Please wait - finding best movies...
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the …mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
Subgenre: | zombie outbreakzombie apocalypsecreature featuresurvival horrorpost apocalypseitalian horrorindependent horroramerican horrordystopiaabsurdismb moviedark comedyblack comedycult filmindependent film |
Themes: | police brutalitynear death experiencemurder of a police officerhuntingcannibalismapocalypsepanicexploitationexecutionsadismparanoiabrutalityrobberymilitarymonster …escapefearpregnancymoneykidnappingsuicidedeathmurderrevenge (See All) |
Mood: | murder of a boypoetic justicesatiregore |
Locations: | fire truckpennsylvaniarooftoptruckfarmapartmentelevatorboatairplanemotorcyclehelicoptercarrestaurant |
Characters: | hunting partypolice shootoutmurder of a girlpolice doghispanic americansexistsniperprofessorvillainsecurity guardwarriortough guyhostagepriestpoliceman …police officersoldierzombiedoctorboyfriend girlfriend relationshipafrican americanpolice (See All) |
Period: | 1970s |
Story: | outlaw gangbiker gangmotorcycle with a sidecarhelicopter pilotzombie attackmotorcycle ganghorror movie remadepie fightabandoned shopping mallracist coplong haired bikerbiker womenbiker babebiker chickphiladelphia pennsylvania …deadly diseaseshopping mallgrindhouse filmhit with a hammergas grenademass paniccar set on fireshort wave radioamateur radioevil nunham radiohand grenaderadio newshit by a truckgang that lives togethergang leadergang violencetelevision stationelevator shaftmilitary jacketmilitary jeepbattle cryfirearm pointed at the camerashot at the camerafemale warriorblood on camera lenssawed off shotgunhelicopter landing padsecurity camerabald zombiezombie childzombie violenceflesh eating zombiecharacter's point of view camera shotstealing a carescape attemptsubjective camerastolen moneyhit by a carexploding carperson on fireknife throwingthreatened with a knifecontemplating suicidethompson gundouble child murdergun shopdumb policebitten in the leggory violenceshooting a childbitten in the armemergency broadcast systemgun storenewsboy capmass deathgearing updereliction of dutyknit capmorning starabsurd violencecontemporary settingpolice vigilantismracket ballmuzakscally capright hand manlooterend of civilizationbikersstabbed in the earpropanegroaningsidecarmorning sicknessleg ripped offcomplaininghell on earthhordeclaustrophobicbaseball glovegrowlingderringerhare krishnatennis ballair ventnewsroomtennis racketdrive in classicnational guardloss of boyfriendsombrerotire ironmidnight moviezombificationentrailshousing projectanthropophagusgolf ballflesh eatingsecret passagewaycircular sawphoto boothtommy gunharley davidsonsurprise during end creditsremadescalpingmartial lawvideo arcadeblockadedinner datebloody violencehangarblowtorchdecomposing bodyjamaicanheadbandbloody body of a childdocksbarricadearm ripped offrookie copwheelbarrowbitten in the throatgraphic violencereanimationhardware storejewelry storenewscasterextreme violencedoomsdaydeath of boyfriendice rinkmacetechno musicwrenchkicking in a doorbandanasocial decaylootingvinylshot through a doorfamous lineshopping cartoutbreakberetvending machinedreadlockscalendarpuerto ricanhedonismdirector also cinematographersledgehammerwalking deadrepeated linecrowbarfriends who live togetherairfieldmeteorbitten in the neckperfumeoffscreen killingmoustacheconsumerismn wordmercy killingcheesepieshot in the eyedepartment storeclimbing through a windowhillbillyfalling into wateranarchystabbed in the armflarebroken windowflaskquick drawmallgolf clubplaguespiral staircasehead blown offhiding in a closetdeath of loved oneepidemicburned to deathvomitliving deadmexican americanbad guycandysidekickhit with a baseball batpolice raidhysterialeather jacketintestinesdead girlmedia coveragebanditblood on shirtmoral dilemmafirefightermannequinethnic slursevered legdead boybody counteye patchmutationtough copgasolinesiegedisfigurementaerial shotslaughterracistpunched in the chestice skatingexploding headstabbed in the leginfectionghettocigarette lighteroutlawdisembowelmentstabbed in the headstabbed in the neckshot in the facem 16psychotronicbutcheritalian americanpower outagedual wieldchaosmercilessnesscannibalgun fuu.s. armytarget practicecrossbowcovered in bloodinterracial friendshipeaten alivegas masksocial commentaryredneckthugcannonend of the worldbikerburialsevered handgrindhouseswat teamkicked in the stomachmass murderloss of loved onewalkie talkiehammerscene during opening creditsbeardhuntercowboy hatlooking at oneself in a mirrorvirusdiseaseelectronic music scorehelmetsociopathmachetehead buttburned alivebow and arrowstylized violencecard gamechild murdergrenadesupermarketdisastereyeglassesriothenchmanundeadcult directordismembermentshot in the armsevered armhandgundie hard scenarioopening action scenebasementdeath of childscene during end creditsscarkicked in the facebaseball battough girlbankknocked outmoaningattackcharacter repeating someone else's dialoguestabbed in the backsuburbprotestscreamingdangerbinocularspilotone against manypolice officer killedshot in the foreheadracial slurtrainingshot in the legcigar smokingnews reportvancreaturecontroversyradiosevered headnunstabbed in the cheststabbed to deathtoiletdeath of friendfootballdrug dealerbridgemontagewomanbasketballambulancemassacreaxeambushganggood versus evilsurvivaldecapitationshot in the backkung fuscientistcombattelevisionrevolverlow budget filmbedsecond partsunglassesheld at gunpointriflevomitingfalling from heightgunfightswordbattlewritten by directorcamerawatching tvpunched in the facerescueshot in the headshotgunshot in the chestmachine gunfoodblood splattershot to deatharcade gamecorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested maleviolencebloodsequelgundog (See All) |
Zombies rule the world, except for a small group of scientists and military personnel who reside in an underground bunker in Florida. The scientists are using the undead in gruesome experiments; much to the chagrin of the military. Finally the military finds that their men have been used in the scie …ntists' experiments, and banish the scientists to the caves that house the Living Dead. Unfortunately, the zombies from above ground have made their way into the bunker. (Read More)
Subgenre: | zombie outbreakzombie apocalypsecreature featuresurvival horrorpost apocalypseamerican horrordystopiab movieblack comedycult filmindependent film |
Themes: | cannibalismapocalypseexploitationsadismparanoiabrutalitymilitaryescapefearsuiciderevengedeathmurder |
Mood: | satiregore |
Locations: | elevatorboathelicopter |
Characters: | hispanic americansexistsoldierzombieboyfriend girlfriend relationshipafrican american |
Story: | helicopter pilotzombie attackhorror movie remadedeadly diseasegrindhouse filmamateur radioham radiomilitary jacketfemale warriorbald zombiezombie childzombie violenceflesh eating zombienewsboy capdereliction of duty …scally capright hand mangroaninghell on earthdrive in classiczombificationanthropophagusbloody violencejamaicanbitten in the throatextreme violencedoomsdaydeath of boyfriendtechno musicbandanafamous lineoutbreakcalendarrepeated linefriends who live togetherbitten in the neckmoustachemercy killingflaskliving deadintestinesblood on shirtethnic slursevered leggasolinesiegeaerial shotracistcigarette lighterdisembowelmentpsychotronicm 16italian americancannibalu.s. armycovered in bloodeaten alivesocial commentaryend of the worldburialgrindhousescene during opening creditsbeardviruselectronic music scoresociopathundeadcult directordismembermentshot in the armsevered armtough girlbankmoaningattackscreamingpilotone against manyshot in the foreheadracial slurtrainingshot in the legcigar smokingradiosevered headdeath of friendwomanmassacresurvivaldecapitationshot in the backscientistrevolverlow budget filmsunglassesheld at gunpointrescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpsepistolsurprise endingchasecigarette smokingsequelbloodviolence (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou …nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Subgenre: | zombie outbreakzombie apocalypsecreature featuresurvival horrorindependent horroramerican horrorcult filmindependent film |
Themes: | police brutalitynear death experiencecannibalismapocalypsepanicparanoiabrutalitymilitaryescapefearrevengedeathmurder |
Mood: | gore |
Locations: | pennsylvaniatruckfarmhelicoptercar |
Characters: | police dogprofessorzombiedoctorboyfriend girlfriend relationshipafrican americanpolice |
Story: | zombie attackhorror movie remadedeadly diseasegrindhouse filmmass paniccar set on fireradio newszombie childflesh eating zombieescape attemptexploding carperson on fireemergency broadcast systemmass deathcontemporary setting …hell on earthhordedrive in classicnational guardtire ironmidnight moviezombificationentrailsanthropophagussurprise during end creditsremadebarricadenewscasterdoomsdaywrenchsocial decayfamous lineoutbreakdirector also cinematographerwalking deadfriends who live togethermeteoroffscreen killinghillbillybroken windowplagueburned to deathliving deadintestinesmedia coveragemoral dilemmamutationgasolinesiegeinfectionpsychotronicpower outagechaoscannibalmercilessnesseaten alivesocial commentaryend of the worldsevered handgrindhouseloss of loved onehammerdiseaseviruselectronic music scoreburned alivedisasterundeadcult directorsevered armhandgundie hard scenariobasementscene during end creditsknocked outattackscreamingdangershot in the foreheadnews reportcreaturecontroversyradiostabbed in the cheststabbed to deathbridgewomanmassacreaxesurvivalshot in the backscientisttelevisionrevolverlow budget filmheld at gunpointriflewatching tvpunched in the facerescueshot in the headshotgunshot in the chestfoodblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosioncigarette smokinggundogviolenceblood (See All) |
Ana goes home to her peaceful suburban residence, but she is unpleasantly surprised the morning that follows when her husband is brutally attacked by her zombified neighbor. In the chaos of her once picturesque neighborhood, Ana flees and stumbles upon a police officer named Kenneth, along with more … survivors who decide that their best chances of survival would be found in the deserted Crossroads Shopping Mall. When supplies begin running low and other trapped survivors need help, the group comes to the realization that they cannot stay put forever at the Shopping Mall, and devise a plan to escape. (Read More)
Subgenre: | zombie outbreakzombie apocalypsesurvival horrorpost apocalypseamerican horrordark comedyblack comedycult film |
Themes: | cannibalismapocalypsesadismbrutalityescapefearpregnancysuicidemurderdeath |
Mood: | gore |
Locations: | elevatorboathelicopter |
Characters: | snipersecurity guardpolicemanpolice officerzombiepolice |
Story: | zombie attackdeadly diseaseshopping mallblood on camera lenszombie childzombie violenceflesh eating zombiecharacter's point of view camera shotsubjective camerahit by a carexploding carperson on firegory violencegun storeend of civilization …hell on earthzombificationanthropophagusflesh eatingbitten in the throatgraphic violenceextreme violencedoomsdayoutbreakwalking deadcrowbarfriends who live togetherconsumerismshot in the eyehillbillyanarchymallhead blown offliving deadsiegeexploding headinfectionstabbed in the headchaosgun fueaten aliveend of the worldmass murderloss of loved onevirusshot in the armhandgundie hard scenariosuburbbinocularsshot in the foreheadshot in the legsevered headmontagewomanambulanceaxesurvivalrevolvergunfightshot in the headshotgunblood splattershot to deathcorpsepistolsurprise endingexplosionbare chested malegunviolenceblooddog (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | zombie apocalypsesurvival horrorpost apocalypsedystopia |
Themes: | apocalypsepanicparanoiabrutalitymonsterescapefearkidnappingmurderdeathrevenge |
Mood: | gore |
Locations: | rooftopmotorcycle |
Characters: | professorsecurity guardhostagesoldierzombiedoctorboyfriend girlfriend relationship |
Story: | hand grenadefemale warriorsawed off shotgunsecurity cameracharacter's point of view camera shotstealing a carsubjective cameraexploding carperson on fireknife throwingthreatened with a knifehordebarricadeoutbreakbitten in the neck …stabbed in the armflareburned to deathliving deadsevered leggasolineaerial shotpunched in the cheststabbed in the leginfectioncigarette lightershot in the facepower outagedual wieldchaosmercilessnessgun fueaten alivesocial commentaryend of the worldsevered handkicked in the stomachwalkie talkiediseaseviruselectronic music scoresociopathmacheteburned alivehead buttstylized violencehenchmanundeadshot in the armsevered armopening action scenescarkicked in the facetough girlknocked outstabbed in the backdangerbinocularsone against manyshot in the foreheadshot in the legcreaturesevered headstabbed in the cheststabbed to deathmassacreambushgood versus evilsurvivaldecapitationshot in the backkung fuscientistcombatsunglassesheld at gunpointfalling from heightgunfightswordbattlewritten by directorpunched in the facerescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionblooddogviolencesequel (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | survival horrordystopiablack comedy |
Themes: | near death experiencepanicexploitationsadismparanoiabrutalityescapefearkidnappingmurderdeathrevenge |
Mood: | gore |
Locations: | rooftoptruckhelicopter |
Characters: | sniperwarriortough guyhostagepriestafrican american |
Story: | hand grenadehit by a trucksecurity camerahit by a carperson on firethreatened with a knifeemergency broadcast systembarricademacesocial decayanarchystabbed in the armburned to deathmedia coverageblood on shirt …moral dilemmaethnic sluraerial shotpunched in the chestghettostabbed in the headstabbed in the neckshot in the facedual wieldchaosmercilessnessgun fucovered in bloodinterracial friendshipsocial commentarykicked in the stomachmass murderwalkie talkiehelmetsociopathmacheteburned aliveshot in the armkicked in the facebaseball batknocked outcharacter repeating someone else's dialoguestabbed in the backdangerbinocularsshot in the foreheadracial slurshot in the legnews reportvansevered headstabbed in the cheststabbed to deathdeath of friendmontageambulancemassacreaxeambushgangsurvivaldecapitationshot in the backcombatrevolverheld at gunpointriflegunfightswordwritten by directorpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionphotographbare chested malesequelviolenceblood (See All) |
Life for former United Nations investigator Gerry Lane and his family seems content. Suddenly, the world is plagued by a mysterious infection turning whole human populations into rampaging mindless zombies. After barely escaping the chaos, Lane is persuaded to go on a mission to investigate this dis …ease. What follows is a perilous trek around the world where Lane must brave horrific dangers and long odds to find answers before human civilization falls. (Read More)
Subgenre: | zombie apocalypse |
Themes: | apocalypsepanicmilitaryescapesuicidedeathmurder |
Locations: | pennsylvaniarooftopapartmentelevatorairplanemotorcyclehelicopter |
Characters: | snipersecurity guardwarriorsoldierzombiedoctor |
Story: | philadelphia pennsylvaniamass panichand grenadehit by a trucksecurity camerazombie violencestealing a carexploding carperson on fireblockadebarricadelootingshopping cartoutbreakvending machine …crowbarairfieldbitten in the neckflareepidemicliving deadhit with a baseball batmutationgasolineinfectionstabbed in the headpower outagechaoseaten aliveend of the worldsevered handdiseaseviruselectronic music scoremacheteburned alivegrenadesupermarketriotundeadsevered armdie hard scenariobaseball batcharacter repeating someone else's dialoguepilotpolice officer killedshot in the foreheadnews reportcreatureradiostabbed in the cheststabbed to deathdeath of friendmontagewomanaxesurvivalshot in the backscientistcombatrevolverriflefalling from heightgunfightbattlerescueshot in the headshotgunshot in the chestmachine gunshot to deathcorpseshootoutpistolsurprise endingchaseknifeexplosionbare chested malegunblooddogviolence (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | zombie outbreakzombie apocalypsecreature featurepost apocalypseamerican horrorblack comedycult film |
Themes: | cannibalismapocalypsesadismbrutalityfearsuicidedeathmurder |
Mood: | gore |
Locations: | truck |
Characters: | villainzombieafrican american |
Story: | zombie attackdeadly diseaseshopping mallflesh eating zombieexploding carperson on firegory violencehell on earthzombificationanthropophagusflesh eatingbloody violencebitten in the throatgraphic violenceextreme violence …doomsdayoutbreakwalking deadshot in the eyeliving deadmexican americanbad guyethnic slursevered legsiegeracistexploding headdisembowelmentbutchereaten aliveend of the worldsevered handvirusmachetehead buttdisasterundeadcult directordismembermentshot in the armkicked in the faceshot in the foreheadracial slurshot in the legsevered headdeath of frienddecapitationrescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpseshootoutpistolexplosionbloodviolencesequel (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | zombie apocalypsesurvival horrorpost apocalypseindependent film |
Themes: | near death experiencecannibalismapocalypsepanicparanoiabrutalityescapefearsuicidemurderrevengedeath |
Mood: | gore |
Locations: | apartmentairplane |
Characters: | security guardpolice officerzombieboyfriend girlfriend relationship |
Story: | grindhouse filmsecurity camerahit by a carexploding carperson on firemass deathhordetennis balltire irondoomsdaycrowbaranarchyhiding in a closetburned to deathepidemic …vomitliving deadhit with a baseball batblood on shirtmutationgasolinedisfigurementaerial shotstabbed in the legitalian americandual wieldchaoscannibalcovered in bloodeaten aliveend of the worldburialscene during opening creditsvirusmacheteburned alivebow and arrowdisasterundeadbaseball batattackscreamingdangershot in the foreheadstabbed in the cheststabbed to deathtoiletmontageaxeambushsurvivalshot in the backheld at gunpointriflefalling from heightswordrescueshot in the headshotgunshot in the chestblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosioncigarette smokingviolencedogblood (See All) |
Police ambush and kill several gang members in Los Angeles. Gang members make a pact of blood to strike back at police, and conduct a siege on the police station which is almost abandoned and due to be closed. Staff of the closing precinct and the criminals being held there while in transit must wor …k together to fight off the attacking gang members. (Read More)
Subgenre: | b movieblack comedycult filmindependent film |
Themes: | police brutalitysadismbrutalityescapefearrevengedeathmurder |
Mood: | gore |
Characters: | police shootoutwarriortough guypolice officerpolice |
Period: | 1970s |
Story: | radio newsfemale warriorescape attemptclaustrophobictommy gunremadebarricaderookie copwrenchsocial decayshot through a doorvending machinerepeated lineclimbing through a windowflare …dead girlbody counttough copsiegeghettoshot in the facepower outagemercilessnessthuggrindhouseelectronic music scorechild murdercult directorshot in the armdie hard scenarioopening action scenebasementdeath of childtough girlcharacter repeating someone else's dialoguebinocularspolice officer killedwomanmassacreambushganggood versus evilsurvivalshot in the backrevolverlow budget filmheld at gunpointriflegunfightpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosioncigarette smokingbloodviolence (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | zombie apocalypsedystopiablack comedyindependent film |
Themes: | near death experiencecannibalismapocalypseparanoiabrutalitymilitaryescapefearkidnappingdeathrevengemurder |
Mood: | gore |
Locations: | rooftop |
Characters: | warriortough guyhostagepriestsoldierzombie |
Story: | grindhouse filmfemale warriorblood on camera lenscharacter's point of view camera shotsubjective cameraknife throwingthreatened with a knifehordesecret passagewaysurprise during end creditsoutbreakquick drawplaguehead blown offepidemic …moral dilemmaeye patchmutationdisfigurementaerial shotpunched in the chestexploding headinfectionstabbed in the neckdual wieldcannibalmercilessnesscannonsevered handlooking at oneself in a mirrordiseaseburned alivestylized violencecard gamegrenadedismembermentsevered armscene during end creditsscartough girlknocked outattackstabbed in the backdangertrainingsevered headstabbed in the cheststabbed to deathbridgemassacreaxeambushgood versus evilsurvivaldecapitationkung fucombatheld at gunpointriflefalling from heightswordbattlewritten by directorpunched in the facerescueblood splattercorpsebeatingfirepistolsurprise endingchaseknifeexplosionbloodviolencedoggun (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | black comedycult filmindependent film |
Themes: | police brutalitynear death experiencemurder of a police officercannibalismexploitationsadismparanoiabrutalityescapefearkidnappingsuicidedeathmurderrevenge |
Mood: | gore |
Locations: | farm |
Characters: | police shootoutvillaintough guyhostagepolice officerboyfriend girlfriend relationshippolice |
Period: | 1970s |
Story: | grindhouse filmgas grenadehit by a truckstealing a carescape attemptknife throwingthreatened with a knifepolice vigilantismentrailsblockadegraphic violencedeath of loved onebad guymedia coverageblood on shirt …severed legbody counttough copgasolinesiegedisfigurementslaughterpunched in the cheststabbed in the legcigarette lighterstabbed in the neckbutchermercilessnesscannibalcovered in bloodinterracial friendshipgas maskredneckgrindhousekicked in the stomachmass murderscene during opening creditscowboy hatlooking at oneself in a mirrorhead buttstylized violencecult directorshot in the armopening action scenebasementknocked outattackstabbed in the backscreamingpolice officer killedshot in the foreheadracial slurshot in the legcigar smokingnews reportstabbed in the cheststabbed to deathdeath of frienddrug dealeraxeambushsurvivalshot in the backrevolverlow budget filmsecond partheld at gunpointriflevomitinggunfightwritten by directorpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionphotographcigarette smokingbare chested maledogviolencesequelblood (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | survival horrorabsurdismb movieblack comedycult filmindependent film |
Themes: | police brutalityhuntingpanicexploitationparanoiabrutalityescapefearmurderrevengedeath |
Mood: | gore |
Locations: | truckfarm |
Characters: | police officerdoctorboyfriend girlfriend relationshipafrican americanpolice |
Story: | hit with a hammerstealing a carescape attempthit by a carperson on firethreatened with a knifebitten in the armstabbed in the eardecomposing bodyoffscreen killingn wordmercy killinghillbillyhead blown offepidemic …hit with a baseball batsevered legdisfigurementslaughterracistpunched in the cheststabbed in the leginfectiondisembowelmentstabbed in the headstabbed in the neckcovered in bloodeaten aliveredneckgrindhousehuntervirusdiseaseburned alivecult directordismembermentshot in the armsevered armscene during end creditsbaseball batknocked outstabbed in the backscreamingbinocularsshot in the foreheadracial slurshot in the legradiosevered headstabbed in the cheststabbed to deathdeath of friendambulancemassacreaxeambushsurvivaldecapitationshot in the backrevolverlow budget filmheld at gunpointriflevomitingwritten by directorpunched in the faceshot in the headshotgunshot in the chestblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifephotographcigarette smokingbare chested malebloodviolencedog (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | absurdismblack comedyindependent film |
Themes: | police brutalitynear death experiencepanicexploitationsadismbrutalityescapekidnappingmurderrevengedeath |
Mood: | gore |
Locations: | rooftoptruckapartmentelevatorairplanemotorcyclehelicopter |
Characters: | police shootoutsnipersecurity guardwarriortough guyhostagesoldierdoctorpolice |
Story: | motorcycle with a sidecarhand grenadeblood on camera lenssawed off shotguncharacter's point of view camera shotstealing a carescape attemptsubjective camerahit by a carexploding carperson on fireknife throwingtommy gunshot through a dooroffscreen killing …climbing through a windowanarchystabbed in the armhead blown offburned to deathhit with a baseball batbody countdisfigurementpunched in the chestexploding headstabbed in the legcigarette lighterstabbed in the headshot in the facedual wieldchaosmercilessnessgun futhugbikergrindhousekicked in the stomachwalkie talkieelectronic music scoresociopathmacheteburned alivehead buttstylized violencehenchmandismembermentshot in the armsevered armkicked in the facebaseball batknocked outattackstabbed in the backdangerone against manypolice officer killedshot in the foreheadshot in the legvansevered headstabbed in the cheststabbed to deathmontagemassacreaxeambushgood versus evilsurvivaldecapitationshot in the backscientistcombatrevolversunglassesheld at gunpointfalling from heightgunfightswordbattlewritten by directorpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maledogviolencebloodgun (See All) |
A zombie is found aboard a boat off the New York coast which belongs to do a famous scientist. Peter West, a journalist, travels to the Antilles with Ann, the daughter of the scientist. On the way, they meet with with Brian, a ethnologist, and Susan. When they arrive at Matul Island, they find Dr. M …enard, and discover a terrifying disease which is turning the islanders into horrifying zombies which devour human flesh and seem indestructible.... (Read More)
Subgenre: | zombie outbreakzombie apocalypsecreature featuresurvival horroritalian horrorcult filmindependent film |
Themes: | murder of a police officercannibalismapocalypsesadismbrutalityfeardeathmurder |
Mood: | gore |
Locations: | boat |
Characters: | zombiedoctor |
Period: | 1970s |
Story: | zombie attackdeadly diseasegrindhouse filmzombie violenceflesh eating zombieperson on firegory violencehell on earthdrive in classiczombificationflesh eatingbloody violencebitten in the throatgraphic violenceextreme violence …doomsdayoutbreakbitten in the neckhead blown offdeath of loved oneliving deadintestinesblood on shirtslaughterexploding headdisembowelmentstabbed in the headshot in the facemercilessnesscannibaleaten aliveend of the worldgrindhousevirusdiseaseundeadsevered armscreamingpolice officer killedshot in the foreheadsevered headstabbed in the chestdeath of friendmassacreshot in the backscientistcombatheld at gunpointgunfightcamerashot in the headshotgunshot in the chestblood splattershot to deathcorpseshootoutfirepistolsurprise endingchaseexplosiongunviolenceblood (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, …to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
Subgenre: | black comedycult filmindependent film |
Themes: | police brutalitynear death experiencemurder of a police officersadismrobberyescapemoneykidnappingrevengedeathmurder |
Locations: | fire truckrooftopapartmentelevatorhelicopter |
Characters: | police shootoutsniperwarriortough guyhostagepolice officerboyfriend girlfriend relationshippolice |
Story: | shopping mallgas grenadehand grenadehit by a truckgang leadersecurity cameracharacter's point of view camera shotsubjective cameraexploding carshot through a doordreadlocksrepeated linemercy killingdepartment storevomit …police raidhit with a baseball batmedia coveragefirefightermannequintough copaerial shotpunched in the chestmercilessnesstarget practicethugswat teamkicked in the stomachmass murderwalkie talkieelectronic music scorehead buttstylized violencehenchmanshot in the armdie hard scenarioopening action scenescarbaseball batkicked in the facebankknocked outcharacter repeating someone else's dialoguebinocularsone against manypolice officer killedshot in the foreheadtrainingshot in the legnews reportdeath of friendmontageambulancemassacreambushganggood versus evilshot in the backkung furevolversunglassesheld at gunpointvomitingfalling from heightgunfightcamerapunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseexplosionphotographbare chested malebloodviolencesequel (See All) |
A lethal virus spreads throughout Scotland, infecting millions and killing hundreds of thousands. To contain the threat, acting authorities brutally quarantine the country as it succumbs to fear and chaos. The quarantine is successful. Three decades later, the Reaper virus violently resurfaces in Lo …ndon. An elite group of specialists, including Eden Sinclair, is urgently dispatched into Scotland to retrieve a cure by any means necessary. Shut off from the rest of the world, the unit must battle through a landscape that has become a waking nightmare. (Read More)
Subgenre: | post apocalypsedystopiacult film |
Themes: | cannibalismapocalypsesadismparanoiabrutalitymilitaryescapefearkidnappingsuicidemurderdeath |
Mood: | gore |
Locations: | motorcyclehelicopter |
Characters: | hostagepolice officersoldierpolice |
Story: | gas grenadecar set on firehand grenadeblood on camera lensstealing a carhit by a carexploding carperson on firedoomsdayoutbreakshot in the eyeplaguehead blown offepidemicmedia coverage …eye patchdisfigurementinfectionstabbed in the headshot in the facechaoscannibalcrossbowgas masksevered handvirusdiseaseelectronic music scoreburned alivebow and arrowgrenaderiotdismembermentshot in the armkicked in the facetough girlprotestpolice officer killedshot in the legnews reportsevered headaxeambushgangsurvivaldecapitationshot in the backscientistcombatheld at gunpointvomitingfalling from heightgunfightswordbattlepunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutpistolchaseexplosionviolenceblood (See All) |
Subgenre: | black comedy |
Themes: | panicexploitationparanoiabrutalityescapefearsuiciderevengemurderdeath |
Mood: | gore |
Locations: | fire truckrooftopelevatormotorcyclerestaurant |
Characters: | sniperwarriortough guypolicemanpolice officerafrican american |
Story: | female warriorblood on camera lensstealing a carescape attempthit by a carthreatened with a knifegearing upstabbed in the earrepeated linestabbed in the armspiral staircaseblood on shirtbody countaerial shotpunched in the chest …stabbed in the legstabbed in the headstabbed in the neckshot in the facedual wieldmercilessnessgun futarget practicethugkicked in the stomachbeardlooking at oneself in a mirrorstylized violencehenchmanshot in the armopening action scenebasementkicked in the facetough girlcharacter repeating someone else's dialoguestabbed in the backdangerone against manyshot in the foreheadshot in the legcigar smokingstabbed in the cheststabbed to deathmontagemassacreambushsurvivalshot in the backsecond partheld at gunpointfalling from heightgunfightpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingdogsequelbloodgunviolence (See All) |
Subgenre: | survival horrorblack comedycult filmindependent film |
Themes: | near death experiencemurder of a police officerhuntingcannibalismpanicparanoiabrutalityescapefearkidnappingrevengemurderdeath |
Mood: | gore |
Locations: | truck |
Characters: | hostagepolice officerboyfriend girlfriend relationship |
Story: | amateur radioham radiostealing a carhit by a carexploding carperson on firethreatened with a knifesurprise during end creditsdeath of boyfriendoffscreen killingshot in the eyehillbillyhit with a baseball batblood on shirtsevered leg …body countgasolinedisfigurementaerial shotmercilessnesscannibalredneckmachetebow and arrowdismembermentsevered armscene during end creditsstabbed in the backscreamingdangerpolice officer killedshot in the legsevered headstabbed in the cheststabbed to deathtoiletdeath of friendaxeambushsurvivaldecapitationshot in the backriflefalling from heightrescueshot in the headshotgunblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosioncigarette smokingviolenceblood (See All) |
Attack the Block follows an unlucky young woman and and a gang of tough inner-city kids who make an unlikely alliance to try to defend their turf against an invasion of savage alien creatures, turning a South London apartment complex into a war-zone.
Subgenre: | creature featurecult filmindependent film |
Themes: | robberymonsterescapedeathmurderrevenge |
Mood: | gore |
Locations: | apartmentelevatormotorcyclehelicopter |
Characters: | police |
Story: | hit by a truckgang leadercharacter's point of view camera shotstealing a carhit by a carexploding carperson on firethreatened with a knifehousing projectsocial decaymeteorflareburned to deathhit with a baseball batcigarette lighter …stabbed in the headcovered in bloodeaten aliveswat teammacheteburned alivechild murdersevered armdie hard scenariodeath of childbaseball batcharacter repeating someone else's dialogueattackstabbed in the backbinocularspolice officer killedcreaturesevered headstabbed in the cheststabbed to deathdeath of frienddrug dealerwomanaxeambushgangsurvivaldecapitationrevolverheld at gunpointfalling from heightswordwritten by directormachine gunblood splattershot to deathcorpsebeatingfirepistolchaseknifeexplosionblooddogviolence (See All) |
A remake of George Romero's 1968 black-and-white classic that begins in a cemetery, as the recently-dead return to life - from an unknown cause - and attack the living as their prey. One woman escapes the frightening zombies to take refuge with others in a farmhouse, as every cadaver for miles aroun …d hungers for their flesh. Will they make it through the night...that the dead came back to life? (Read More)
Subgenre: | zombie outbreakzombie apocalypsesurvival horroramerican horrorcult film |
Themes: | cannibalismapocalypsefearsuicidedeathmurder |
Mood: | gore |
Locations: | pennsylvaniahelicopter |
Characters: | zombieboyfriend girlfriend relationshipafrican american |
Story: | biker gangzombie attackdeadly diseasebald zombiezombie childzombie violenceflesh eating zombieexploding carperson on firegory violencehell on earthdrive in classiczombificationanthropophagusflesh eating …bloody violencebitten in the throatgraphic violenceextreme violencedoomsdayoutbreakwalking deadfriends who live togetherhillbillyliving deadleather jacketbutcherchaoseaten aliveredneckend of the worldbikersevered handloss of loved oneviruseyeglassesundeadbasementattackshot in the foreheadwomanshot in the headshotgunblood splattercorpsefireexplosionbare chested maleblood (See All) |
Set within a year after the events of Batman Begins, Batman, Lieutenant James Gordon, and new district attorney Harvey Dent successfully begin to round up the criminals that plague Gotham City until a mysterious and sadistic criminal mastermind known only as the Joker appears in Gotham, creating a n …ew wave of chaos. Batman's struggle against the Joker becomes deeply personal, forcing him to "confront everything he believes" and improve his technology to stop him. A love triangle develops between Bruce Wayne, Dent and Rachel Dawes. (Read More)
Subgenre: | cult film |
Themes: | police brutalitynear death experiencepanicsadismparanoiabrutalityrobberyescapefearmoneykidnappingrevengemurderdeath |
Locations: | fire truckrooftoptruckapartmentelevatorboatairplanemotorcyclehelicopterrestaurant |
Characters: | police shootoutpolice dogsnipervillainsecurity guardwarriortough guyhostagepolice officerdoctorboyfriend girlfriend relationshipafrican americanpolice |
Story: | gas grenadecar set on firehand grenadehit by a trucksawed off shotguncharacter's point of view camera shotescape attemptsubjective camerahit by a carexploding carperson on firethreatened with a knifenational guardnewscasterkicking in a door …social decayfamous linecrowbaroffscreen killinganarchyplagueburned to deathdeath of loved onepolice raidmedia coveragemoral dilemmagasolineaerial shotpunched in the chestpower outagechaosmercilessnesssocial commentarythugswat teamkicked in the stomachmass murderloss of loved onewalkie talkiecowboy hatelectronic music scorehelmetsociopathburned alivestylized violencegrenadehenchmandie hard scenarioopening action scenescarkicked in the facebankknocked outcharacter repeating someone else's dialoguedangerone against manypolice officer killedcigar smokingnews reportvandeath of frienddrug dealerbridgemontageambulanceaxeambushganggood versus evilshot in the backkung fuscientistrevolversecond partsunglassesheld at gunpointriflefalling from heightgunfightwritten by directorpunched in the facerescueshotgunshot in the chestmachine gunshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested maledogviolencebloodsequel (See All) |
Subgenre: | black comedy |
Themes: | police brutalitysadismmilitaryescapekidnappingmurderrevengedeath |
Locations: | fire truckrooftopapartmentelevatormotorcyclerestaurant |
Characters: | police shootoutsnipersecurity guardwarriortough guyhostagesoldierpolice |
Story: | hand grenadesecurity camerastealing a carescape attemptthreatened with a knifebarricadekicking in a doorsocial decayn wordhit with a baseball batethnic slurtough coppunched in the chestghettodual wield …u.s. armykicked in the stomachswat teamwalkie talkiehead buttstylized violenceriothenchmanshot in the armdie hard scenarioopening action scenekicked in the facebaseball battough girlknocked outone against manyracial slurcigar smokingnews reportdrug dealerambulanceaxeambushrevolverheld at gunpointfalling from heightgunfightpunched in the facerescueshot in the headshotgunmachine gunbeatingshootoutpistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested maleviolence (See All) |
Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.
Subgenre: | cult film |
Themes: | murder of a police officerpanicexecutionparanoiabrutalityrobberymilitaryescapekidnappingsuicidemurderdeathrevenge |
Locations: | rooftoptruckapartmentelevatorairplanemotorcyclehelicopter |
Characters: | police shootoutsnipersecurity guardwarriortough guyhostagepriestpolicemanpolice officersoldierdoctorpolice |
Story: | hand grenadefemale warriorsawed off shotgunsecurity cameracharacter's point of view camera shotstealing a carescape attemptsubjective cameraexploding carpolice vigilantismnational guardblockaderookie coplootingoffscreen killing …anarchyflarepolice raidmedia coveragedead boygasolinesiegeaerial shotpunched in the chestpower outagechaosmercilessnessu.s. armygas masksocial commentarythugswat teamkicked in the stomachwalkie talkielooking at oneself in a mirrorelectronic music scorehelmetsociopathhead buttbow and arrowstylized violenceriothenchmandie hard scenarioopening action scenedeath of childkicked in the facetough girlknocked outcharacter repeating someone else's dialoguestabbed in the backprotestscreamingdangerone against manypolice officer killedtrainingshot in the legnews reportstabbed in the chestfootballbridgeambulancemassacreambushgood versus evilshot in the backscientistcombatheld at gunpointriflefalling from heightgunfightbattlewritten by directorwatching tvpunched in the facerescueshotgunshot in the chestmachine gunshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographbare chested malesequel (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | creature featuresurvival horrorpost apocalypsedystopiaindependent film |
Themes: | near death experiencecannibalismpanicexecutionsadismbrutalityescapefearsuicidemurderdeath |
Mood: | gore |
Locations: | farmhelicopter |
Characters: | security guardwarriortough guyhostagezombieboyfriend girlfriend relationship |
Story: | female warriorblood on camera lenssecurity camerathreatened with a knifeair ventoffscreen killingflareepidemicmoral dilemmastabbed in the legcigarette lighterinfectionstabbed in the headstabbed in the neckbutcher …power outagemercilessnesscannibaleaten alivekicked in the stomachbeardvirusdiseasemachetehead buttdismembermenttough girlstabbed in the backscreamingdangershot in the foreheadshot in the legcreaturesevered headstabbed in the cheststabbed to deathbridgeaxeambushgood versus evilsurvivaldecapitationshot in the backcombatrevolverheld at gunpointriflefalling from heightgunfightbattlewritten by directorpunched in the facerescueshot in the headshotgunshot in the chestfoodblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosiongunviolenceblood (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead …that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
Subgenre: | zombie apocalypsesurvival horrorpost apocalypsedystopia |
Themes: | brutalitymonsterescapekidnappingrevengedeathmurder |
Mood: | poetic justicegore |
Locations: | rooftopelevatorboatairplanehelicopter |
Characters: | sniperwarriorhostagesoldierzombie |
Story: | zombie attackamateur radioham radioelevator shaftfemale warriorsawed off shotgunsecurity cameraknife throwingsurprise during end creditsairfieldbitten in the neckflarehead blown offmutationsiege …aerial shotexploding headinfectionshot in the facechaosmercilessnessgun fueaten alivesocial commentarykicked in the stomachvirussociopathgrenadehenchmanundeadshot in the armscene during end creditskicked in the facetough girlstabbed in the backbinocularsshot in the foreheadshot in the legcreaturesevered headstabbed in the chestdeath of friendmassacreaxegood versus evilsurvivaldecapitationshot in the backcombatrevolversunglassesheld at gunpointfalling from heightswordbattlepunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathshootoutpistolsurprise endingchaseknifeexplosionblooddogviolencegunsequel (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to … survive the night in Los Angeles. (Read More)
Subgenre: | survival horrordystopia |
Themes: | near death experiencehuntingbrutalitykidnappingrevengemurderdeath |
Mood: | gore |
Locations: | apartmentmotorcyclecar |
Characters: | snipertough guyhostageboyfriend girlfriend relationshippolice |
Story: | gas grenadecar set on firehand grenadecharacter's point of view camera shotstealing a carhit by a carexploding carperson on fireemergency broadcast systemmass deathdeath of boyfriendanarchyhiding in a closethit with a baseball batmedia coverage …ghettoshot in the facegas maskmass murdermacheteburned aliveshot in the armdie hard scenariocharacter repeating someone else's dialogueshot in the foreheadshot in the legnews reportstabbed in the cheststabbed to deathambulanceaxeambushgangsurvivalshot in the backrevolversecond partheld at gunpointwritten by directorrescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolsurprise endingknifeexplosionphotographbare chested maleviolencebloodsequel (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra …nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
Subgenre: | dystopia |
Themes: | panicsadismparanoiabrutalityescapefearmoneykidnappingrevengemurderdeath |
Mood: | poetic justicegore |
Locations: | fire trucktruckfarmmotorcyclehelicopter |
Characters: | professorwarriortough guyhostagesoldierdoctorpolice |
Story: | amateur radioham radiohand grenadehit by a truckblood on camera lenscharacter's point of view camera shotstealing a carsubjective camerahit by a carexploding carthreatened with a knifegory violencetire ironbloody violencegraphic violence …extreme violenceoffscreen killingstabbed in the armhead blown offhit with a baseball batblood on shirtmoral dilemmaethnic slursevered legbody countpunched in the cheststabbed in the legstabbed in the headstabbed in the neckshot in the facemercilessnesssocial commentaryredneckthugburialsevered handkicked in the stomachswat teamwalkie talkiescene during opening creditscowboy hatlooking at oneself in a mirrorvirussociopathstylized violencehenchmandismembermentshot in the armsevered armopening action scenescarbaseball batkicked in the faceknocked outcharacter repeating someone else's dialoguestabbed in the backscreamingdangerbinocularsone against manypolice officer killedshot in the foreheadracial slurshot in the legvansevered headstabbed in the cheststabbed to deathmontagemassacreaxegangsurvivaldecapitationshot in the backscientistcombatrevolversunglassesheld at gunpointswordwritten by directorwatching tvpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosionphotographbare chested malesequeldogbloodviolencegun (See All) |
In TRIPLE 9, a crew of dirty cops are blackmailed by the Russian mob to execute a virtually impossible heist. The only way to pull it off is to manufacture a 999, police code for "officer down". Their plan is turned upside down when the unsuspecting rookie they set up to die foils the attack, trigge …ring a breakneck, action-packed finale filled with double-crosses, greed and revenge. (Read More)
Subgenre: | independent film |
Themes: | police brutalitynear death experiencemurder of a police officerpanicparanoiabrutalityrobberyescapefearmoneykidnappingrevengemurderdeath |
Locations: | fire truckapartmentelevatorairplanehelicoptercarrestaurant |
Characters: | police shootouthispanic americansecurity guardhostagepolice officerboyfriend girlfriend relationshipafrican americanpolice |
Story: | car set on firesecurity cameraexploding carthreatened with a knifehousing projectrookie copsocial decayoffscreen killingmercy killingpolice raidblood on shirtfirefighterethnic slurtough copgasoline …aerial shotpunched in the chestghettocigarette lightershot in the faceinterracial friendshipthugswat teamwalkie talkiescene during opening creditselectronic music scoresociopathgrenadehenchmanopening action scenekicked in the facebaseball batbankattackprotestdangerpolice officer killedshot in the foreheadracial slurcigar smokingnews reportvansevered headdeath of frienddrug dealermontageambulanceambushgangrevolversunglassesheld at gunpointgunfightpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested maleviolenceblood (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
Subgenre: | black comedy |
Themes: | panicsadismparanoiabrutalityescapefearkidnappingdeathrevengemurder |
Mood: | gore |
Locations: | rooftopapartmentelevatorairplanemotorcyclerestaurant |
Characters: | police shootoutsniperhostagepolice officersoldierpolice |
Story: | car set on firefemale warriorblood on camera lensstealing a carescape attempthit by a carexploding carknife throwingthreatened with a knifebloody violencegraphic violenceshot in the eyestabbed in the armpolice raidblood on shirt …gasolineaerial shotpunched in the cheststabbed in the legcigarette lighterstabbed in the headshot in the facemercilessnesscovered in bloodthugkicked in the stomachscene during opening creditsbeardelectronic music scorehead buttstylized violenceriothenchmanhandgunopening action scenescarkicked in the facetough girlknocked outcharacter repeating someone else's dialogueattackstabbed in the backprotestdangerbinocularsone against manypolice officer killedshot in the foreheadshot in the legnews reportvanradiostabbed in the cheststabbed to deathbridgemontagewomanmassacreambushsurvivalshot in the backkung furevolverbedsunglassesheld at gunpointfalling from heightgunfightcamerapunched in the facerescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malebloodgunviolence (See All) |
Twenty three-year-old Mitch lost his parents to a tragic car accident at the age of fourteen, and his girlfriend to a terrorist attack just as they were engaged. Seeking revenge, he is enlisted by CIA Deputy Director Irene Kennedy as a black ops recruit. Kennedy then assigns Cold War veteran Stan Hu …rley to train Mitch. Together they will later on investigate a wave of apparently random attacks on military and civilian targets. The discovery of a pattern in the violence leads them to a joint mission with a lethal Turkish agent to stop a mysterious operative intent on starting a world war in the Middle East. (Read More)
Themes: | near death experiencepanicexploitationsadismbrutalitymilitaryescapemoneykidnappingsuicidemurderdeathrevenge |
Mood: | gore |
Locations: | rooftopapartmentelevatorboatairplanemotorcyclehelicoptercarrestaurant |
Characters: | sniperwarriortough guyhostagepolice officersoldierdoctorboyfriend girlfriend relationship |
Story: | helicopter pilotfemale warriorblood on camera lenscharacter's point of view camera shotstealing a carsubjective camerahit by a carexploding carknife throwingthreatened with a knifehousing projectsecret passagewaybloody violenceblowtorchanarchy …stabbed in the armdeath of loved onevomitethnic slurbody countgasolineaerial shotpunched in the cheststabbed in the legshot in the facemercilessnesstarget practicegas maskthugcannonkicked in the stomachloss of loved onewalkie talkiebeardsociopathhenchmanshot in the armopening action scenescartough girlbankknocked outcharacter repeating someone else's dialogueattackstabbed in the backdangerone against manypolice officer killedshot in the foreheadracial slurtrainingshot in the legnews reportvanstabbed in the cheststabbed to deathmontagemassacreambushshot in the backscientistsunglassesheld at gunpointgunfightpunched in the facerescueshot in the headshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested maledogviolenceblood (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter …mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
Subgenre: | black comedy |
Themes: | near death experiencepanicsadismbrutalityrobberymilitarymonsterescapefearkidnappingsuiciderevengemurderdeath |
Locations: | rooftopelevatorairplanehelicopterrestaurant |
Characters: | snipersecurity guardwarriortough guyhostagesoldierboyfriend girlfriend relationshipafrican american |
Story: | female warriorsecurity cameracharacter's point of view camera shotescape attemptsubjective cameraexploding carperson on firedepartment storeflarespiral staircasehead blown offburned to deathhit with a baseball batethnic slurmutation …aerial shotpunched in the chestexploding headcigarette lighterstabbed in the headstabbed in the neckpower outagedual wieldchaoscannibalu.s. armytarget practicethugend of the worldsevered handkicked in the stomachswat teamwalkie talkiebeardsociopathmacheteburned alivehead buttstylized violencehenchmanscene during end creditsscarkicked in the facetough girlknocked outstabbed in the backdangerone against manyshot in the foreheadracial slurvancreaturesevered headstabbed in the cheststabbed to deathmontagewomanmassacreambushgangsurvivaldecapitationshot in the backscientistcombatrevolversunglassesheld at gunpointfalling from heightgunfightswordbattlewritten by directorpunched in the facerescueshot in the headshotgunshot in the chestmachine gunshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosionphotographbare chested maleviolence (See All) |
A down and out cynical detective teams up with a down and out ex-quarterback to try and solve a murder case involving a pro football team and a politician.
Subgenre: | black comedycult film |
Themes: | murder of a police officerbrutalityescapemoneykidnappingsuiciderevengedeathmurder |
Mood: | gore |
Locations: | fire truckapartmenthelicoptercar |
Characters: | police shootoutsniperwarriortough guyhostagepolice officerboyfriend girlfriend relationshipafrican americanpolice |
Story: | sawed off shotgunstealing a carhit by a carexploding carperson on firethreatened with a knifegraphic violencekicking in a doorrepeated linequick drawgolf clubhead blown offhiding in a closetburned to deathdeath of loved one …firefightertough copstabbed in the legshot in the facem 16dual wieldgun fuinterracial friendshipthugswat teamloss of loved onecowboy hatburned alivestylized violencehenchmanshot in the armdie hard scenarioopening action scenescarknocked outcharacter repeating someone else's dialogueone against manypolice officer killedshot in the foreheadshot in the legdeath of friendfootballmassacreambushshot in the backcombatrevolversunglassesheld at gunpointfalling from heightgunfightcamerapunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malegunviolencedogblood (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | black comedycult filmindependent film |
Themes: | near death experiencemurder of a police officersadismescapefearkidnappingdeathmurderrevenge |
Mood: | gore |
Locations: | truckfarm |
Characters: | police shootouthostagepolice officerpolice |
Story: | hit by a truckgang leadersawed off shotgunstealing a carhit by a carexploding carperson on fireknife throwingthreatened with a knifeshot through a doorvending machinebitten in the neckquick drawburned to deathpolice raid …blood on shirtmoral dilemmasiegedisfigurementpunched in the chestoutlawmercilessnessredneckthugmass murderscene during opening creditscowboy hatelectronic music scoresociopathburned alivecard gameundeaddeath of childscarscreamingpolice officer killedshot in the foreheadshot in the legcigar smokingvanstabbed in the cheststabbed to deathmassacreganggood versus evilshot in the backrevolversunglassesheld at gunpointriflevomitinggunfightwatching tvpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosioncigarette smokingbare chested maledogviolencegunblood (See All) |
Small-town stoner Mike Howell ('Jesse Eisenberg' (qv)) spends most of his time getting high and writing a graphic novel about a superhero monkey. What Mike doesn't know is that he was trained by the CIA to be a lethal killing machine. When the agency targets him for termination, his former handler a …ctivates his latent skills, turning the mild-mannered slacker into a deadly weapon. Now, the utterly surprised Mike must use his newfound abilities to save himself and his girlfriend from getting wasted by the failed test subjects that are sent after him by the CIA. (Read More)
Subgenre: | absurdismblack comedyindependent film |
Themes: | near death experienceexecutionsadismparanoiabrutalitymilitaryescapefearkidnappingmurderrevengedeath |
Mood: | poetic justicesatiregore |
Locations: | fire trucktruckelevatorairplanehelicopter |
Characters: | police shootouthostagepolice officersoldierboyfriend girlfriend relationshippolice |
Story: | hit with a hammercar set on firehand grenadesecurity cameraescape attemptexploding carthreatened with a knifeblockadevinylshot through a doorrepeated linen wordstabbed in the armblood on shirtgasoline …siegepunched in the cheststabbed in the legcigarette lighterstabbed in the headstabbed in the neckshot in the facepower outageu.s. armycovered in bloodgas masksocial commentaryswat teamhammerhead buttstylized violencesupermarketshot in the armdie hard scenariotough girlknocked outcharacter repeating someone else's dialoguestabbed in the backone against manypolice officer killedshot in the foreheadnews reportstabbed in the chestdrug dealerbridgemontageambulancemassacreambushsurvivalshot in the backrevolverheld at gunpointvomitinggunfightpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested malebloodviolence (See All) |
After an experimental bio-nerve gas is accidentally released at a remote U.S. military base in Texas, those exposed to the gas turn into flesh-eating, mutating zombies out to kill. An assortment of various people who include stripper Cherry, her shady mechanic ex-boyfriend Wray, a strong-willed doct …or, the local sheriff, and an assortment of various people must join forces to survive the night as the so-called "sickos" threaten to take over the whole town and the world. (Read More)
Subgenre: | zombie apocalypsecreature featuresurvival horrorb movieblack comedycult film |
Themes: | murder of a police officercannibalismparanoiamilitaryfearpregnancymurderdeath |
Mood: | gore |
Locations: | elevatormotorcyclehelicoptercar |
Characters: | tough guypolice officersoldierzombiedoctorboyfriend girlfriend relationship |
Story: | deadly diseasehit by a truckblood on camera lenszombie violenceflesh eating zombiehit by a carexploding carperson on fireanthropophagusflesh eatingbloody body of a childdoomsdaydirector also cinematographerwalking deadhead blown off …death of loved oneleather jacketsevered legmutationexploding headinfectionstabbed in the neckshot in the faceeaten alivegas maskend of the worldhammerdismembermentdeath of childtough girlstabbed in the backshot in the foreheadshot in the legsevered headstabbed in the cheststabbed to deathaxesurvivaldecapitationshot in the backscientistheld at gunpointfalling from heightshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpseshootoutfirepistolexplosionbare chested malebloodviolencedog (See All) |
A reckless janitor accidentally releases a zombie from a laboratory of research. Meanwhile, the teenagers scouts Ben Goudy and Carter Grant decide to camp for the last time since they are too old to be scouts. The problem is that they do not want to harm the feelings of their friend Augie Foster and … the Scout Leader Rogers. They have a flat tire after hitting a deer on the road and Carter's sister Kendall Grant, her boyfriend and her friend Chloe stop their Jeep to see whether they need a ride. They invite Ben and Carter to go to a party in the night. The two scouts leave the camping during the night to go to the party. When they drive through the town, they do not see a living soul and they decide to visit a night-club since the bouncer is not at the door. They discover that people have turned into zombies and they team-up with Ben's recent acquaintance Denise Russo, who is bartender in the nightclub, and Augie that was left alone at the camp and came to the town. Soon they discover that the non-infected inhabitants have been evacuated and the town will be bombed by the government. They decide to rescue Kendall but they find that the address her boyfriend gave to them is wrong. What can they do to save Kendall? (Read More)
Subgenre: | zombie apocalypseabsurdismb movieblack comedy |
Themes: | near death experiencemurder of a police officerapocalypseexploitationmilitaryescapefearrevengedeathmurder |
Mood: | gore |
Locations: | motorcyclehelicopter |
Characters: | hostagepolice officersoldierzombieboyfriend girlfriend relationship |
Story: | zombie attackhand grenadeblood on camera lensstealing a carhit by a carperson on firethreatened with a knifegory violencebitten in the armgearing upabsurd violencehordetire ironsurprise during end creditsbarricade …hardware storeoutbreakvending machinebitten in the neckmallhead blown offblood on shirtsevered legbody countmutationgasolinedisfigurementaerial shotexploding headstabbed in the leginfectioncigarette lighterstabbed in the headstabbed in the neckshot in the faceu.s. armycrossbowcovered in bloodeaten alivegrindhousewalkie talkievirusdiseasehead buttburned aliveundeaddismembermentsevered armbasementscene during end creditsattackcharacter repeating someone else's dialoguestabbed in the backsuburbdangerpolice officer killedshot in the foreheadshot in the legvanradiosevered headstabbed in the cheststabbed to deathmontagemassacreaxeambushsurvivaldecapitationshot in the backscientistwritten by directorrescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsefirepistolsurprise endingchaseknifeexplosionphotographbare chested maleviolencegunblood (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | dystopia |
Themes: | police brutalitymonsterescapekidnappingdeathrevengemurder |
Mood: | poetic justicegore |
Locations: | rooftopelevatorhelicopter |
Characters: | security guardwarriorhostagedoctorpolice |
Story: | hand grenadeelevator shaftfemale warriorsecurity cameracharacter's point of view camera shotstealing a carsubjective camerahit by a carknife throwingdocksbitten in the neckshot in the eyestabbed in the armmutationpunched in the chest …stabbed in the legstabbed in the headshot in the facegun fusocial commentarykicked in the stomachgrenadehenchmanshot in the armsevered armkicked in the facetough girlcharacter repeating someone else's dialogueattackstabbed in the backone against manyshot in the foreheadshot in the legnews reportcreaturesevered headstabbed in the cheststabbed to deathmassacreaxegood versus evilsurvivaldecapitationshot in the backkung fuscientistcombatrevolverheld at gunpointfalling from heightgunfightswordbattlepunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographbare chested malesequelbloodviolence (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Subgenre: | black comedy |
Themes: | near death experiencepanicparanoiamilitarymonsterescapefearkidnappingmurderdeathrevenge |
Locations: | rooftopairplanehelicopter |
Characters: | professorsecurity guardwarriortough guyhostagepriestpolice officersoldierzombiedoctorpolice |
Story: | hand grenadesecurity cameracharacter's point of view camera shotescape attemptsubjective camerathreatened with a knifecontemporary settingdecomposing bodybitten in the neckoffscreen killingliving deadsidekickmedia coveragemoral dilemmaaerial shot …punched in the cheststabbed in the legstabbed in the neckpower outagemercilessnessu.s. armytarget practiceburialkicked in the stomachwalkie talkiegrenadeundeadopening action scenescarknocked outattackcharacter repeating someone else's dialoguescreamingdangerbinocularspilotpolice officer killedshot in the legnews reportstabbed in the cheststabbed to deathdeath of friendambulancemassacreaxeambushgood versus evilshot in the backscientistcombatsunglassesheld at gunpointgunfightbattlepunched in the facerescueshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested malebloodviolencedog (See All) |
Themes: | near death experiencepanicsadismparanoiabrutalityrobberyescapefearpregnancykidnappingdeathmurder |
Locations: | rooftoptruckapartmentelevatorboatmotorcycle |
Characters: | police shootoutsecurity guardwarriortough guyhostagepolicemanpolice officerdoctorboyfriend girlfriend relationshippolice |
Story: | hand grenadefemale warriorcharacter's point of view camera shotsubjective camerahit by a carexploding carknife throwingsurprise during end creditsdocksmaceoffscreen killingshot in the eyehiding in a closetdeath of loved onedisfigurement …aerial shotpunched in the chestmercilessnessthugkicked in the stomachloss of loved onewalkie talkiehelmetsociopathstylized violencegrenadehenchmanopening action scenescene during end creditskicked in the facetough girlbankknocked outattackscreamingdangerbinocularsone against manypolice officer killedshot in the foreheadcigar smokingnews reportambulanceaxeambushgood versus evilkung furevolverheld at gunpointfalling from heightgunfightcamerapunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattercorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malebloodviolencegun (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ …le'. (Read More)
Subgenre: | absurdismblack comedy |
Themes: | near death experiencecannibalismpanicparanoiabrutalityescapefearkidnappingrevengedeathmurder |
Mood: | satiregore |
Locations: | apartmentairplanehelicoptercar |
Characters: | security guardwarriortough guyhostagesoldierboyfriend girlfriend relationshipafrican american |
Story: | hand grenadesecurity cameracharacter's point of view camera shotsubjective cameraexploding carthreatened with a knifeshot through a dooranarchyburned to deathmedia coveragemoral dilemmaeye patchsiegeaerial shotpunched in the chest …cigarette lighterinfectionshot in the facedual wieldmercilessnessgun fuinterracial friendshipsocial commentaryredneckthugsevered handkicked in the stomachwalkie talkiecowboy hatlooking at oneself in a mirrordiseasevirussociopathhead buttstylized violenceeyeglasseshenchmansevered armhandgunopening action scenescarbaseball batkicked in the faceknocked outcharacter repeating someone else's dialoguedangerone against manyshot in the foreheadnews reporttoiletdeath of frienddrug dealermontageambulanceaxeambushgood versus evilshot in the backrevolverbedsecond partsunglassesheld at gunpointriflegunfightbattlewatching tvpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathbeatingshootoutpistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malegunsequeldogbloodviolence (See All) |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo …rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
Subgenre: | zombie apocalypsesurvival horrorpost apocalypsedystopia |
Themes: | cannibalismmilitarymonsterescapekidnappingrevengedeathmurder |
Mood: | gore |
Locations: | rooftopelevatorairplanemotorcyclehelicopter |
Characters: | warriortough guyhostagesoldierzombie |
Story: | hand grenadehit by a truckfemale warriorblood on camera lenssecurity cameraflesh eating zombiehit by a carthreatened with a knifewalking deadbitten in the neckplaguehiding in a closethit with a baseball batmutationpunched in the chest …infectionshot in the facepower outagedual wieldgun fueaten alivegas maskend of the worldkicked in the stomachdiseasevirusstylized violenceeyeglassesshot in the armdie hard scenariokicked in the facebaseball battough girlsuburbone against manyshot in the foreheadshot in the legcreatureaxesurvivalshot in the backcombatheld at gunpointfalling from heightgunfightbattlepunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathshootoutpistolsurprise endingchaseknifeexplosionviolencebloodsequel (See All) |
Ben must prove he is good enough to date cop James' sister. By doing this he goes on a "Ride Along" to show that he is not weak and he will do whatever it takes to get James' approval but along the way runs into a few obstacles that he has to overcome in a very funny way.
Themes: | police brutalityparanoiaescapekidnappingmurderdeath |
Locations: | motorcycle |
Characters: | police shootoutsecurity guardtough guyhostagedoctorboyfriend girlfriend relationshipafrican americanpolice |
Story: | biker gangmotorcycle gangshopping mallhand grenadesecurity cameracharacter's point of view camera shotstealing a carsubjective cameraexploding carthreatened with a knifegun storepolice vigilantismsurprise during end creditsethnic slurtough cop …punched in the chesttarget practicethugbikerkicked in the stomachscene during opening creditselectronic music scorehead buttgrenadehenchmanshot in the armopening action scenescene during end creditskicked in the faceknocked outcharacter repeating someone else's dialogueracial slurshot in the legnews reportfootballbasketballambulanceambushshot in the backrevolversunglassesheld at gunpointgunfightwatching tvpunched in the facerescueshotgunshot in the chestmachine gunshot to deathbeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested maleviolenceblood (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | survival horrorindependent film |
Themes: | near death experiencepanicparanoiabrutalityescapefearkidnappingmurderdeathrevenge |
Mood: | gore |
Locations: | restaurant |
Characters: | warriortough guyhostagepolicemanboyfriend girlfriend relationshippolice |
Story: | gang leaderbattle cryfemale warriorstealing a carescape attemptthreatened with a knifevinyln wordshot in the eyestabbed in the armethnic slurgasolineaerial shotcigarette lighterdisembowelment …stabbed in the headstabbed in the neckshot in the facepower outagemercilessnesseaten alivethugsociopathmachetehenchmandie hard scenariobaseball battough girlstabbed in the backdangershot in the foreheadracial slurshot in the legvanstabbed in the cheststabbed to deathdeath of frienddrug dealermontageambushgangsurvivalshot in the backrevolverheld at gunpointgunfightwritten by directorshot in the headshotgunshot in the chestblood splattershot to deathcorpseshootoutpistolsurprise endingknifephotographcigarette smokingdogviolenceblood (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
Subgenre: | creature featuresurvival horrorb movieblack comedycult filmindependent film |
Themes: | near death experiencepanicparanoiamonsterescapefearkidnappingmurderdeath |
Mood: | satire |
Locations: | rooftopfarmhelicopter |
Characters: | hostagepriestpolice officerboyfriend girlfriend relationship |
Story: | character's point of view camera shotstealing a carescape attemptsubjective camerabitten in the legbitten in the armloss of boyfrienddeath of boyfriendconsumerismburned to deathhit with a baseball batdead boymutationsiegecigarette lighter …psychotronicpower outagechaosmercilessnesseaten alivesocial commentaryredneckscene during opening creditselectronic music scoreburned alivebaseball batknocked outscreamingdangerpolice officer killednews reportcreatureradiotoiletaxeambushsurvivalrevolverheld at gunpointriflewatching tvrescueshotgunshot in the chestblood splattershot to deathcorpsefiresurprise endingknifeexplosionphotographcigarette smokingbloodviolence (See All) |
Southland Tales is an ensemble piece set in the futuristic landscape of Los Angeles on July 4, 2008, as it stands on the brink of social, economic and environmental disaster. Boxer Santaros is an action star who's stricken with amnesia. His life intertwines with Krysta Now, an adult film star develo …ping her own reality television project, and Ronald Taverner, a Hermosa Beach police officer who holds the key to a vast conspiracy. (Read More)
Subgenre: | dystopiaabsurdismblack comedycult filmindependent film |
Themes: | police brutalityapocalypsepanicparanoiabrutalitymilitaryescapefearpregnancykidnappingsuicidemurderdeath |
Mood: | satiregore |
Locations: | elevatorhelicopter |
Characters: | police shootoutsniperhostagepolicemanpolice officersoldierafrican americanpolice |
Story: | racist copradio newssecurity cameracharacter's point of view camera shotsubjective camerahit by a carmass deathvideo arcadenewscasterdoomsdaysocial decaylootingn wordshot in the eyeanarchy …vomitpolice raidmedia coverageblood on shirtethnic sluraerial shotpunched in the chestm 16power outagedual wieldchaosu.s. armygas masksocial commentaryend of the worldsevered handkicked in the stomachswat teammass murderelectronic music scoredisasterriotshot in the armhandgunscarknocked outcharacter repeating someone else's dialogueprotestdangerpolice officer killedracial slurshot in the legnews reporttoiletdeath of frienddrug dealermontageambulanceambushshot in the backscientisttelevisionrevolversunglassesheld at gunpointriflevomitingfalling from heightgunfightwritten by directorwatching tvpunched in the faceshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malebloodgunviolencedogsequel (See All) |
Subgenre: | black comedy |
Themes: | panicexecutionparanoiabrutalityrobberymonsterescapefearmoneykidnappingdeathmurderrevenge |
Locations: | boat |
Characters: | warriortough guyhostagesoldier |
Story: | character's point of view camera shotsubjective cameraknife throwingthreatened with a knifekicking in a doorburned to deathdisfigurementaerial shotpunched in the cheststabbed in the legoutlawstabbed in the headshot in the facedual wieldchaos …mercilessnesstarget practiceinterracial friendshipeaten alivekicked in the stomachscene during opening creditsbeardhelmethead buttburned alivebow and arrowstylized violenceriothenchmanshot in the armsevered armopening action scenescarknocked outattackcharacter repeating someone else's dialoguestabbed in the backscreamingdangerone against manytrainingshot in the legcreaturesevered headstabbed in the cheststabbed to deathbridgemontagemassacreaxeambushganggood versus evildecapitationshot in the backcombatfalling from heightswordbattlewritten by directorpunched in the facerescueshot in the headshot in the chestblood splattershot to deathcorpsebeatingfiresurprise endingchaseknifeexplosionbare chested malebloodviolencedog (See All) |
In a dystopian near future, humanity has been ravaged by a mysterious fungal disease. The afflicted are robbed of all free will and turned into flesh-eating 'hungries'. Humankind's only hope is a small group of hybrid children who crave human flesh but retain the ability to think and feel. The child …ren go to school at an army base in rural Britain, where they're subjected to cruel experiments by Dr. Caroline Caldwell (Glenn Close). School teacher Helen Justineau (Gemma Arterton) grows particularly close to an exceptional girl named Melanie (Sennia Nanua), thus forming a special bond. But when the base is invaded, the trio escape with the assistance of Sgt. Eddie Parks (Paddy Considine) and embark on a perilous journey of survival, during which Melanie must come to terms with who she is. (Read More)
Subgenre: | zombie apocalypsesurvival horrorpost apocalypsedystopiaindependent film |
Themes: | near death experiencecannibalismapocalypsepanicparanoiamilitaryescapefearkidnappingmurderdeath |
Mood: | gore |
Locations: | rooftop |
Characters: | hostagesoldierzombiedoctor |
Story: | hand grenadehit by a truckzombie childflesh eating zombieend of civilizationhordeflesh eatingdecomposing bodyoutbreakbitten in the neckmercy killingliving deadhit with a baseball batblood on shirtmoral dilemma …severed legbody countmutationaerial shotinfectionshot in the facecannibaleaten alivegas masksocial commentarywalkie talkiediseasevirusundeadsevered armbaseball batknocked outcharacter repeating someone else's dialoguescreamingdangerbinocularsshot in the foreheadvancreaturemassacreambushsurvivalshot in the backscientistcombatheld at gunpointbattlerescueshot in the headshot in the chestmachine gunfoodblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeblooddogviolence (See All) |
Air travel is the safest, the FAA says. But the FAA never figured the risk with Charles Rane on board. "The Rane of Terror" has masterminded four terrorist attacks. Soon there will be a fifth -- and that's bad news for the passengers on Flight 163. But there's good news too: the man in seat 57! Wesl …ey Snipes plays John Cutter, an undercover security operative who enters the lavatory and exits to find Rane (Bruce Payne) and his gang have taken over. Cutter's next move is clear. Do. Or be done to. (Read More)
Subgenre: | black comedycult film |
Themes: | police brutalitypanicsadismparanoiabrutalityescapefearkidnappingrevengedeathmurder |
Mood: | gore |
Locations: | fire truckairplanehelicopter |
Characters: | police shootoutsniperwarriortough guyhostagepolice officerafrican americanpolice |
Story: | hand grenadeescape attemptexploding carthreatened with a knifeairfieldquick drawgolf clubfirefighterracistpunched in the chestm 16mercilessnessredneckswat teamkicked in the stomach …cowboy hatelectronic music scorehenchmandie hard scenarioopening action scenekicked in the faceknocked outdangerbinocularspilotone against manyshot in the foreheadvantoiletambulanceambushganggood versus evilsurvivalshot in the backkung fusunglassesheld at gunpointfalling from heightgunfightpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosiongunbloodviolence (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
Themes: | near death experiencepanicparanoiabrutalityescapefeardeathmurder |
Mood: | poetic justicegore |
Locations: | motorcycle |
Characters: | snipersecurity guardwarriortough guyhostagesoldier |
Story: | female warriorsecurity camerastealing a carknife throwingthreatened with a knifesecret passagewaystabbed in the armburned to deathaerial shotpunched in the cheststabbed in the legstabbed in the headstabbed in the neckshot in the facedual wield …mercilessnessgun futarget practicecrossbowcovered in bloodkicked in the stomachburned alivestylized violencehenchmanshot in the armsevered armhandgunopening action scenekicked in the facetough girlknocked outcharacter repeating someone else's dialoguestabbed in the backdangerone against manyshot in the foreheadtrainingshot in the legsevered headstabbed in the cheststabbed to deathbridgemassacreambushsurvivaldecapitationshot in the backcombatheld at gunpointfalling from heightgunfightswordbattlepunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionbare chested maleviolencebloodsequel (See All) |