendomutilationbow and arrowwolfprincessfictional wardecapitationcombatdemonshowdown …swordblood splattercharacter name in titlebloodfightviolencef ratedtwo word titleguntitle spoken by characterknifechasehorseriflefightingshot in the backweaponanimaldisarming someonejourneytransformationduelcurseopening action scenemanipulationsevered armhateprincestrong female characterspiritheroinehunterblockbusterstrong female leadcompassionfemale warriordual wieldpeaceenvironmentalenvironmental issuedark heroknife fightenvironmental issuesdaggerfolkloresuper strengthconservationgirl powerkindnessfabletolerancemusketdeforestationgiant animalfortshot with a bow and arrowboarhorse chasemoral ambiguityirondilemmawild boarforest protectionleprosyelknature conservationanimal protectionferal childsevered limbpanterritoryutopia questhuman versus animalwhite wolfthe westcutting off a handanimal allytalking wolf (See All)

Ying Xiong (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ying Xiong (2002)

In ancient China, before the reign of the first emperor, warring factions throughout the Six Kingdoms plot to assassinate the most powerful ruler, Qin. When a minor official defeats Qin's three principal enemies, he is summoned to the palace to tell Qin the story of his surprising victory.

Subgenre:
christ allegoryepicmartial artswuxia
Themes:
self sacrificevengeancefuneralsuicidefriendshiplovesurrealisminfidelitybetrayaljealousyherodeceptionredemptionexecutionhope …courage (See All)
Locations:
desertschoollakechina
Characters:
action herowarriortough guy
Story:
hand to hand combatwarrior womanone man armysword duelsword fightvoice over narrationancientheroismspearpremarital sexkingstabbed in the chestarmycombatshowdown …swordbattleshot in the headbare chested malebloodviolencefightflashbackmale rear nuditysurprise endingshot in the chestslow motion scenefightingorphanassassincandleritualshot in the legtrainingduelone against manylibrarylegendstabbed in the backkicked in the facestylized violenceflyingassassination attempttold in flashbackfaked deathhonorcompassionchop sockyfemale killersocial commentarydeath of protagonistrainstormtragic heroarrowmain character diespalacefemale assassinswordsmanlocal blockbusterlost lovetrue lovearcheryidealismfilm starts with textheritagetyrantkindnessresponsibilityrespectredescorttragic lovegreendeath of title characterpatriotundressing someoneflashback within a flashbackman with no namewu shurewardbluemale full back nuditynameless charactercalligraphywuxia fictionancient chinaunreliable narratordouble impalementwalking on waterbody searchunreliable flashbackunreliable narrationthrone roomcolor motif (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Beowulf (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Beowulf (2007)

Set against the coming of Christianity, this is the story of the last hero: in 507, a monstrous troll wreaks havoc in the mead hall of the Danish king, Hrothgar. He offers rewards for the death of Grendel, so Beowulf, a great and boastful Geat warrior, arrives with his thanes. Beowulf sets aside his … armor and awaits the monster; a fierce battle ensues that leads to Beowolf's entering the watery lair of Grendel's mother, where a devil's bargain awaits. Beowulf returns to Herot, the castle, and becomes king. Jump ahead many years, and the sins of the father are visited upon Beowulf and his kingdom. The hero must face his weakness and be heroic once again. Is the age of demons over? (Read More)

Subgenre:
sword and sorcerycult filmepictragedycomputer animationcgi animationadult animation
Themes:
mythologyvengeancecannibalismbrutalityseductionmagicfuneralsuiciderevengedeathmurderfriendshipinfidelityadulterydrinking …drunkennessmonsterheromemorycorruptionobsessionredemptioncourageinheritance (See All)
Mood:
gore
Locations:
seabeachchurchforestshipcastlecaveoceanstorm
Characters:
warriorfather son relationshipmother son relationshiphusband wife relationshipsingersoldierpriestchristianitymermaiddeath of herohuman versus monster
Story:
funeral pyresword fightloinclotharcherfight to the deathmutilationbow and arrowspearperson on firekingsevered headstabbed to deaththroat slittingimpalementarmy …good versus evildecapitationcombatdemonfalling from heightswordbattleblood splattercharacter name in titlefemale frontal nuditybare chested malefemale nudityviolencefightsexmale nudityone word titlekisstitle spoken by charactersingingchasesurprise endingfirebeatingdreamcorpseslow motion scenereenactmentbrawlmassacrestabbingdeath of friendbridgeapologyno opening creditsritualcreatureduelgravelegendcursebeaten to deathstabbed in the backactor playing multiple rolesdragonsadnessratsevered armqueendismembermenthatepowergoldloyaltyburned alivequestfametold in flashbackdenmarktreasurebuttocksgiantservanthonorburialanimal attackeaten alivecelebrationpromisedwarfshieldloss of sonstabbed in the throatprophecystabbed in the headswampstabbed in the legdisembowelmentheartslaughterarmordisfigurementstabbed in the eyebroken armkingdomloss of husbandtragic herosevered legdaggersinshamereflectionnecrophiliavikingshot with an arrowarcherycrownstabbed in the armfortressburnt facetaverncrushed headtrollseductressstabbed in the shoulderbleeding to deathheirmartyrclawritedeformityheart ripped outburning buildingsailing shipexpressionismcustomrewardarm ripped offillegitimate sonbased on poemleadershipfeastsagabattle axefalling off a cliffhornaxe in the headsliced in twoorigin of herotreasure cheststabbed in the sidedanishcoronationburned bodyfire breathing dragonfake bloodtorn in halfconquestnude fightlairchildlessnessmotion capturedeath by firesplit in twodesecrationdark agesfleethospitalityhero worshipcandlestickweaknesswenchavariceretellingspear through chestswimming competitionsword throwingdeath by swordnorsestabbed in chestwinged dragontrampled to deathfuneral riteseacoastancient sworddragon riderraider6th centuryragnarokhuman versus dragontest of characterrafterbare backburning churchburning citymonster childhuman fallibilityold englishbeast's heart (See All)

47 Ronin (2013) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

47 Ronin (2013)

While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga …to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)

Subgenre:
sword and fantasysword and sorceryepicconspiracytragedydark fantasy
Themes:
samuraideath of fathermagicghostsuiciderevengemurderdeathsurrealismkidnappingescapeweddingmonsterdeceptionsupernatural power …redemptionunrequited loveritual suicide (See All)
Locations:
forestsnowcemeteryvillagewoodsjapanlakeshipcastlecampfire
Characters:
samurai swordwitchaction herowarriortough guyfather son relationshiphusband wife relationshipfather daughter relationshipsoldierhostageteacher student relationshipself mutilationhuman versus monstersamurai warriorhunting party
Story:
sword duelsword fightarcherfight to the deathwitchcraftbow and arrowspearbattlefieldperson on firesevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmy …axedecapitationcombatdemonshowdownswordbattleshot in the headblood splatterbare chested malebloodviolencenumber in titleflashbacktitle spoken by characterexplosionknifechasesurprise endingbased on true storyfirebeatingcorpsedigit in titleshot to deathhorseshot in the chestrescueshot in the backfoot chaseorphancandleambushmassacremountaindisguisemapfalse accusationno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologueattackpoisondragonmanipulationexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagestylized violenceburned aliveheavy raintempleexploding buildingspidervillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadguardarranged marriagecrossbowstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexiledark heromeditationsnowingtragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offmusketshape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All)

Alexander (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Alexander (2004)

Conquering 90% of the known world by the age of 25, Alexander the Great led his armies through 22,000 miles of sieges and conquests in just eight years. Coming out of tiny Macedonia (today part of Greece), Alexander led his armies against the mighty Persian Empire, drove west to Egypt, and finally m …ade his way east to India. This film will concentrate on those eight years of battles, as well as his relationship with his boyhood friend and battle mate, Hephaestion. Alexander died young, of illness, at 33. Alexander's conquests paved the way for the spread of Greek culture (facilitating the spread of Christianity centuries later), and removed many of the obstacles that might have prevented the expansion of the Roman Empire. In other words, the world we know today might never have been if not for Alexander's bloody, yet unifying, conquest. (Read More)

Subgenre:
christ allegoryepicmartial artscoming of ageconspiracytragedymelodrama
Themes:
death of fatherbrutalityseductionfriendshipdeathmurderrevengemarriagebetrayaljealousypoliticspregnancyfeardrunkennessescape …danceweddingherodeceptionangerparanoiadysfunctional familywrestlingfaithexecutioncouragephilosophynear death experiencegreek mythologyhomosexual love (See All)
Mood:
gorewedding nightgreek myth
Locations:
desertsnowcavejungleindiawalled city
Characters:
action herowarriortough guymother son relationshipfather son relationshiphusband wife relationshipdoctorteachersoldierdancerbest friendinterracial relationshiphomosexualityteacher student relationship …snipergay frienddeath of herohomosexual kissdancing girl (See All)
Story:
hand to hand combatfilm starts with quotesword and sandalfinal battlesword fightvoice over narrationwarlordharemarcherarenacamelslaverybow and arrowspearbattlefield …femme fataleprincesskinganti herosevered headsnakestabbed in the cheststabbed to deaththroat slittingimpalementarmyaxedecapitationcombatorgyswordbattleshot in the headface slapblood splattercharacter name in titlefemale frontal nuditybare chested malefemale nuditybloodviolencefightmale nudityone word titlebare breastsflashbackmale rear nuditydogfemale rear nudityfemale full frontal nuditydancingtitle spoken by characterpartyknifesurprise endingfiretopless female nuditycorpseshot to deathfistfighthorseshot in the chestslow motion scenepunched in the facecatarrestbrawlbare buttletterbedhallucinationrivershot in the backsubjective cameracleavagebisexualstrangulationmountainstabbingdeath of friendmixed martial artsmapnonlinear timelineno opening creditsscantily clad femaleassassinationdouble crossritualspankingshot in the legtrainingflash forwardattempted murdertreelegendargumentstabbed in the backpoisoncharacter's point of view camera shotstatuetentlightningopening action sceneringshot in the shouldercourtmanipulationscargiftloss of fatherthreatened with a knifesevered armshot in the armgeneralbearqueendismembermentmonkeyprincetraitordestinyloyaltyrevelationwhat happened to epilogueassassination attemptnipples visible through clothingelectronic music scoreheavy rainhelmetroyaltytold in flashbackelephantloss of loved onedysfunctional marriageblockbusterservantparadehonortorchfateanimal attackcrushed to deathambitionindianslavefull moonshieldvisionbraveryinvasionstabbed in the throathatredstabbed in the neckshot in the facegreecestabbed in the headthunderstormstabbed in the legdeath of protagonistdark heroliondisembowelmentaerial shotrainstormtigertribestabbed in the eyepassionate kisskingdomtragic herosevered legarrowparrotmain character diespalacedrugged drinkblood on camera lensbisexualityforename as titlegreekshot in the neckwar herometaphorwar violencesex slaveeuthanasiatreasonlost loveshot with an arrowyoung version of characterarcherycrownidealismstabbed in the armemperorpsychedelichead bashed inwetting pantsmercy killingshamancolonialismleadereaglestabbed in the shouldershot in the throathistorianspastabbed in the facedeath of title characterdistrustspitting bloodheroic bloodshedsorceresscavalryflashback within a flashbacksnake bitephilosopherancient egyptanimal killingbanquetassassination plotrainforestknife held to throatepic battleends with textretreatclothes rippingdutch anglescrollbird cageleadershipancient greecememoirmutinystabbed in the footjugglerone eyed manstruck by lightningbody armoreunuchcouncilbad motherpantherscreaming in painreference to aristotleoutnumberedoedipus complexantiquityhusband wife estrangementspear throwingjungle warfareconquestanimal sacrificeentrailsherculeschariotwar woundpersiastabbed through the chestzeusbloody sprayfire eatercave paintingtrippyends with historical notesmeleemacedonia25 year oldalchemistguerrilla warfarecavalry chargehadessurroundedpoisoned drinktemptresstitanthrown from a horsetunicathenaancient worldblack panthercriminal trialapollocave drawingfield hospitalnile riversnake charmerbabylonreference to zeusalexandria egyptjourney shown on mapmonsoonanti arabharnesssuccessordereliction of dutypiketroyafrican lionscribeherbal medicinereference to oedipusshot through the chestalexander the greatbabylon babyloniapersian catreference to achillesmedeaconquerorman boy loveinspirational speechcity stateprometheusreference to aphroditebattle cryreference to prometheusexecuting the woundedone eyed characterriding at a gallopfalse colorpolitical marriageroman salutebattle tactic (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Solomon Kane (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Solomon Kane (2009)

Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi  …kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)

Subgenre:
sword and fantasysword and sorcerychrist allegoryindependent filmb moviegothic horror
Themes:
cannibalismmagicfuneraltorturemurderdeathrevengekidnappingreligionbetrayaldrunkennessmonsterdeceptionredemptionfaith …abductiondevilmurder of familycooking over a campfire (See All)
Locations:
churchforestsnowcemeteryvillagewoodsenglandshipcastlecavecampfire
Characters:
witchwarriormother son relationshipfather son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierpriesthostagebibleself mutilation …ex soldiership captain (See All)
Period:
winter16th century1600s
Story:
black magicfuneral pyresword fightbased on pulp magazinesorcerercrucifixionwitchcraftslaveryperson on firekinganti herosevered headstabbed in the cheststabbed to deaththroat slitting …impalementarmyaxegood versus evildecapitationdemonshowdownfalling from heightswordbattleshot in the headblood splattercharacter name in titlebare chested malebloodviolenceflashbacktwo word titleguntitle spoken by characterexplosionknifechasesurprise endingfirecorpsehorsemirrorshot in the chestrescueslow motion scenemaskbased on comicinterrogationbritishprayerrivershot in the backambushmassacredisguiseno opening creditschild in perildouble crossjourneytransformationshot in the foreheadcursestabbed in the backprologuestatuetentknocked outdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armundeadprincerevelationheavy rainhatcaptivecrucifixtreasureaccidental deathjumping from heightmind controltorchmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydark herodead childjumping through a windowdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legburned to deathwilhelm screamdaggerteleportationcrowmudblood on camera lensillusiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortressshot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired malehorse chaseknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerbrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backhuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All)

Your Highness (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Your Highness (2011)

Throughout history, tales of chivalry have burnished the legends of brave, handsome knights who rescue fair damsels, slay dragons and conquer evil. But behind many a hero is a good-for-nothing younger brother trying just to stay out of the way of those dragons, evil and trouble in general. As two pr …inces on a daring mission to save their land, they must rescue the heir apparent's fiancee before their kingdom is destroyed. Thadeous (McBride) has spent his life watching his perfect older brother Fabious (Franco) embark upon valiant journeys and win the hearts of his people. Tired of being passed over for adventure, adoration and the throne, he's settled for a life of wizard's weed, hard booze and easy maidens. But when Fabious' bride-to-be, Belladonna (Zooey Deschanel), gets kidnapped by the evil wizard Leezar (Justin Theroux), the king gives his deadbeat son an ultimatum: Man up and help rescue her or get cut off. Half-assedly embarking upon his first quest, Thadeous joins Fabious to trek across the perilous outlands and free the princess. Joined by Isabel (Natalie Portman)-an elusive warrior with a dangerous agenda of her own-the brothers must vanquish horrific creatures and traitorous knights before they can reach Belladonna. If Thadeous can find his inner hero, he can help his brother prevent the destruction of his land. Stay a slacker, and not only does he die a coward, he gets front row seats to the dawn of an all-new Dark Ages. (Read More)

Subgenre:
sword and fantasysword and sorcerymartial artsblack comedy
Themes:
magictorturerevengemurderdeathkidnappingdrugsbetrayaldrunkennessescapeweddingmonsterdeceptionsupernatural power
Mood:
gorespoofparody
Locations:
forestwoodscastlecampfire
Characters:
witchaction herowarriorfather son relationshipbrother brother relationshipsoldierhostage
Story:
hand to hand combatevil sorcererblack magicsword fightsorcerermegalomaniaccapturewizardcannibalkilling an animalbow and arrowbattlefieldprincesskinganti hero …severed headstabbed in the cheststabbed to deathimpalementarmyaxegood versus evildecapitationcombatswordbattleblood splatterbare chested malefemale nuditybloodfightviolencemale nuditytwo word titleexplosionpartyknifechasefirecorpsefistfighthorserescuebrawlf wordfoot chaseambushmixed martial artsbirdritualcreatureskinny dippingvirginstabbed in the backmissiondragonrace against timetough girlattempted rapeexploding bodycharacter says i love youthreatened with a knifewaterfallsevered armfireworksbare chested male bondageprincestrong female charactertraitorquesttied to a bedgiantknightstrong female leadtorchaction heroineanimal attackbar fightfemale warriorfull moondamsel in distressdwarfreverse footagesevered fingercrossbowprophecystabbed in the headstabbed in the legsibling rivalrydungeonknife fightslackertribekingdomrescue missionsevered legcrude humorswearingdaggerteleportationpipe smokingpalacetorso cut in halfpractical jokemazefemale fighterscene before opening creditsgiant monsterhuman sacrificeworld dominationstonertavernkiss on the lipskidnappershapeshiftinganimated creditsriddletwo brothersone woman armycompassthronelong haired malehorse chasehorse drawn carriageeclipsesuit of armordouble entendrestabbed in the footwarlockgiant creatureinterrupted weddingstabbed with a swordscalpingroyal weddingminotaurswordplaybest manoutnumberedwedding daybad singingchastity beltseerheir to the throneclothes torn offmaking facesstorybookman woman fightmanservantspeared to deathwhipping someonemagical staffthong bikinimechanical birdthrowing a speartackled to the groundsaying booarm chopped offspear in chest (See All)

The Great Wall (2016) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Great Wall (2016)

When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army … of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)

Subgenre:
sword and fantasyalternate historyheistfish out of watercreature featureperiod dramaperiod piecedark fantasymonster movielive action and animation
Themes:
self sacrificefuneralfriendshipdeathmurdersurrealismbetrayalprisonfearescapemonsterdeceptionrobberyparanoiaredemption …greedpaniccouragenear death experience (See All)
Mood:
poetic justice
Locations:
desertchurchrooftopcavechinacampfiretunnelsewer
Characters:
action herowarriortough guythiefteachersoldierinterracial relationshipchinesealien monster
Period:
15th centuryzip line
Story:
severed handfinal battlearcherheroismcapturebow and arrowspearbattlefieldfictional waranti herosevered headstabbed to deathimpalementarmyaxe …good versus evildecapitationcombatshowdownfalling from heightswordbattleblood splatterthree word titleviolenceexplosionknifechasesurprise endingfirecorpsehorseshot in the chestrescueslow motion scenearrestbomborphanbound and gaggedambushmassacremountainprisonermapno opening creditsdisarming someonedouble crosscontroversycreatureshot in the legcharacter repeating someone else's dialoguedangerattackstatueknocked outopening action sceneexploding bodysuspicionthreatened with a knifemercenarysevered armgeneralqueensubtitled scenetruststylized violenceshavinggrenadedestructionburned alivecagehelmetjail cellcaptivetemplebeardjumping from heightirishculture clashhonortorchcannoneaten aliveguardrampageshieldtarget practiceexplosivebraveryinvasioncrossbowdual wieldanimated sequencepartner3 dimensionalchaosevacuationescape attempt3ddark herodynamitemedieval timesaerial shotdungeontribesiegestabbed in the eyedark pastkingdomtragic heroburned to deathpalacebullet timeimprisonmentrockettorso cut in halfbanditfemale soldiertranslatorblood on camera lensflaghistorical fictionfinal showdowntowergiant monsterfireballstonetwo man armyshot with an arrowarcherywallemperorcommanderdrumfilm starts with textcrash landingoffscreen killingcrashing through a windowmacguffinpotionmale protagonistacrobatgurneybritish soldiermeteorhot air balloontragic pastmiddle agesdistrustpsychotronic filmcavalrybanquetarmoryacrobaticsthronealien creaturenomadhorse chasemedallionscrollhands tiedsuit of armorspaniardstudio logo segues into filmkaijumagnetnunchucksharpoongiant creaturecatapultcouncilgunpowdercaught in a netstampedespear throwinggreen bloodspear gunbowlswarmancient chinabackflipgreat wall of chinacannonballstore roomdining roombungee jumpchinese armyaxe throwinghordeman with a ponytailtunic11th centuryburning bodyengine roomsecret military operationstabbed through the mouthhiveopening creditsenvoygreat wallwhite saviorchinese lanternwall of firesleeping potion (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Underworld: Blood Wars (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld: Blood Wars (2016)

The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)

Subgenre:
martial artsconspiracysupernaturaldark fantasy
Themes:
self sacrificedeath of fatherbrutalityseductiontorturedeathmurderlovebetrayalfearescapedeceptionangersupernatural powerparanoia …redemptionsurveillanceunrequited lovepanicnear death experience (See All)
Mood:
poetic justicegoredarkness
Locations:
trainsnowmotorcyclewatercastlelaboratorytunneltrain stationcar motorcycle chasemotorcycle chase
Characters:
action herowarriortough guyfather son relationshipfemale protagonistsoldierhostagevampiresecurity guardsniperself healing
Story:
hand to hand combatfinal battlesword fightvoice over narrationbreak infight to the deathspearbattlefieldsacrificeevil manfemme fatalefictional warsevered headstabbed in the cheststabbed to death …throat slittingimpalementarmydecapitationcombatshowdownfalling from heightswordbattleshot in the headblood splatterbare chested malebloodfightviolencef ratedsequelflashbackexplosionpartyknifechasesurprise endingpistolshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunhorseshot in the chestshotgunrescueslow motion scenepunched in the facegunfightbrawlheld at gunpointbombinterrogationfightingshot in the backspysurvivalflashlightassassinambushstrangulationmassacremountainbridgemixed martial artssuicide attemptsubwayfalse accusationno opening creditsdisarming someonedouble crossshot in the legtransformationshot in the foreheadon the runtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backfugitivepoisonknocked outkicked in the facetough girllightningopening action sceneringshot in the shouldermanipulationbodyguardinjectionneck breakingloss of fatherthreatened with a knifedirectorial debutsevered armshot in the armhandgunpowerstylized violencehenchmanak 47werewolficetraitoruzifalling down stairsbulletburned aliverevelationassassination attempthypodermic needlegothicheavy rainsecurity camerakicked in the stomachvillainesspooljumping from heightcovered in bloodstrong female leadaction heroinemexican standofffemale killergun fuback from the deadambitionfemale warriorguardreverse footageshieldhaunted by the paststealing a cartarget practiceexplosivecrossbowconfrontationdual wieldstabbed in the throatmercilessnessstabbed in the neckresurrectionshot in the facestabbed in the headframe upstabbed in the legpunched in the chestjumping through a windowassault rifleaerial shothologramrainstormknife throwingraidsnowingstabbed in the eyedark pastfemale directorfifth partburned to deathframed for murderbullet timetorso cut in halftracking devicefemale assassindesert eaglefemale soldierfinal showdownreturning character killed offstabbed in the handfemale fighterpistol whipsubway stationsuper strengthstabbed in the armfemale spyfemale vampirebroken mirrorfortresshanging upside downunderworldreluctant heroblizzardman kills a womanmacguffinwoman kills a manstabbed in the shoulderbullet woundheirburnt bodyevil womanshot in the throatshot in the footopen endedfur coatrighteous ragestabbed in the facecorrupt officialtragic pastwoman fights a mandistrustshooting rangemind readingone woman armyanti heroineglowing eyesknocked out with a gun buttarmoryhummersurveillance footageregenerationfemale antagonistslow motion action scenesecret doorwoman punches a mansuper speeddrinking bloodman fights a womandark heroinecage fightingsecret passagewayharpoonman punches a womansunlightcouncilwoman hits a manalbinohybridsilverhenchwomancrisis of consciencespear throwingsecret laboratorycovenfeature film directorial debutcage fightrailyardmachine pistolbloodlettingcomplotlatex catsuiturban gothicburning bodytragic heroinewoman breaks man's neck50. caliber machine gunstrapped to a tablerecap segmentstabbed through the backclemencytwin handguns (See All)

The Magnificent Seven (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Magnificent Seven (2016)

Director Antoine Fuqua brings his modern vision to a classic story in The Magnificent Seven. With the town of Rose Creek under the deadly control of industrialist Bartholomew Bogue, the desperate townspeople employ protection from seven outlaws, bounty hunters, gamblers and hired guns. As they prepa …re the town for the violent showdown that they know is coming, these seven mercenaries find themselves fighting for more than money. (Read More)

Subgenre:
christ allegoryblack comedy
Themes:
self sacrificebrutalityfriendshiprevengemurderdeathbetrayaldrunkennessescapedeceptioncorruptiongamblingcouragemurder of a police officernear death experience
Mood:
poetic justice
Locations:
towndesertbarchurchforestcemeterysmall townwoodsfarmcampfirecanyon
Characters:
action herowarriortough guyhusband wife relationshipafrican americantattooprostitutenative americanalcoholicsnipersheriffasian americanex soldier
Period:
19th century
Story:
final battlevoice over narrationarcherstandoffdeath of loved oneheroismfight to the deathbooby trapkilling an animalbow and arrowbattlefieldevil manperson on fireanti herostabbed in the chest …stabbed to deathimpalementarmyaxegood versus evilcombatshowdownfalling from heightbattleshot in the headblood splatterbloodviolencenumber in titlecigarette smokingexplosionknifepistolfireshootoutcorpseshot to deathhorseshot in the chestremakeshotgunrescueslow motion scenerifleheld at gunpointinterrogationrevolvercriminalshot in the backassassinambushcaliforniastrangulationmassacremansiondeath of friendmontagedisarming someonecoffinchild in perilpolice officer killedcigar smokingshot in the legshot in the foreheadbartenderracial sluron the runtrainingduelone against manygravecharacter repeating someone else's dialoguestabbed in the backprologuecowboyfugitivetentfarmershot in the shoulderscarexploding bodydeath of husbandhorse ridingdie hard scenariothreatened with a knifemercenaryshot in the armsubtitled scenearsoncorrupt cophenchmangoldfalling down stairscard gamerevelationsociopathscene during opening creditscowboy hatjumping from heightirishhonortorchgoatinterracial friendshippreachermexicanthughaunted by the pastface painttarget practicebraverydual wieldmercilessnesschaosevacuationpost traumatic stress disorderpolice officer shotensemble caststabbed in the legdark herodynamitethrown through a windowoutlawaerial shotknife fightwisecrack humortitle at the endbounty hunterknife throwingminedark pasteye patchlens flareethnic slurcellargatling gunshot multiple timessouthern accentclose up of eyesshot through a windowmagic trickgamblerfinal showdownpistol whipquick drawshot with an arrowarcherygunslingerhired killershot in the eyesaloonsawed off shotguncabin in the woodsshot in the handteamworkminershot in the throatbadgeshot in the footscarfrighteous ragereference to abraham lincolnsix shooterwanted posterbarbershopgunfighterkicking in a doortycoonknocked out with a gun buttbilingualisminnocent person killedhostile takeovertrenchlast standchurch bellcowardicehorse chaseindustrialistknife in the chestcard trickhidden gunhorse drawn carriageaxe fightflaming arrowwestern townsharpshooterbaronone eyed manshot through a wallcamaraderieguerilla warfaretrackerabandoned mineenforcertomahawkblack herobell towermining townshot in the earspyglassabandoned churchapacheburial groundsacramento californiaevil businessmantrip wirecivil war veteranaxe throwingremake of remakelong range rifleyear 1879comanchecomanche indianreference to john d. rockefeller (See All)

Pride And Prejudice And Zombies (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pride And Prejudice And Zombies (2016)

The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.

Subgenre:
alternate historymartial artsindependent filmblack comedymelodramadystopiazombie apocalypse
Themes:
cannibalismbrutalityrevengedeathfriendshipmurderkidnappingmarriagebetrayalfeardrunkennessescapedanceweddingdeception …incestmilitarytravelparanoiaredemptionillnessunrequited lovehopeapocalypseprejudicewealthcouragenear death experience (See All)
Mood:
gorerainominous ending
Locations:
forestcemeterylondon englandvillagewoodsenglandrooftopwalled city
Characters:
action herowarriortough guyfamily relationshipsfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipfemale protagonistzombiesoldierpriesthostagesister sister relationshiplove triangle …cousin cousin relationshipaunt niece relationshipaunt nephew relationship (See All)
Period:
19th century
Story:
hand to hand combatsevered handone man armysword duelsword fightvoice over narrationcannibalspearbattlefieldfictional waranti herosevered headstabbed in the cheststabbed to deaththroat slitting …impalementaxegood versus evildecapitationkung fucombatshowdownfalling from heightswordbattleblood splatterfightbloodviolencebased on novelflashbackdoggunkissdancingexplosionpartyknifechasesurprise endingpistolfirebeatingcorpsefistfighthorserescueslow motion scenepunched in the facewritten by directorbrawlletterpaintingrifleheld at gunpointhallucinationbritishsubjective camerasurvivalambushmassacremansionbridgemixed martial artsdisarming someonedouble crossmarriage proposaltransformationtraininglibrarydangerstabbed in the backprologueattackcharacter's point of view camera shotrace against timetentknocked outtough girllightningscene during end creditslong takescarbodyguardexploding bodypigthreatened with a knifesevered armclass differencesdismembermentsubtitled scenestylized violencestrong female charactereavesdroppingtraitorcaptaincard gamemartial arts mastergrenadeburned aliverevelationheavy rainlooking at oneself in a mirrordiseaseroyaltyjail cellservantrebelstrong female leadforbidden loveviolinaction heroinecolonelcrushed to deathcannonfemale warriorguarddamsel in distressexplosivecorsetbraverydual wieldstabbed in the throathatredhit in the crotchmercilessnessstabbed in the necklove at first sightballexploding headpunched in the chestdark herosuperstitioninfectionprideaerial shotrainstormdisfigurementknife throwingdark pasteye patchlieutenantmutationtragic herocellarmoral dilemmaroundhouse kickblood on camera lensswordsmanface maskfemale fighterhead blown offepidemicphysicianquick drawmilitiaplagueflypocket watchbritish armywoman kills a manbritainstabbed in the shoulderfight the systemheirbritish soldieropen endedtragic pastwoman fights a manarm cut offaristocracycourtshiparmy basefade to blackanti heroinegrindhouse filmbilingualismthroneoutbreakhigh societygold diggersuitorelopementrich manslow motion action scenehorse drawn carriagesurprise during end creditswoman punches a manlordaxe in the headman fights a womansecret passagewaycountry estatemanor houseshaolinladywoman hits a manstory continued during end creditscliffhanger endingrich womansisterhoodswordswomanblood on mouthabandoned churchenglish countrysidegolddiggercavalry chargehordeman murders a womanfire pokergeorgian eraexploding bridgepeace treatyjourney shown on maprogue soldierends with weddingburning bodymashupregency periodparsoncollapsing bridgehouse flyrace warreference to the four horsemen of the apocalypsetotal warwoman wearing an eye patch (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ninja Assassin (2009) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ninja Assassin (2009)

Trained since childhood to be a lethal killer, Raizo has since turned his back on the Ozunu clan that raised him and now seeks revenge for their heartless murders. Teaming up with Europol investigator Mika, Raizo steadily butchers his enemies while inching ever closer to the long-awaited bloody reun …ion with his former master. (Read More)

Subgenre:
martial arts
Themes:
brutalitymagicrevengemurderdeathfearescapegangsterinvestigationsupernatural powerredemptionsurveillanceexecutionexploitationcruelty …murder of a police officer (See All)
Mood:
gorerainneo noir
Locations:
barhotelhelicopterpolice car
Characters:
action herowarriortough guytattoopolice officerpolice shootoutself mutilation
Story:
hand to hand combatsevered handone man armysword duelsword fightmasterkendofight to the deathcaptureanti herosevered headstabbed in the cheststabbed to deathimpalementgood versus evil …decapitationkung fucombatshowdownfalling from heightswordshot in the headblood splatterbare chested malebloodfightviolenceflashbackgunkisscigarette smokingexplosionchasepistolshowerfireshootoutshot to deathfistfightmachine gunshot in the chestrescueslow motion scenewatching tvarrestgunfightbrawlheld at gunpointcompetitionshot in the backf wordfoot chaseorphanassassinmassacremountainstabbingmixed martial artsprisonermapnonlinear timelinechild abuseno opening creditsassassinationhit by a carbartenderpainon the runtrainingone against manyorganized crimebeaten to deathstabbed in the backfugitiveninjaopening action scenescarmartial artistdeath of husbandblindfoldsevered armdismembermentstylized violenceberlin germanyak 47crime bossmachismogoldassassination attemptgothicloss of loved onetempleswat teamcovered in bloodrocket launchergun fugun battledivinghaunted by the pastsanddual wieldstabbed in the throatmercilessnessgash in the facestabbed in the neckstabbed in the headstabbed in the legdark herohealingslaughteryakuzalonerdark pasttragic herosevered leglasersightlightsirengovernment agentbloodbathgrenade launcherlaptop computertorso cut in halftracking devicefemale assassinblood on camera lensbeheadingkatanastabbed in the armlaundromatbullet ballethead bashed inninjitsugun actionhazingsense of smellcarnagebloodshedtragic pastarm cut offcut handvideo cassetteexit woundsuper speedhand cut offthrowing starshurikentied to a postgutsgun katainternal affairsgun sauheartbeaton the lamclanninja masterhead cut in halfdehydrationthrown through a wallgolden gunclimbing up a wallfight in the restroomosaka japangold watchpolice officer strangulatedgoreshedsliced bodybloody footprintstabbing a police officerpolice officer stabbed in the chestpolice officer stabbed in the backninja traininghook and chainsubordination (See All)

Highlander II: The Quickening (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Highlander II: The Quickening (1991)

The second "Highlander" movie, again with Christopher Lambert and Sean Connery. It's the year 2024 and all the ozone above Earth has gone. To protect people from dying, MacLeod helped in the construction of a giant "shield", several years ago. But, since there isn't left anyone Immortal after MacLeo …d's victory in the previous film, he has stopped being an Immortal himself. Now he is just an old man, until one day some other Immortals arrive on our planet. You see, the Immortals come from another planet... (Read More)

Subgenre:
sword and fantasysword and sorcerycult filmmartial artsindependent filmblack comedyconspiracydark comedyb moviedystopiafish out of watercyberpunkswashbucklercorporate conspiracy
Themes:
self sacrificerevengedeathmurderdrunkennessherodeceptionpsychopathsupernatural powerterrorismsurveillancefuture war
Mood:
gorerain
Locations:
desertnew york citybartrainchurchairplanetaxielevatorapartmentpolice carouter spacecavetaxi drivertrain accident
Characters:
samurai swordaction herowarriortough guydoctoralienactorsecurity guardengineerself healing
Period:
1990sfuturenear future2020s
Story:
one man armysword duelkatana swordsword fightwarlordkendobooby trapbattlefieldevil manfictional waranti herosevered headsnakegood versus evildecapitation …combatshowdownfalling from heightswordbattleblood splatterbloodviolencenumber in titlesequelflashbackkisscigarette smokingphotographexplosionchasesurprise endingpistolfirepunctuation in titleshootoutcorpseshot to deathfistfightmachine gunshot in the chestblondepunched in the facegunfightsecond partrevolverscientistoperaassassinambushterroristdeath of friendmontagemixed martial artssubwayexploding cardisarming someonepolice officer killednews reportbartendertrainingflash forwardtheaterlimousineone against manyprologueelectrocutionfugitivestatuecover uptough girlbodyguardexploding bodyneck breakingmercenarygenerallove interestfreeze framehenchmanflyinghead buttassassination attemptsociopathfaintingsecurity cameraroman numeral in titleexploding buildingplanetfaked deathsocial commentaryback from the deadfemale warriorold ageresistanceresurrectionfalling to deathimmortalitymentordark herosequel to cult favoriteteleportationlaser gunsatellitebeheadingextraterrestrialyellingswordsmanterrorist groupkatanareturning character killed offfemale fighterspiral staircasejournalcomputer crackerworld dominationurban decayfencingexploding truckhead cut offfight the systemexperiment gone wrongcrotch grabreference to shakespeare's hamletimmortaltailorfreedom fighterresistance fightersocial decayevil corporationalien raceregenerationmentor protege relationshipglobescotmegacorporationbanishmentcorporate crimehuman aliencorrupt businessmanopera houseamazing grace hymntroubled productiondehydrationfighting in the airancient astronautnight vision binocularsdiving suitastral projectionboardroomlong swordbeheadedhoverboardinsurrectionsolar flareelevator crashozone layerhighlandershot with a laser gunamazing grace the hymn (See All)

Mortal Kombat: Annihilation (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mortal Kombat: Annihilation (1997)

Mortal Kombat is an ancient tournament where the Earth Realm warriors battle against the forces of Outworld. Liu Kang and a few chosen fighters fought and defeated the powerful sorcerer Shang Tsung, their victory would preserve the peace on Earth for one more generation. Taking place now where the f …irst movie left off, the Earth realm warriors live a short period of peace when evil forces from another dimension come to invade and wreak havoc on Earth. They are guided by the forces of Outworld leader, Shao Kahn and his generals such as: Motaro, Rain, Ermac, Sheeva and Sindel. Now Liu Kang, Raiden, Jax, Sonya and Kitana must defeat Shao Kahn in six days before the Earth realm merges with the Outworld. (Read More)

Subgenre:
cult filmmartial artsindependent filmb movieabsurdismcampy
Themes:
self sacrificebrutalityseductiondeathmurderrevengesurrealismkidnappingbetrayalescapemonsterherodeceptionsupernatural powerredemption …guiltapocalypse (See All)
Mood:
nightmare
Locations:
desertcavelaboratory
Characters:
witchaction herowarriortough guyfather son relationshipmother daughter relationshipbrother brother relationshiphostagenative americanvillain
Period:
1990s
Story:
hand to hand combatevil sorcererfinal battleone man armyancientwarlordsorcerermegalomaniacfight to the deathevil manfemme fatalefictional wararmygood versus evilkung fu …combatshowdownbattlebare chested maleviolencebloodfightsequelexplosionfirebeatingdreamfistfightrescuepunched in the facebrawlbombsecond partrobotfightingsurvivalassassinambushmixed martial artsdouble crosscreaturetransformationtrainingone against manybeaten to deathkarateattackninjadragonrace against timekicked in the facetough girllightningmartial artistexploding bodyneck breakinggeneralqueenstylized violencehenchmanwerewolficedestructionelectronic music scoreheroinecatfightloss of friendtemplekicked in the stomachmind controlcgiend of the worldaction heroinecrushed to deathback from the deadmasked manfemale warriordamsel in distressinvasionbased on video gamechaosresurrectionimmortalitypunched in the chestalternate realitykarate chopstick fightteleportationroundhouse kickkarate kickfemale assassinfighterfinal showdownreturning character killed offruinskung fu masterfemale fightereiffel tower parissuper strengthfireballportalworld dominationemperortwin brotherninjitsushamanshape shifterwoman fights a manimmortalsubterraneangodsorceressone woman armyalternate dimensionglowing eyesjujitsureturning character with different actorbanishmentparallel worldjeet kune doman fights a womanmysticevil twinfemale ninjabrother versus brotherunderground fightingcounciloutrunning explosionevil queencentaurweather manipulationshape shiftingelderfrozen aliveprosthetic armskull maskmortal kombathydraself destruct mechanismevil brotherrobotic arm (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hobbit: The Desolation Of Smaug (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hobbit: The Desolation Of Smaug (2013)

After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h …is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)

Subgenre:
sword and fantasysword and sorcerymartial artscoming of agedark fantasy
Themes:
magicrevengemurderdeathdrunkennessescapemonsterdeceptionredemptionunrequited lovehome invasiongreed
Mood:
rainnightmare
Locations:
townforestsnowsmall townboatvillagewoodscastlecave
Characters:
action herowarriortough guythieffather son relationshipfather daughter relationshipbrother sister relationshipsoldierhostagelove trianglemayorsingle father
Story:
hand to hand combatsword fightstabbed in the mouthcapturewizardkilling an animalbow and arrowspearperson on firekingfictional warsevered headstabbed in the cheststabbed to deaththroat slitting …impalementarmyaxegood versus evildecapitationcombatfalling from heightswordbattleshot in the headblood splattercharacter name in titlebloodviolencefightbased on novelsequelflashbackphotographtitle spoken by characterexplosionpartyknifechasefiredreamshot to deathfistfightshot in the chestrescuewritten by directorarrestbrawlsecond parthallucinationrivershot in the backsubjective camerafoot chaseassassinambushstrangulationmountainbridgemixed martial artsmapfishno opening creditschild in perilunderwater scenecreatureshot in the legtransformationshot in the foreheadcharacter repeating someone else's dialoguestabbed in the backkeyfantasy sequencepoisoncharacter's point of view camera shotdragonrace against timeknocked outtough girlskeletonringshot in the shoulderscarneck breakingtrapwaterfallshot in the armpubsubtitled scenestylized violencesingle parenticegoldfalling down stairsassassination attemptquestbarnjail celltreasureblockbustergiantskullaction heroineanimal attackgoatfemale warriorguarddwarfshieldburglarflooddual wieldstabbed in the throat3 dimensionalstabbed in the neckshot in the faceprophecystabbed in the headstabbed in the legfogdisfigurementknife throwingstabbed in the eyeeye patchlens flarekingdomprequelteleportationpipe smokingtorso cut in halfelftombfemale soldierinvisibilitydirector cameoshot in the neckfemale fightergiant monsterbeeshot with an arrowamputeestabbed in the armwellshot in the eyecrystaldammushroomfriends who live togetherstabbed in the shoulderclimbing a treeshot in the throatdisfigured faceopen endedcorrupt officialshapeshiftingsubterraneanjewelfreedom fighterbarrelclose up of eyeanimal killingforce fieldarmoryleg woundburning buildinghumangiant spiderchopping woodgold coinwheelbarrowhidden doorwine cellargiant creaturelost in the woodsorbdog sledfire breathing dragoncliffhangerspider webhealing powerballadeerstaringcocoonsignalhobbitmoonlightprequel and sequelnecromancersinger offscreenflying dragonminstrellive action remaketapestryflatterywinged dragonwhite mouseapprehensiongold ringstone bridgetalking dragongold statuepoisoned arrowsilver coinbare foot manpile of goldsleepyglowing crystalthrush (See All)

Ben-hur (2016) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ben-Hur (2016)

Subgenre:
christ allegoryepic
Themes:
self sacrificevengeancebrutalityrevengemurderdeathlovemarriagereligionbetrayaljealousypoliticsescapedeceptionanger …redemptionfaithhome invasionexecutionhopeblindnessamnesiaforgivenessnear death experience (See All)
Locations:
seadesertbeachsnowcemeterywatervillageshiprooftopcaveoceancampfiresea battle
Characters:
warriortough guymother son relationshipfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipsoldierhostagereference to godchristianityteacher student relationshipjewchildhood friend
Story:
sword and sandalsword fightvoice over narrationloinclotharcherarenanarrated by charactercrucifixionslaverybow and arrowbattlefieldperson on firestabbed in the chestarmyaxe …combatshowdownswordbattleshot in the headcharacter name in titlebare chested maleviolencebloodbased on novelflashbackdogdancingtitle spoken by characterexplosionpartyknifesurprise endingfirecorpsehorseshot in the chestremakeslow motion scenearrestletterorphanmountainmontageprisonernonlinear timelinefalse accusationno opening creditsdisarming someoneassassinationunderwater sceneracial slurtrainingflash forwardtentlightninglong takecrossgiftreunionthreatened with a knifesevered armwhippingbare chested male bondageclass differencesqueenprincecircusassassination attemptheavy rainfriendship between menhelmetcrucifixbeardrebelrebellioncrying mantorchcompassionsocial commentarydebateslavepresumed deadcelebrationreverse footageshieldresistancewhiphatredmercilessnessdeath threatgreecemiracleoilsibling rivalryrainstormbalconybetwar veterankingdomstadiumsevered legdaggermoral dilemmapalaceman cryingbriberyoppressionfinal showdownspiral staircasemale friendshiphorse racingshot with an arrowamputeejerusalemarcherygovernorraftemperordrumcheering crowdhead injurywagerpalm treestablefight the systemchainedparaplegicbettingancient romecarpenterbowhorse racefreedom fighterresistance fighterbanquetdreadlockstotalitarianismnomadloss of memoryrowingroman empiredinner tableflaming arrowstabbed in the sideromansheikcaught in the rainjesus christlobotomydiscipleseparation from familydeus ex machinasinking shipnaval battle1st centurychariotfirst aidleprosycrucifixion of jesusroman soldierjerusalem israelcannonballzealotoarreference to julius caesarjulius caesarenslavementlepertunicshackledadopted brotherslave girlcenturionremake of remakeriding accidentroman legionchariot racepontius pilatefast forwardleper colonyadrifttrampledcapsizeroman armycarrying someone over shouldercoliseumrebel fighterroman salutewhipping scars (See All)

Pan (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pan (2015)

Subgenre:
sword and fantasychrist allegorymartial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbuckler
Themes:
magicmurderdeathfriendshiprevengesurrealismkidnappingbetrayalfearescapeherodeceptionfaithhopecourage …near death experience (See All)
Locations:
forestboatlondon englandwoodsshipouter spacecavecampfirecable car
Characters:
warriorboymother son relationshipchildrenbabyhostagenative americanamerican abroadmermaidship captaincrying boyboy crying
Period:
world war two1940s1930s
Story:
hand to hand combatwarrior racesword duelsword fightvoice over narrationheroismbooby trapslaveryspearbattlefieldevil manprincessfictional waraxegood versus evil …combatshowdownfalling from heightswordbattleface slapcharacter name in titlefightviolencebased on novelone word titleguntitle spoken by characterexplosionknifechasesurprise endingpistolfirefistfightrescueslow motion scenepunched in the facebrawlletterheld at gunpointbombriversubjective cameraorphanflashlightambushmountainmixed martial artsmapnunno opening creditschild in perilunderwater scenecreaturesearchjourneyon the runtrainingflash forwardattempted murdertreecharacter repeating someone else's dialogueprologuekeyattackfugitivecharacter's point of view camera shotstatueknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifestylized violencehenchmanflirtingropepiratedestinycaptainflyingcowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroineanimal attacksocial commentarybald manslavecannoneaten alivefemale warriorguardvisionexplosivechild's point of viewbraveryfairydual wieldanimated sequencechild protagonist3 dimensionalfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestmusical numbertribeminekingdomcellarflamethrowerprequelclose up of eyesflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Seventh Son (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seventh Son (2014)

John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to  …survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)

Subgenre:
sword and fantasysword and sorcerymartial artscoming of ageblack comedydark fantasy
Themes:
self sacrificedeath of mothermagicghostdeathmurderrevengelovesurrealismkidnappingbetrayalfearescapemonsterdeception …robberysupernatural powerredemptionunrequited lovehopecourage (See All)
Mood:
nightdarkness
Locations:
churchforestsnowvillagewoodsfarmcastlecampfirewalled city
Characters:
witchaction herowarriortough guymother son relationshipmother daughter relationshipsoldiersister sister relationshipalcoholicteacher student relationshipevil witchdeath of student
Story:
hand to hand combatblack magicsword fightbow and arrowspearbattlefieldfemme fatalefictional waranti herostabbed in the cheststabbed to deaththroat slittingimpalementarmyaxe …good versus evilcombatdemonshowdownfalling from heightswordbattlefightviolencebased on noveldogtitle spoken by characterexplosionknifechasesurprise endingfirefistfighthorseurinationrescueslow motion scenebrawlhallucinationassassinambushstrangulationmountainmontagebridgemixed martial artsno opening creditschild in perilunderwater scenecreaturetransformationtrainingskinny dippingstabbed in the backprologueattackpossessiondragonrace against timelightningskeletonfarmerexploding bodypigthreatened with a knifewaterfallbearqueenstylized violencestrong female characterhenchmandestinyburned aliveassassination attemptheavy raincagecatfightvillainesseccentricgiantjumping from heightirishskullknightstrong female leadtorchaction heroinefemale killerbar fighteaten alivefull moonretirementvisiontarget practicebraverycrossbowdual wieldson3 dimensionalstabbed in the headoiltime lapse photographystabbed in the legdark heroaerial shotknife fightwisecrack humorrainstormdeerdisfigurementknife throwingdemonic possessiontragic heroburned to deathexorcismteleportationswordsmanfemale fightergiant monstertwo man armyworld dominationfemale spyhired killertavernassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladejumping into waterstabbed in the faceclawgravestonepitchforkchosen oneapprenticearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonebased on young adult novelcaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airwoman murders a manmaster apprentice relationshipshape shiftingsororicidecauldronaxe throwingman murders a womanbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningopening creditswoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All)

Wonder Woman (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wonder Woman (2017)

Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t …o end all wars, Diana will discover her full powers and her true destiny. (Read More)

Subgenre:
sword and fantasyepicmartial artscoming of agesuperherofish out of watersteampunkdark fantasy
Themes:
self sacrificemythologybrutalitytorturedeathrevengemurderlovesurrealismbetrayaldrinkingfeardrunkennessescapedeception …militaryangercorruptionpsychopathobsessionsupernatural powerparanoiainsanitysadismhopepanicjusticecouragegreek mythology (See All)
Mood:
darknessgreek myth
Locations:
beachtrainchurchforestsnowmotorcycleairplaneparis franceboatlondon englandvillagewoodsshipcastlecave …campfirelaboratorytrain stationairplane chase (See All)
Characters:
action herowarriortough guyfamily relationshipsmother daughter relationshipsingerfemale protagonistsoldierdancerphotographersister sister relationshipnative americansingle motheralcoholicsniper …secretarygermanamerican abroadsniper rifleaunt niece relationshipfemale scientistamerican in the uk (See All)
Period:
2010s1910syear 1918
Story:
hand to hand combatpart of serieswarrior racewarrior womanfinal battlesword fightvoice over narrationarchermegalomaniacheroismfight to the deathbow and arrowspearbattlefieldevil man …princessanti herostabbed in the cheststabbed to deatharmyaxegood versus evilcombatshowdownfalling from heightswordbattleshot in the headcharacter name in titlebare chested maleviolencefightf ratednuditymale nuditysequelflashbacktwo word titlecigarette smokingdancingphotographexplosionsingingpartyknifechasesurprise endingpistolfireshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunhorseshot in the chestshotgunrescueslow motion scenepunched in the facedrinkgunfightbrawlsecretpaintingbased on comicrifleheld at gunpointbeerbombinterrogationpianoislandrevolverfightingscientistshot in the backspybased on comic bookmassacredisguisemontagemixed martial artspoliticianmapnonlinear timelinefalse accusationno opening creditsscantily clad femaledisarming someonedouble crossunderwater scenevanshot in the legtrainingflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguebeaten to deathdangercostumescreamingelectrocutionfantasy sequencefactorypay phonepoisonmissionundercoverrace against timestatueknocked outkicked in the facetough girllightningtankbraceletscardeath of brotherexploding bodylaptopsuspicionworld war onethreatened with a knifewaterfallshot in the armgeneralsecret agentlove interestpubqueennewspaper headlinesubtitled scenestylized violenceeavesdroppingropedestinycaptainhand grenadesabotagefireplacedestructionbulletrevelationassassination attemptwarehousesociopathhelmettold in flashbackmad scientistexploding buildingkicked in the stomachcaucasianvillainessblockbusterwristwatchphone boothpooldesperationjumping from heightculture clashstrong female leadfollowing someonehonorfateaction heroinebar fightcannonfemale warriorgas maskshieldbraveryinvasioncynicismdual wieldanimated sequencehatredimpostormercilessnesschaossuper villainpost traumatic stress disorderimmortalitymentorpunched in the chestdynamitejumping through a windowdeath of sisteraerial shotsuperheroinee mailtitle at the endundercover agentarmordisfigurementgasolinekingdomfemale directorsecret identitydc comicsloss of brothertelekinesissmokegatling gunprequelteleportationpipe smokingbullet timeclose up of eyesfemale soldiertranslatormale objectificationface maskhistorical fictionlevitationalleyanti warfinal showdownnotebookfemale fighterassumed identityeiffel tower parissuper strengthfake identitytoweramerican indianworld dominationcomic reliefsailboatshot with an arrowyoung version of characterarcherycrownidealismamazonno title at beginningsmugglerdepartment storebelgiumcrash landingexploding truckbehind enemy linesgirl powerfemale herobayonetsaving the worldwoman kills a manhumorsuper powergurneyhijackingloss of sisterevil womanflamebomberopen endedsuperhuman strengthwoman fights a manvaultimmortaldistrustgodhuman experimenttalking about sexanecdoteone woman armyflashback within a flashbackottoman empirearmy basebiplanechosen oneexploding airplanehalf brotherforce fieldfake accentbilingualismmad doctorfratricidetrenchrevolving doorearth viewed from spaceoverhead shotepic battlescottish accentparadisehorse drawn carriagesexual innuendopayphonesuit of armorwoman kills mandouble entendrescotsmanwoman punches a mansuper speedgerman armyinvulnerabilityorigin of heroflaming arrowbig ben londonman fights a womansharpshooterwalking stickevil scientistgalachemistdisobeying ordersgas grenadepoison gasstudent teacher relationshipgunpowdersultanbritish intelligencemass deathspear throwingthrown from heightturkwatchtowerantique dealermatriarchybell towergreek godbackfliptrench warfareevil godwartimealley fightbowler hatdeath of auntflamescostumed heroescalationamazon tribeend of waralliteration in titlemoroccanchemical weaponsfeztower bridge londonmachine gun nestaxe throwingdc extended universesuperhuman speedcasualty of warchemical weapontough womanprequel and sequelwestern frontwonder womanarmisticereference to zeuslightning boltamazon warriorhydrogenintelligence officeramazon womanfemale superheromilitary jeepdeath of mentorfemale archergas attackarescyanide pillmustard gasfemale talking about sexgerman spyamazon queenloss of auntmagic swordreturning actress with different character (See All)

Thor (2011) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor (2011)

The warrior Thor (Hemsworth) is cast out of the fantastic realm of Asgard by his father Odin (Hopkins) for his arrogance and sent to Earth to live among humans. Falling in love with scientist Jane Foster (Portman) teaches Thor much-needed lessons, and his new-found strength comes into play as a vill …ain from his homeland sends dark forces toward Earth. (Read More)

Subgenre:
cult filmepicmartial artssuperherodark comedyfish out of waterscience fantasymythological
Themes:
self sacrificemythologysuicidebetrayaldrunkennessescapemonsterherodeceptionsurveillancerivalryforgivenessartificial intelligencespace travelnorse mythology
Locations:
deserthospitalbarsnowsmall towncastlerooftopouter spacegas stationstormnew mexico
Characters:
action herowarriortough guymother son relationshipfather son relationshipfamily relationshipshusband wife relationshipdoctorbrother brother relationshipsoldiernursereference to godprofessorbabe scientistalien superhero
Period:
2010s21st century
Story:
hand to hand combatevil sorcererwarrior raceone man armysword fightvoice over narrationsorcererspearkingfictional waranti heroarmyaxegood versus evilcombat …falling from heightswordbattlecharacter name in titlebare chested maleviolenceone word titleflashbackkisstitle spoken by characterexplosioncell phonefistfightmachine gunhorseslow motion scenepunched in the facearrestbrawlbased on comicinterrogationrobothandcuffsscientistflashlightbased on comic bookmountainbridgedinerprisonerexploding carno opening creditscreaturelibrarybinocularsstabbed in the backelectrocutionproduct placementlightninginjectionfirst partmercenarywaterfallsecret agentqueenprincepickup truckicetraitorfalling down stairsflyinghead buttheavy rainhelmetwalkie talkiehammerexploding buildingkicked in the stomachplanetblockbustergianthonorpresumed deadfemale warriorguardcameothundergash in the facepool tablesuper villainmentorexilescene after end creditsmarvel comicssibling rivalryarmorbody landing on a careye patchlens flarelasersightgovernment agentteleportationarrogancesurprise after end creditspalacenorwayspellfemale soldiergiant robottaserreference to facebooksuper strengthgiant monstervikingyoung version of charactertrailer homesuper powersno title at beginninghit by a truckadopted sonblizzardpatricidegoddesscapecamcorderopen endedalien planetimmortalshapeshiftingin medias rescasketthronebudweiserstrong mandutch anglebanishmentoathwormholehuman alienorigin of herovisabrother versus brothergiant creatureobservatoryanti villainpet shopalternate worldmarvel cinematic universefreeze to deathcraterexploding gasoline stationstepbrotherabysssentryhumilitybackhand slapfrozen alivescepterson kills father10th centurymale aliennorse godbrother against brotherextraterrestrial humannorseextraterrestrial manpop tartgate keepers.h.i.e.l.d.dr pepperheir to thronebrother betrays brotherinterstellar travelone eyed characterreference to xena warrior princesshammer as weaponmastercardextraterrestrial womanhawkeye the characterrivalry over throne (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Gladiator (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gladiator (2000)

Maximus is a powerful Roman general, loved by the people and the aging Emperor, Marcus Aurelius. Before his death, the Emperor chooses Maximus to be his heir over his own son, Commodus, and a power struggle leaves Maximus and his family condemned to death. The powerful general is unable to save his  …family, and his loss of will allows him to get captured and put into the Gladiator games until he dies. The only desire that fuels him now is the chance to rise to the top so that he will be able to look into the eyes of the man who will feel his revenge. (Read More)

Subgenre:
cult filmepicmartial artsstop motion
Themes:
self sacrificevengeancebrutalitymurderrevengedeathsurrealismrapebetrayaljealousypoliticsescapeincestcorruptionredemption …gamblingmental illnesscrueltydeath of wifedyingfreedomjusticecheatingcourageafterlifemurder of familymurder of son (See All)
Mood:
goresurreal scene
Locations:
desertforestitalygermanyspain
Characters:
warriorfather son relationshipmother son relationshipfamily relationshipshusband wife relationshipfather daughter relationshiptattoobrother sister relationshipsoldiersingle motherdaughteruncle nephew relationshipdeath of hero
Story:
severed handsword and sandalsword fightfamous scoregladiatorarcherbarbarianarenacrucifixioncamelfight to the deathmutilationslaverybow and arrowspear …battlefieldevil manperson on firesevered headsnakestabbed in the cheststabbed to deathimpalementarmydecapitationcombatswordbattleface slapblood splatterbare chested malefightbloodviolenceone word titledogkisstitle spoken by charactersingingfirehorseshot in the chestarresthallucinationprayerriversurvivalstabbingwidowprisonermapno opening creditschilddream sequencejourneyshot in the legtrainingstabbed in the backfantasy sequencepoisonrace against timestatuetentringfarmerhangingcourtspeechwigdeath of sonloss of fathertied upcharacter says i love yougeneraldismembermenttrusthatepowerchild murderafricanapplausegoldentertainmentgameloyaltydestructionburned aliveflyingwoundcageinjuryfamehelmetsurvivorrome italyelephantcaptivehunterenemyloss of wifeblockbusterparadehomehonorcrying mantorchanimal attackambitionslaveshieldvisioncrossbowloss of sonstabbed in the throatwhippet dogsonpeacebutchertime lapse photographysenatorstabbed in the legdeath of protagonistlionsundungeonslaughterarmortigerstadiumtragic heroarrowbloodbathholding handscrowdmain character diesimprisonmenttorso cut in halfcontractsuffocationflagwifebandageskirtstreet marketsexual tensionplaguearcherycrownstabbed in the armemperormedalcheering crowdhugwetting pantscampaignpatricidepopularitytyrantaltered version of studio logocapedocumentempirefailuremurder of wifecrotch grabscarfbladefur coatcaravanancient romebloodshedbowdeath of title charactercaresshorse and wagoninfantryvictoryretributionphilosopherslapincestuous desiregiraffestrengthveilcarriagechantingdepravityrewardmacefurdeserterscrollleadershipbattle axecobraroman empiresliced in twospaniardstabbed in the footwisdomdevotionflaming arrowsenatemessengernephewdebaucherystabbed in the sideromanprocessionromabody armorcatapulthomesicknessnorth africagodstriumphbustbannerstar died before releasefamous songpracticesaluteantiquityslave tradeconquestchariotlancewatching someone sleeplegioncolosseumencampmentserviceroman soldiertridentanimal bitegrapessavagerywheat fieldrepubliclast man standingreference to julius caesarfighting moviesobbinggloryplacardregicidewooden swordscene based on paintingrememberingdeath of cast memberspectaclevalorhailheadless horsemanimageryburnt corpseriding accidentfrostnativesrobinroman legionsuccessorfamily betrayalgerman languagepikesalt minecaesarforced perspectivevindicationflying debriscropsidearefusalsanitationtent city2nd centuryapplescruel fatherenvoymortal woundgladiatorial combatjasminereference to hannibalroman senatethumbs upbotched executionfamous speechinsigniaoverkillroman centurionchainmailcommanddream imageryformer slavegladiatorial sportlying in statetiredcall to armscoliseumlaurel wreathroman salutetemperanceancestorsartistic imagerydigitizationskip motionthumbs down (See All)

The Crow (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Crow (1994)

A poetic guitarist Eric Draven is brought back to life by a crow a year after he and his fiancee are murdered. The crow guides him through the land of the living, and leads him to his killers: knife thrower Tin-tin, drugetic Funboy, car buff T-Bird, and the unsophisticated Skank. One by one, Eric gi …ves these thugs a taste of their own medicine. However their leader Top-Dollar, a world-class crime lord who will dispatch his enemies with a Japanese sword and joke about it later, will soon learn the legend of the crow and the secret to the vigilante's invincibility. (Read More)

Subgenre:
cult filmmartial artsblack comedyallegorydark fantasy
Themes:
brutalityrevengemurderdeathrapedrunkennessheroincestpsychopathsupernatural powerjusticeafterlife
Mood:
poetic justicegorerainneo noir
Locations:
churchcemeterybathtuburban settingrooftopinner cityrooftop fighthelicopter chase
Characters:
action herowarriorpolicemother daughter relationshipwaitressfiance fiancee relationshipmysterious villain
Story:
hand to hand combatone man armysword duelkatana swordsword fightvoice over narrationmegalomaniackendoperson on fireanti herostabbed in the cheststabbed to deaththroat slittingimpalementgood versus evil …kung fucombatshowdownfalling from heightswordshot in the headblood splattercharacter name in titlefemale nudityviolencefightbloodflashbackgunfemale rear nuditytitle spoken by charactershowerfireshootoutcorpseshot to deathshot in the chestslow motion scenecatgunfightshootingbombrock musicreference to jesus christguitarshot in the backsubjective camerahalloweenbased on comic bookconcertmontagemixed martial artstied to a chairexploding carchild in perilgraveyardmarriage proposalgunshotduelone against manycharacter repeating someone else's dialoguecharacter's point of view camera shotfirst partdirectorial debutshot in the armvigilanteundeadarsonfreeze framecrime bossoccultfalling down stairssyringebulletgothicloss of loved onedrug abusesergeantexploding buildingvillainessskateboardgun fubreakfastback from the deadgun battledrug overdosenostalgiadual wieldstabbed in the throatironyjunkiedark herothrown through a windowgang rapedead maneye gougingslaughterbody landing on a carknife throwingtragic herolasersightmain character diesengagement ringjewelrystabbed in the handdetroit michiganfencestabbed in the armhot dogbullet balletbased on graphic novelnihilismgun duelguitar playerraveshot in the handpawnshoptragic loverighteous ragedeath of title characterfart jokerock musicianblack copfade to blackrebirthoverhead shotstairwellexit woundlong haired malefalling off a roofjeet kune doorigin of herogrungehot dog standgun katadrinking gamegun saustar died before releasecold casefalling off a balconyabandoned churchlead actor's last filmindustrial musiccalling parent by first nameknife in handdeath of cast membercrowd surfingurban gothicnocturnaldark angelreference to amelia earhartsmashing guitarhole in handmusician in castflashback montagerain fightslow motion shootoutcharred bodyeyes pecked outdevil's nighteve of weddingmurder of fiance (See All)

The Lord Of The Rings: The Fellowship Of The Ring (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lord Of The Rings: The Fellowship Of The Ring (2001)

An ancient Ring thought lost for centuries has been found, and through a strange twist in fate has been given to a small Hobbit named Frodo. When Gandalf discovers the Ring is in fact the One Ring of the Dark Lord Sauron, Frodo must make an epic quest to the Cracks of Doom in order to destroy it! Ho …wever he does not go alone. He is joined by Gandalf, Legolas the elf, Gimli the Dwarf, Aragorn, Boromir and his three Hobbit friends Merry, Pippin and Samwise. Through mountains, snow, darkness, forests, rivers and plains, facing evil and danger at every corner the Fellowship of the Ring must go. Their quest to destroy the One Ring is the only hope for the end of the Dark Lords reign! (Read More)

Subgenre:
sword and fantasysword and sorceryepicdark fantasy
Themes:
self sacrificetorturefriendshipbetrayalmonsterredemptionabductioncourage
Locations:
forestvillagecastlecampfireroad moviesea monstercave in
Characters:
warriorboyfriend girlfriend relationshipcousin cousin relationshipdeath of hero
Story:
hand to hand combatevil sorcererbroken swordsword fightancientprehistoric timesarchersorcererheroismwizardbow and arrowspearbattlefieldfictional warstabbed in the chest …impalementgood versus evildecapitationcombatdemonshowdownfalling from heightswordbattleviolencedancingpartymirrorbirthdayrivermountaindeath of friendbridgedisarming someonebirthday partycreatureshot in the foreheadstatueskeletonringspeechgiftunderwaterwaterfallsevered armfireworkseavesdroppingtraitorfireplaceloyaltyquestmutantmale bondingmind controlforbidden lovehonortorchcompassioncrushed to deathpromisedwarfvisionsevered fingerbraverywhipimmortalityrowboatstabbed in the legdark herovolcanohealingrainstormarmortelekinesisteleportationuncletelepathyelftombinvisibilityruinstowergiant monsterstaircasetemptationgardenerarcherystabbed in the armwellfortresscornfieldreluctant heropremonitionblizzardtentacletyrantpipetrolleaglesaving the worldfriends who live togethergoblinstabbed in the shoulderinnpasswordrescue from drowningavalancheriddlearchivesecret passagestaffdoomenvelopelast standleaving homedecoyaxe fightbattle axehornpendantferry boatprehistorycamaraderiehidden doorcollisiongiant creaturemothchorustobaccoabandoned minecouncilechocurly hairmotion captureorcmagical ringevil wizardinvented languageabysswraithhobbitmiddle earthunderground cityenchantmentgiant birdflaming swordchain reactionhorseback chaseevil creatureflash floodsmoke ringfictional languagelord of the ringsfictional worldswarm tacticdistant relativebarrow wightknife in thighsubterranean city (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Eagle (2011) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Eagle (2011)

In 140 AD, twenty years after the unexplained disappearance of the entire Ninth Legion in the mountains of Scotland, young centurion Marcus Aquila (Tatum) arrives from Rome to solve the mystery and restore the reputation of his father, the commander of the Ninth. Accompanied only by his British slav …e Esca (Bell), Marcus sets out across Hadrian's Wall into the uncharted highlands of Caledonia - to confront its savage tribes, make peace with his father's memory, and retrieve the lost legion's golden emblem, the Eagle of the Ninth. (Read More)

Subgenre:
independent film
Themes:
death of fatherbrutalityfuneralrevengebetrayalescaperedemption
Locations:
forestvillagewoodscavecampfire
Characters:
warriorfather son relationshipsoldieruncle nephew relationshipyounger version of character
Story:
hand to hand combatfuneral pyresword fightgladiatorarenafight to the deathslaverykilling an animalbow and arrowspearbattlefieldperson on firesevered headstabbed in the cheststabbed to death …throat slittingimpalementarmyaxedecapitationcombatshowdownswordbattlebare chested malefightbloodbased on noveldogtwo word titletitle spoken by charactersurprise endinghorseslow motion scenepunched in the facevomitinganimal in titleriversubjective cameraorphanambushmassacreno opening creditschild in perilritualnecklacedrowningcharacter repeating someone else's dialoguebased on tv seriesbeaten to deathstabbed in the backattackcharacter's point of view camera shotrace against timeknocked outkicked in the facedeath of childringscarhorse ridingloss of fatherratthreatened with a knifewaterfallcowdismembermentsubtitled scenechild murdersurgeryburned alivehead buttheavy raininjuryhelmetkicked in the stomachculture clashhonortorchgoatslaveguardshieldhaunted by the pastface paintdual wieldscotlandtribeknife throwingdead boyethnic slursurgeondaggerbeheadinghistorical fictionwallhuntfilm starts with textbloody body of childrole reversalancient romebird in titlestabbed in the facedeath of familyspitting bloodsole survivorguideanimal killingarmorybilingualismforthatchetleg woundbody paintboarcowardicehorse drawn carriagechild killeddesertercut armroman empirebody armorspear throwingoutpostchariotboy killedlegionscottish highlandstuniccenturionslitting the throat of a childeating raw meatmaster slave relationshiptribesmanknife in the backskeletal remains2nd centuryeating a rathonorable dischargeroman senatorcut leghadrian's wall (See All)

Thor: Ragnarok (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor: Ragnarok (2017)

Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.

Subgenre:
epicmartial artssuperheroabsurdismslapstick comedydark fantasyscience fantasylive action and animation
Themes:
self sacrificebrutalitymurderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessescapemonsterdeceptionsupernatural powerredemption …celebritysadismalcoholismpanicapocalypsedisabilitycouragerevolutionspace travelprison escapenorse mythology (See All)
Locations:
new york citybarchurchforestelevatorvillagewoodsouter space
Characters:
action herowarriortough guyfather son relationshiptattoobrother brother relationshipbrother sister relationshipzombiesoldieralienhostagealcoholicvillaincousin cousin relationshipfather …alien monster (See All)
Story:
hand to hand combatwarrior racewarrior womanone man armyfinal battlesword fightfight to the deathcapturebow and arrowspearwolfbattlefieldfemme fatalefictional warsevered head …stabbed in the cheststabbed to deathimpalementarmyaxename in titlegood versus evildecapitationcombatdemonshowdownfalling from heightswordbattlecharacter name in titlebare chested maleviolencefightsequelflashbacktwo word titletitle spoken by characterexplosionknifechasesurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facegunfightbrawlbookbased on comicheld at gunpointbeerriverfightingsurvivalfoot chasebased on comic bookambushmassacremountainbasketballbridgemixed martial artsprisonerweapontied to a chairdisarming someonedouble crossspaceshipunderwater scenecreaturethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningopening action sceneskeletonbraceletscene during end creditsmanipulationspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadprincestylized violencestrong female characterhenchmanapplausedestinydestructionflyingracehead buttelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplanetblockbustereccentriccamprebeljumping from heightclubskullrebellionknightlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footageshieldcameohaunted by the pastvisionbootsbraverydual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fightwisecrack humorhologrambounty huntereye gougingarmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemcrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerexploding planetwoman murders a manred capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All)

Priest (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Priest (2011)

PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)

Subgenre:
christ allegorymartial artspost apocalypsedystopiacyberpunk
Themes:
self sacrificedeath of motherdeath of fatherfuneraltorturerevengedeathmurderkidnappingreligionbetrayalmonsterherodeceptionredemption …home invasionjusticeghost town (See All)
Mood:
poetic justicegorenightmarenightdarkness
Locations:
towndesertbartrainchurchmotorcyclecemeterysmall townelevatorcitycavebar brawlmotorcycle chasetrain explosionwalled city
Characters:
action herowarriortough guyhusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshippriesthostagechristianvampirevillainbible …sheriffuncle niece relationshipex soldierhuman versus monsterfacial tattoo (See All)
Period:
future
Story:
hand to hand combatone man armyvoice over narrationmegalomaniaccrucifixionkilling an animalperson on firefictional waranti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementgood versus evil …decapitationkung fucombatshowdownfalling from heightbattleblood splattercharacter name in titlebare chested malebloodviolencefightbased on novelone word titleflashbackguncigarette smokingphotographtitle spoken by characterexplosionknifechasesurprise endingfireshootoutbeatingcorpsefistfightmachine gunshot in the chestshotgunrescuepunched in the facebrawlbased on comicheld at gunpointinterrogationsurvivalflashlightbased on comic bookambushmassacremountainweaponno opening creditscoffincreaturetransformationon the runconfessionone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuespiritualityelectrocutionattackbased on mangamissionrace against timedollstatuekicked in the facetough girllightningfarmerscardeath of brothercrossexploding bodyneck breakingthreatened with a knifecabinmercenarychickensevered armvigilantestylized violencestrong female characterbulletrevelationhead buttheavy rainmachetemutantcowboy hatjail cellcrucifixkicked in the stomachnosebleedasian womanjumping from heightcovered in bloodskullhonoraction heroineanimal attackcrushed to deathsocial commentarybar fighteaten alivepresumed deadfemale warriorfull moonguarddamsel in distresstarget practiceveteransandcrossbowteamanimated sequence3 dimensionalgash in the facestabbed in the leg3dpunched in the chestdark herodynamitejumping through a windowdisembowelmentblood on shirtfascismboyfriendknife throwingdark pastlanternmutationgadgetsevered legcellardaggertorso cut in halftracking devicefemale soldierprayingruinsvigilantismparkourworld dominationconfessionalshot with an arrowflask18 year oldflarequitting a jobgramophonepocket watchvigilante justicebased on graphic novelbitten in the neckmeat cleaveracrobatstabbed in the shoulderfight the systembladerepeated linesuperhuman strengthtragic pastsubterraneancut into piecestrapdoornight timemass gravevampire hunterone woman armypsychotronic filmanti heroinegogglesman with no nameacrobaticssome scenes animatedvampire slayerstarts with narrationhit by a trainwire fubritish actor playing american characterpassenger traintrain conductorcoming out of retirementmotorcycle stuntnieceoil lampexploding motorcyclecouncilinsubordinationoutpostalternate worldtrain wreckclergytrackinggeiger countertotalitarianknife in chestsuperhuman speedtrain derailmentexploding trainhit by a motorcyclefight on train roofhuntressmonolithsolar panelblack hathiveriding motorcyclehuman versus vampireopening credits18 year old girldisobeyfall through floorvampire queengiant statuelong haired womanwoman with long hairfemale vampire hunter (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hellboy II: The Golden Army (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hellboy II: The Golden Army (2008)

In this continuation to the adventure of the demon superhero, an evil elf breaks an ancient pact between humans and creatures, as he declares war against humanity. He is on a mission to release The Golden Army, a deadly group of fighting machines that can destroy the human race. As Hell on Earth is  …ready to erupt, Hellboy and his crew set out to defeat the evil prince before The Golden Army can destroy humanity's existence. (Read More)

Subgenre:
martial artssuperheroparanormal phenomenasteampunkparanormal investigation
Themes:
self sacrificesuicidedeathchristmaspregnancydrunkennessherowrestlingabductionapocalypsefalling in lovenear death experience
Locations:
new york city
Characters:
action herofather son relationshipfather daughter relationshipbrother sister relationshipbabygerman
Period:
1950s
Story:
hand to hand combatone man armysword fightancientstabbed in the mouthspearperson on firefictional waranti herosevered headstabbed in the chestimpalementarmygood versus evildecapitation …demonshowdownfalling from heightbattleface slapcharacter name in titleviolencebloodfightsequelflashbacktitle spoken by charactersingingsurprise endingpistolshowershootoutfistfightshot in the chestgunfightbrawlbookbased on comicsecond partbased on comic bookmixed martial artsmapno opening creditschild in perilcreaturecigar smokingone against manystabbed in the backprologueskeletonsplit screenfilm within a filmthreatened with a knifesevered armtwinprincemutantroman numeral in titlenosebleedrebellioncrushed to deatheaten alivehit in the crotchgash in the facesuper villainstabbed in the headexilechristmas evethrown through a windowsoulbody landing on a carexploding helicopterauctionelfblood on camera lensoutcastremorsecrownquitting a jobpatricidesuperhero teamtrollgoblinhead cut offshot through the mouthblacksmithnorthern irelandgoggleshead ripped offregenerationunwed pregnancyresignationarm ripped offmultiple time framestumorcut armstabbed in the footfederal bureau of investigationturned to stoneson murders fatherpyrokinesisreference to the wizard of ozthrown through a glass doorangel of deathdark horse comicsteeth knocked outtooth fairytruceinterspecies romancenazi experimentsecret government organisationindestructibilityoccult detectiveowning many catswebbed fingersaquatic humanoidbreathing apparatushumanoid demon (See All)

Hansel & Gretel: Witch Hunters (2013) is one of the best movies like Conan The Barbarian (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hansel & Gretel: Witch Hunters (2013)

The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)

Subgenre:
sword and sorcerymartial artsblack comedysupernaturalfairy talesteampunkdark fantasy
Themes:
death of motherdeath of fathermagicdeathmurdersurrealismkidnappingbetrayalescapesupernatural powerabductionfalling in lovemissing child
Mood:
gore
Locations:
desertforestsmall townvillagewoodscity
Characters:
witchaction herotough guypolicebrother sister relationshiphostagevillainsnipersheriffmayorsniper rifleself inflicted gunshot woundevil witch
Story:
hand to hand combatblack magicsword fightvoice over narrationdeath of loved onefight to the deathwitchcraftbow and arrowbattlefieldperson on fireanti herosevered headstabbed in the cheststabbed to deathimpalement …axegood versus evildecapitationcombatshowdownfalling from heightswordbattleshot in the headblood splattercharacter name in titlebare chested malefemale nuditybloodfightviolencenudityflashbackgunfemale rear nudityphotographexplosionknifechasepistolfirepunctuation in titlebeatingshot to deathfistfightmachine gunshot in the chestshotgunrescuepunched in the facewritten by directorbrawlrifleheld at gunpointinterrogationshot in the backf wordcleavageorphanassassinambushmassacrestabbingcolon in titlechild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backmissionrace against timeknocked outtough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentstylized violenceampersand in titleburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfirefamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All)

Seven Samurai (1954)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seven Samurai (1954)

A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w …hen 40 bandits attack the village. (Read More)

Subgenre:
cult filmepicmartial artscult classic
Themes:
samuraisuicidedeathfriendshiprevengelovefeardrunkennessherodeceptionangergriefhopedeath of wifepanic …falling in lovecouragestarvation (See All)
Mood:
rain
Locations:
townforestvillagejapanfarmcampfire
Characters:
samurai swordaction herowarriortough guythiefhusband wife relationshipfather daughter relationshipchildrenhostageold friendcrying babysamurai warrior
Period:
16th century
Story:
hand to hand combatkatana swordsword fightstandoffkendobow and arrowspearbattlefieldpremarital sexcombatshowdownswordbattlebare chested maleviolence …number in titlemale rear nuditygunkisssingingchasefireshot to deathhorseslow motion scenesecretrifleriverorphanold manprisonermapdisarming someonefishingchild in perilold womantrainingduelfarmerhorse ridingtied upmercenarywaterfallflowerlove interestclass differencesarsonhappinessmale bondingcrying womanforbidden lovefollowing someonehonorcrying manburialmoralitycelebrationsufferingmisunderstandinghungerdespairensemble castyoung lovearmorsiegeblind mantragic herostick fightmoral dilemmacrowdmudtombbanditswordsmanpeasantkatanastrategyassumed identityfencingoffscreen killingilliteracyhumormusketvictorybo staffhouse on firevillagerhillman with no namehostage situationstraight razorshot with a bow and arrowharvestlootingflintlock rifleweepingchopping woodricekneelingmoral ambiguitybarricadebarefoot womansicklejidai gekilong black hairstabbed with a swordmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshiproninsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoritestabbed with a spearweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Conan The Barbarian?
<< FIND THEM HERE! >>