Best popular movies like De Vierde Man:

Do you need specific genre & keyword selection to find films similar to De Vierde Man?
<< FIND THEM HERE! >>

De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

De Vierde Man (1983)

The morbid Catholic writer Gerard Reve who is bisexual, alcoholic and has frequent visions of death is invited to give a lecture in the literature club of Vlissingen. While in the railway station in Amsterdam, he feels attracted to a handsome man who embarks on another train. Gerard is introduced to β€¦ the treasurer of the club and beautician Christine Halsslag, a wealthy widow who owns the Spider beauty shop, and they engage in a one night stand. On the next morning, Gerard sees the picture of Christine's boyfriend Herman and recognizes him as the man he saw in the train station. He urges her to bring Herman to her house to spend a couple of days together, but with the secret intention of seducing the man. Christine travels to Koln to bring her boyfriend and Gerard stays alone in her house. He drinks whiskey and snoops through her safe, finding three film reels with names of men; he decides to watch the footage and discovers that Christine had married each; all of whom died in tragic accidents. Later Gerard believes Christine is a Black Widow and questions whether Herman or he will be her doomed fourth husband. (Read More)

Subgenre:
sexual thrillerlgbt horrorsemi autobiographicalparanormal phenomena
Themes:
mysterious deathwritinginsanityfearreligionsurrealismdeath
Mood:
nightmaregore
Locations:
train stationcemetery
Characters:
catholichomosexualityalcoholicgay kisswriter
Story:
hair salonwhite briefslicking facepenis cut offscene based on paintingimpaledsalonspiderwebpsycho sexualgiallo esquecutting hairreference to the virgin marytalking while drivingspeedourn β€¦graphic violencehitchcockianman in underwearpremonitioneyecrucifixionbisexualityhairdressertombbriefscastrationscissorsvisionmale underwearhaircutfemale killerspidercrossconvertibledangeraccidentwidowbisexualmale pubic hairvoyeurbare buttdreamwoman on topmale full frontal nudityfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditybased on novelmale nuditysex scenebloodmasturbationkiss (See All)

Basic Instinct (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Basic Instinct (1992)

A former rock star, Johnny Boz, is brutally killed during sex, and the case is assigned to detective Nick Curran of the SFPD. During the investigation, Nick meets Catherine Tramell, a crime novelist who was Boz's girlfriend when he died. Catherine proves to be a very clever and manipulative woman, a β€¦nd though Nick is more or less convinced that she murdered Boz, he is unable to find any evidence. Later, when Nilsen, Nick's rival in the police, is killed, Nick suspects of Catherine's involvement in it. He then starts to play a dangerous lust-filled mind game with Catherine to nail her, but as their relationship progresses, the body count rises and contradicting evidences force Nick to start questioning his own suspicions about Catherine's guilt. (Read More)

Subgenre:
erotic thriller
Themes:
mysterious deathwritingdeathmurderbetrayaljealousylesbianismdrunkennessdeceptionvoyeurismseductionangercorruptionpsychopath β€¦obsessionparanoiaguiltunfaithfulnesssadismunrequited lovedyingmurder investigation (See All)
Mood:
rainneo noircar chase
Locations:
carelevatorapartmentsan francisco california
Characters:
writerpoliceserial killerdetectivepolicemanlove trianglelustpolice detectivepsychiatristalcoholic drink
Period:
1990s
Story:
talking while drivinghitchcockianbisexualityfemale killerdangeraccidentbisexualmale pubic hairvoyeurwoman on topfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditymale nudity β€¦sex scenekissbloodnudityviolencebare breastsbondagetwo word titlegunfemale rear nudityfemale full frontal nuditycigarette smokingdancingnippleslesbian kissleg spreadingchasesurprise endingpantiestopless female nuditylickingfondlingshot to deathunderwearshot in the headwatching tvundressingkissingsex in bedshootingbookbedcar crashinterrogationtelephonef wordsubjective cameracleavagebedroombraambushcaliforniatoplessdisguisestabbingdeath of friendwomancocainestabbed in the chestfemale pubic hairscantily clad femalehit by a carcontroversypolice officer killedfemme fataleconfessionsmokingauthorblack pantiesmini skirtmoaningreadingopening action scenefemale full rear nuditymanipulationfemale removes her clothestragic eventsuspicionmurdererfirst partkissing while having sexcult directorblood spatterbralessstrong female characterpizzagirl in pantiestopless womaniceidentityno pantiesdesirenipples visible through clothingbeer drinkingsexual attractionloss of loved oneaccidental deathblockbusterpsychologiststrong female leadrock starsexual desirebarefootrear entry sexcynicismpartnerstabbed in the necknipplenovelistpanties pulled downperversiondeceitsuspectdark pastclassmatedead woman with eyes opengunfireframed for murderexhibitionismfemale female kissbisexual womanpsychopathic killerhairpromiscuous womannovelmental breakdownmini dressdrunken manskirtgun held to headlegsfemale psychopathconsensual sexmind gameexhibitionistbeach housewrathcowgirl sex positionmurder suspectlook alikeorchestral music scorefatal attractionmurderessstabbed in the facehiding under a bedbreastcaressfilm starts with sexwoman smokerwhite dresswoman undressingcriminal investigationdying during sexdeath of loversexual obsessionextreme close uptear on cheekdying wordsfemale writerbudweiserstairwellgirlfriend girlfriend relationshipclothes rippingwoman moaning from pleasurekilled during sexwoman moaningmoaning womanwoman kills manborderline personality disorderrearview mirrorsex act reflected in mirrorbutt nakeddiscothequefemale serial killernaked buttwoman's bare buttvillainess played by lead actresssmoking in bedfemale star appears nudekilled in an elevatorcult movie castfemale psychiatristsmoking after sexman and woman in bedwatching a movie on tvbourbonice picksan francisco bayshot with a gunnorth american gialloprovocationromantic obsessionpuddlenude man murderedjack danielsmultiple stabbingsblouse rippingice blockchilinarcissistic personality disorderpolice psychologistpsychiatric evaluationinquestkey ringwoman changing clotheslesbian stereotypelotusmale star appears nudefemale psychologistplaying chickenreal tv show shown in fictional situationhidden weaponreal movie shown in fictional situationblood on backcop having sex with suspectfalse endinglipstick lesbianpolygraph testspurned malestabbed with an ice pickreference to jack danielsspurned manpicasso paintinggraduation photographhanging up without saying goodbyeattacked in an elevatorblond wigocean front housepanties ripped off (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Bad Education (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bad Education (2004)

In the early 60s, two boys - Ignacio and Enrique - discover love, movies and fear in a Christian school. Father Manolo, the school principal and Literature teacher, both witnesses and takes part in these discoveries. The three characters come against one another twice again, in the late 70s and in 1 β€¦980. These meetings are set to change the life and death of some of them. (Read More)

Subgenre:
gay interestcoming of age
Themes:
fearreligiondeathmurderlovefriendshipblackmailsexualityunrequited loveeducationtransgenderfirst love
Mood:
neo noirreligious
Locations:
schoolchurchswimming poolspaincatholic churchcatholic schoolreligious school
Characters:
catholicgay kissmother son relationshipchildrenbrother brother relationshipteachergay sexactorpriesttranssexualchristianitydirectorprofessorfathercatholic priest β€¦parent child relationshipboyfriend boyfriend relationshipsex with a priestevil priestboy singer (See All)
Period:
1960s
Story:
white briefshitchcockianmale underwearmale pubic hairmale nuditymasturbationflashbackbare chested maleunderwater scenebuxomfilm within a film β€¦witnessreunionunderwaterheroinlgbtdrag queenwhat happened to epiloguedesiresexual abusedrug abusegay lead charactermovie theatreliteraturejunkieyoung loveboarding schoolfilm actormale objectificationlightercatholicismtransvestismsexual frustrationsexual repressionscreenplaysexual identitysexual obsessionmultiple time framespersonal assistanttranssexualityhostelloss of innocencelife and deathsexual favorloss of faithmovie businessstory within a storypederastyman boy lovehebephilia (See All)

Crash (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Crash (1996)

Since a road accident left him with serious facial and bodily scarring, a former TV scientist has become obsessed by the marriage of motor-car technology with what he sees as the raw sexuality of car-crash victims. The scientist, along with a crash victim he has recently befriended, sets about perfo β€¦rming a series of sexual acts in a variety of motor vehicles, either with other crash victims or with prostitutes whom they contort into the shape of trapped corpses. Ultimately, the scientist craves a suicidal union of blood, semen, and engine coolant, a union with which he becomes dangerously obsessed. (Read More)

Subgenre:
independent filmcult filmerotic thriller
Themes:
insanitydeathsurrealismmarriageinfidelityadulteryextramarital affaircorruptionobsessionunfaithfulnesssexualitysadismapocalypsemadness
Mood:
gore
Locations:
hospitalcarairplaneairportsex in carsex in publicsex in chair
Characters:
gay kisshusband wife relationshiphomosexualtattooprostitutelust
Story:
bisexualityconvertibledangeraccidentbisexualvoyeurbased on novelfemale nuditysex scenebloodmasturbationkissviolence β€¦one word titledogbare chested malefemale rear nudityfemale full frontal nuditycigarette smokingfingeringtitle spoken by characterlesbian kissleg spreadingpantieslabiafondlingcar accidentthonglingeriecar crashsex standing upcleavagefemale pubic hairscantily clad femalecontroversypainbinocularsblack pantiesmini skirtactor shares first name with characterscarhairy chestautomobilecult directordesiresexual attractiondysfunctional marriagesadomasochismsexual desireunfaithful wifesex talkmovie setperversionbalconyfemale doctorcaneattractionloss of husbandreckless drivingunfaithful husbandpervertpromiscuous womangerman shepherdmovie producertrafficbitternesssexual perversionsexual violencefemale genitaliamasochismdegradationcar washporschesexual obsessiondepravitycar salesmantrophy wifecar wreckdebaucherytattooingsexual sadismsexual crueltyhangarburning carreference to james deanlegviolent sexsuicidal tendencyparaphiliadeviant sexpessimismaccident victimreference to grace kellypainful sexdegenerationstock market crashspooning sexual positionhandicap sexblurred boundariesreference to jayne mansfieldsilk stockingsalienated sexualitymutual consent (See All)

The Holy Mountain (1973) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Holy Mountain (1973)

A Christlike figure wanders through bizarre, grotesque scenarios filled with religious and sacrilegious imagery. He meets a mystical guide who introduces him to seven wealthy and powerful people, each representing a planet in the Solar system. These seven, along with the protagonist, the guide and t β€¦he guide's assistant, divest themselves of their worldly goods and form a group of nine who will seek the Holy Mountain, in order to displace the gods who live there and become immortal. (Read More)

Subgenre:
cult filmexperimental filmabsurdismabsurd comedycult classic
Themes:
fearreligiondeathsurrealismdrugsmoneylesbianismdrinkingdrunkennessdancetheftbrutalitydrug usepoetryexecution β€¦greedblindnessrevolution (See All)
Mood:
goresatireavant gardebreaking the fourth wall
Locations:
cemeterybarhelicoptersnowboatbathtubbuswheelchairshipmexicotunnelsex in car
Characters:
catholichomosexualityhusband wife relationshiphomosexualfather son relationshippolicemother son relationshipchildrentattooprostitutesoldieraliendancerbabypriest β€¦thiefreference to godchristianityjewsecretarywriter directordeafnessactor director writerreligious iconreligious statueself delusionsex robot (See All)
Story:
crucifixioncastrationscissorsspidercrossmale pubic hairbare buttmale full frontal nudityfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditymale nuditybloodkiss β€¦masturbationsexnudityviolencebare breaststhreesomedogbare chested malegunfightfemale full frontal nuditydancingexplosionpartyknifethree word titlefirevoice over narrationlickingbeatingcorpsetesticlesfoodhorsemirrorurinationshotguncomputercameradrinkswordundressingmaskshootingvomitingriflebombbedmarijuanabathroompianodemonislandreference to jesus christguitaralcoholstripperold manaxemassacremountaincocainetoiletfemale pubic hairweaponsnakenunbirdcoffinfictional wargarter beltritualjourneygraveyardcigar smokingdrowningtransformationpublic nuditylimousinetreeclownspiritualitystripteasefactorywritten and directed by cast membermassagestatuedirected by starbodyguardpresidentgovernmentrock 'n' rollhorse ridingpigchickensevered armflowerpoetwhippingdismembermentfull frontal nuditytransvestitecircusoccultgoldgrenadenipples visible through clothingwarehouseballoonlooking at oneself in a mirrorcakequesttouristarchitecturecomic bookhelmetelephantmagicianmousecrucifixdemonstrationtoyplanetbarefoot malefrogproduced by directorskullgoatfemale warriorgas maskguarddwarfabsurd humorpillshippiedrummerimmortalityrowboatsculpturedead childbathingmeditationfascismtigercanebarefoot femaleexistentialismsevered legchaintripwritten by starsymbolismmannequinteleportationchauffeurcamelceremonymale objectificationearphonescandyjudaismapparitionmysticismmummyfountaindead animalmusclemantowercrutchesvery little dialoguefemale genitaliaamputeebroken mirrordrumseagullgoldfishlsdtaking a bathnihilismfactory workercellobayonetfinger cut offmushroommanuscriptperuchimpanzeefeatherrainbowsitting on a toiletpolygamydance sceneritedead birdknittingfiring squadsurrendertoy gundogfightenlightenmentmattresspsychotronic filmaltardicephobiagurumountain climbingbanquetbreaking a mirrorcasketmars the planetthronedovevulturepilgrimageblasphemybody paintbuddhaloinclothmodern arttoadinitiationexcrementgold cointarantulatarotlambtumorsolar systemsanta claus suitcrossing selfzenhermaphroditehand kissingcadaverprocessionray gunanimal sexmarchingalchemybiblical referencegreen hairmohawk haircutcarrying someoneeunuchfalconleg bracegas chamberhippopotamusstrong sexual contentburning moneymidnight moviejaguarman dancing with manglass eyepsychedeliapythongeeseproduced by actorlaxativehair dyeice sculptureroman soldierstarfishmale bare butthead shavingpelicanseven deadly sinschameleoninvented languagemarketplacestoningalchemistmayanoverweight manchrist figurechief of policeslideshowmagic actwashing someonejupiter the planetspiritual journeywashing feetlima perusex in limousinemenorahsaturn the planetprosthetic body partbook of the deadhall of mirrorsoxboa constrictorlederhosencracked mirrorpeg legtoy factoryperuviantoy horsechamber potvenus the planetgold nuggetmale star appears nudepluto the planetexplicit nuditymale secretarynothingnessfan dancerpantheonfrontal nudityexotic animalneptune the planetwashing someone's feetmultiple amputeeuranus the planetman in a bathtubmating animalsmouse costumebreathing tubeglyphlever action rifle (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Name Of The Rose (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Name Of The Rose (1986)

1327. After a mysterious death in a Benedictine Abbey, the monks are convinced that the apocalypse is coming. With the Abbey to play host to a council on the Franciscan's Order's belief that the Church should rid itself of wealth, William of Baskerville, a respected Franciscan friar, is asked to ass β€¦ist in determining the cause of the untimely death. Alas, more deaths occur as the investigation draws closer to uncovering the secret the Abbey wants hidden, and there is finally no stopping the Holy Inquisition from taking an active hand in the process. William and his young novice must race against time to prove the innocence of the unjustly accused and avoid the wrath of Holy Inquisitor Bernardo Gui. (Read More)

Subgenre:
conspiracyperiod dramamurder mystery
Themes:
mysterious deathfearreligiondeathmurderlovefriendshipsuicidetortureinvestigationsupernatural powerpovertyfaithexecutionapocalypse β€¦wealthdevilmurder investigationthe devil (See All)
Mood:
poetic justice
Locations:
cemeterychurchsnowbathtubitalyfrancecavetunnelcatholic church
Characters:
catholichomosexualityfriendserial killerdetectivepriestartistreference to godchristianitylustbiblewitchfrenchself flagellationreligious fervor β€¦suicide by poisonsuicide by jumping out a window (See All)
Story:
reference to the virgin marycrossaccidentbare buttwoman on topmale frontal nuditymale rear nuditybased on novelfemale nuditymale nuditysex scenebloodkissflashbackfemale rear nudity β€¦fightfemale full frontal nuditynipplessingingchasefirevoice over narrationcorpsemirrorcatsecretfalling from heightbookdead bodyreference to jesus christprayerold manimpalementtoiletfemale pubic hairfalse accusationtrialpainterforeign language adaptationtonguegraveyarddrowningfive word titleconfessiongravelibrarypoisonwitnesspigratchickeneuropemonkeyeyeglassesitalianmousewitchcraftblockbusterjumping from heightskulltorchmonkdebatecensorshipdwarfresearchmiracleprophecyreference to satanlostlaughtersuperstitionthrown through a windowmedieval timesautopsyfogblind manhorse and carriageshowtranslatorspittingdonkeypeasantpopegreekmonasteryfoxpaintdoubttowertemptationlibrarianhead bashed instablebishopcluecodepersecutiontitle same as bookmultiple murdermiddle agesblack catsaintmagnifying glassdeath by drowningman on firetrapdooraltarsecret passagemassrichantichristbludgeoningplant in titlepoorvulturesecret roomhunchbackmaterialismsex on the floorreference to the devilmedievalchantinglabyrinthchurch bellglovepick axemissionary positionreference to the book of revelationinquisitioninksatanic ritualconundrumeunuchorderbook burningsexual favorfalse confessionreference to aristotleburned at the stakechantbiblical quotebattering ramgay for paynameless charactercalligraphyflower in titledeath by impalementpoisonedbludgeoned to deathheresyabbeycensorreference to the popeobediencenovicenorthern italy14th centuryhereticambiguous titledrowning in a bathtubexcommunicationtorture deviceseminarytribunalquestion and answerreasonvirtue1300sarseniccatacombsdeath by poisonpyreflagellationsouthern franceabbotpushed off a cliffsatan worshipherbalistwalking backwardspoisoned to deathcipherfaith in godinscriptionfranciscanholinesssecret entrancecorporeal mortificationlemon juiceredistribution of wealthreference to saint francis of assisiavignon francebibliophiliaflagrante delictoforbidden bookhidden staircasereference to ecclesiastesshoeprintdispensarylatin phraseparchmentpig penreference to virgilbenedictinecopiertithevow of povertyword of godblack spotbutchering pigpage turnerrecantationreference to ovidreference to st. thomas aquinas (See All)

The Great Beauty (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Great Beauty (2013)

Journalist Jep Gambardella has charmed and seduced his way through the lavish nightlife of Rome for decades. Since the legendary success of his one and only novel, he has been a permanent fixture in the city's literary and social circles, but when his sixty-fifth birthday coincides with a shock from β€¦ the past, Jep finds himself unexpectedly taking stock of his life, turning his cutting wit on himself and his contemporaries, and looking past the extravagant nightclubs, parties, and cafes to find Rome in all its glory: a timeless landscape of absurd, exquisite beauty. (Read More)

Themes:
writingreligiondeathsurrealismlovefriendshipsuicidedrugsmoneydrinkingweddingfuneralartvoyeurismmemory β€¦divorceobsessionpovertygriefyouthfaiththeatredeath of wifewealthmadnessfirst love (See All)
Mood:
satirerainnight
Locations:
beachchurchswimming poolnightclubelevatorwheelchairurban settingseaitalyshipstrip clubmuseumsuicide by car
Characters:
catholicwriterhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerboyprostitutegirldanceractorpriest β€¦artistactresslittle girllittle boyself portraitfacial tattoo (See All)
Period:
2010ssummer
Story:
white briefsbriefsmale underwearcrossmale pubic hairbare buttmale full frontal nudityfemale frontal nuditymale frontal nudityfemale nuditymale nuditykisssexbare breastsflashback β€¦dogbare chested malefemale full frontal nuditycigarette smokingdancingphotographtitle spoken by charactersingingpartytelephone callvoice over narrationcryingcell phonesongfoodslow motion scenewatching tvdrinkarrestundressingbikinipaintingbookliesunglassesbirthdayguitarriveralcoholstripperf wordsubjective cameraswimmingjournalistcandlemontageeatingcocainenonlinear timelineapologynunno opening creditscoffinbirthday partyunderwater scenecontroversyold womanparktheaterskinny dippingmicrophonespiritualitykeyliarchampagnefugitiveumbrellapassionstatuescene during end creditsdisappearancedeath of sonsadnessgardenmagical realismpoetreference to william shakespearetrustheroinsurgeryeyeglassesitalianapplausefemale stockinged legsteatouristrome italyjoggingroyaltyagingguitaristgossipswimsuitwatching televisiondwarflandscapeboxer shortsold agemourningliteraturedespairsculpturechoirbenchwedding receptionlighthouseplastic surgerypaintsnorting cocaineshipwreckjazz musiceditor14 year old18 year oldlatingiving a toastcruise shiphammockpark benchsorrowoverhead camera shottricksaintsleeplessnesskiss on the cheekvaticangiraffehigh societyreference to the devilwater fountainoverhead shotexorcistbaroquehappy birthdaybegins with textillusionistnobilitycardinal the priestcountesshand kissinggenitaliaromaart collectorcountmarxismmagic showmisanthrope20 year oldpeepholemariachi bandeurocommunist partyflamingoreference to dostoyevskysleeping on the floorart exhibitdead daughterbotoxalmost hit by a carvagina sluraqueductburkachinese manreference to marcel proustjapanese touristknife throwerpallbearerintelligentsialawn partynothingnessopening creditsconga linetourist guidewashing one's face60 year oldreferring to oneself in the third person42 year olddisappearing actla dolce vitaplaywritingsleeping on a park bench65 year oldreference to gustave flaubertreference to milan italyreflection in a glass doortiber rivervow of poverty69 year oldcolosseum romelegs crossed (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
lgbt horrorparanormal phenomenacult filmsupernaturalparanormalslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasycult classichorror b movie
Themes:
mysterious deathfeardeathsurrealismmurderfriendshiprevengekidnappingghostescapemonstervoyeurismpsychopathbrutalitysupernatural power β€¦paranoiasadismevilpanicshower murder (See All)
Mood:
nightmaregorerainhigh schoolslasherdarknesspoetic justice
Locations:
barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
family relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacher β€¦girlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
white briefsbriefsmale underwearconvertiblevoyeurbare buttdreammale rear nuditymale nuditybloodcharacter name in titlenuditynumber in titleviolencesequel β€¦bondagedogbare chested malefightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinisunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiarygymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countcellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shouldermoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hunger (2008) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hunger (2008)

Hunger follows life in the Maze Prison, Northern Ireland with an interpretation of the highly emotive events surrounding the 1981 IRA Hunger Strike, led by Bobby Sands. With an epic eye for detail, the film provides a timely exploration of what happens when body and mind are pushed to the uttermost  β€¦limit. (Read More)

Themes:
religiondeathmurdersuicidepoliticsprisontorturememorybrutalityterrorismhumiliationillnesssadismexecutioncruelty β€¦dyingfreedompolice brutalitystarvation (See All)
Locations:
snowbathtubbuswaterprison hospital
Characters:
catholicfamily relationshipsfather son relationshipmother son relationshipdoctorbrother brother relationshipboybabypriestbiblecatholic priestprison officer
Period:
1980syear 1981
Story:
eyebriefsscissorshaircutcrossmale pubic hairbare buttmale frontal nuditymale rear nuditymale nuditymasturbationbloodkissnudityviolence β€¦one word titleflashbackbare chested maleguncigarette smokingphotographtitle spoken by charactercryingbeatingunderweartesticlesfoodmirrorshot in the headpunched in the faceundressingmaskshootingvomitingtearsrunningbathroomjailhallucinationreference to jesus christriverf wordterroristmontageeatingprisonerdrivingbirdcontroversyold womanlatex glovespaingunshotprologueprotestlocker roomuniformstorytellingsuitcaseflowerslong taketragic eventratirelanddirectorial debutriotwhat happened to epiloguehead butthypodermic needlevandalismcrucifixdemonstrationbeardswat teamcovered in bloodirishbreakfastbarefootshieldprison guardbloody nosesufferingboxer shortssmugglinghungercigarette lighterblack eyeprison cellsnowinglooking at self in mirrorchildhood memorymain character diesspittingoppressionyellingbodyspit in the facehead woundlockervery little dialogueshoutinglistening to a radiourinehead injuryurinalnursing homeprison visitgurneypolitical prisonercontrabandclothingmartyrradio newssurrenderfreedom fightermassdeathbednegotiationnorthern irelanddressingdeterminationstarvingrunnerblanketchantingends with textexcrementpassing outpolitical protestbegins with textburnhand injuryirish republican armyemaciationcell mateconvulsionreference to the bibleirahospital visithunger strikesinkeye injuryworryingpolice vanhand woundpolitical criminalends with deathhandspeepholemale with long hairfly the insectbody mutilationfilthcrossing oneselfrolling a cigarettefacial injuryurine samplebedsheetbritish government28 year oldbody searchcavity searchbritish parliamentdisinfectanthuman excrement27 year oldmaggotstinfoilmargaret thatchernorthern irishmandistorted soundrectal examstarving to deaththe troublescross country runningback scarbelfast irelandfood traypolice batonriot gearriot squadsweeping a floortrashing a roombody sore (See All)

Kalifornia (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β€¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
independent filmcult filmpsycho thrilleramerican horror
Themes:
writinginsanityfeardeathmurderkidnappingrapetorturetheftpsychopathsadismevilphotographymurder of a police officerrape and murder
Mood:
goreneo noirslasher
Locations:
barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
writerpoliceboyfriend girlfriend relationshiphostagewaitresskillervillainterrorslasher killerchinese foodserial murderershooting a police officer
Story:
graphic violencemale underwearcrossbare buttmale rear nudityfemale nuditymale nuditybloodsexnudityviolenceone word titlebare chested malegunfight β€¦cigarette smokingphotographtitle spoken by characterpistolshot to deathblood splattercar accidentshot in the chesturinationshot in the headshotgunbeerdead bodysex standing upgay slurjournalistcaliforniastabbed to deathnarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilemurdererkillingarsonmaniactape recorderragemutilationstabbed in the stomachpsychovictimrape victimrapistrampagerednecktensionstabbed in the throatgash in the facedark humorbutcherblack brabilliardsperversionrainstormbody countsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertserial murderpsychopathic killerbad guymadmankillpistol whiphuman monsterpolice officer shot in the chestsexual violencehomicidal maniacknocked unconscioushillbillyyuppietrailer parkwhite trashcactushit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendlunaticsadistic psychopathmass murdererbreaking a bottle over someone's headbutcherycrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistpsycho terrorexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

Weekend (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Weekend (2011)

On a Friday night after a drunken house party with his straight mates, Russell heads out to a gay club, alone and on the pull. Just before closing time he picks up Glen but what's expected to be just a one-night stand becomes something else, something special. That weekend, in bars and in bedrooms,  β€¦getting drunk and taking drugs, telling stories and having sex, the two men get to know each other. It is a brief encounter that will resonate throughout their lives. Weekend is both an honest and unapologetic love story between two guys and a film about the universal struggle for an authentic life in all its forms. It is about the search for identity and the importance of making a passionate commitment to your life. (Read More)

Subgenre:
gay interest
Themes:
friendshipdrugshomophobiagay love
Mood:
nightone night
Locations:
train stationbartrainswimming poolnightclubenglandgay bartwo on a bicycle
Characters:
homosexualitygay kisshomosexualfriendgay sexartistgay relationship
Story:
white briefsbriefsmale underwearmale pubic hairmale full frontal nuditymale rear nuditymale nuditykissmasturbationsexnudityone word title β€¦bare chested maleejaculationpartytelephone callunderwearundressingmarijuanagay slurorphancocainetoilethousebirthday partyconfessioncoming outhairy chestgay couplelgbtfriendship between mentape recorderworking classone night standclubcarnivalbarefoottext messaginggay romancejointgay clubhouse partyweekendawkward situationdialogue drivencruisingundressing someonehappy birthday to youintimacymale in bathtubtext messagetramfoster childfoster homesaying goodbyefear of commitmenthigh risecuddlingparaphiliatwister the gameaspiring artistman in bathtubnottingham englandreference to ikeabrief encountergoing away partyreference to oliver twisthash pipegay man straight man relationshipheteronormativitynottingham (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Clockwork Orange (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Clockwork Orange (1971)

Protagonist Alex DeLarge is an "ultraviolent" youth in futuristic Britain. As with all luck, his eventually runs out and he's arrested and convicted of murder and rape. While in prison, Alex learns of an experimental program in which convicts are programmed to detest violence. If he goes through the β€¦ program, his sentence will be reduced and he will be back on the streets sooner than expected. But Alex's ordeals are far from over once he hits the mean streets of Britain that he had a hand in creating. (Read More)

Subgenre:
cult filmcoming of ageblack comedydystopiapolitical satire
Themes:
writinginsanitysurrealismmurderfriendshiprevengesuicidedrugsrapebetrayalpoliticsprisontorturedrunkennessdeception β€¦robberypsychopathbrutalityredemptionsexualityillnessmental illnesssadismhome invasiondeath of wifehomelessnesspolice brutalitynear death experience (See All)
Mood:
satireneo noiravant gardeambiguous ending
Locations:
hospitalbarrestaurantchurchsnowmotorcyclebathtubnightclublondon englandwheelchairapartmentpolice stationwater torturesex in the snow
Characters:
writerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipteenagerdoctorpolice officernurseactorpriestlustpsychiatrist β€¦biblehomeless manpolice sergeantsex with a nurse (See All)
Period:
world war two1990sfuturenear future
Story:
white briefseyecrucifixionconvertiblemale pubic hairvoyeurbare buttdreammale frontal nuditymale rear nudityfemale nuditybased on novelmale nuditymasturbationblood β€¦violencethreesomeinterviewbare chested malefemale rear nudityfightfemale full frontal nudityphotographsingingknifeleg spreadingthree word titlesurprise endingvoice over narrationfondlingbeatingfistfightcar accidentslow motion scenepunched in the facecatarrestundressingbrawlsex in bedfalling from heightmaskriflecar crashinterrogationhandcuffsbritishreference to jesus christcolor in titlecriminalreportersubjective cameracleavagejournalistbound and gaggedwinegangdisguisemansionmontagethroat slittingbridgesuicide attemptprisonerpoliticianfemale pubic hairtied to a chairsnakewhite pantiesno opening creditsanti heroscantily clad femaledouble crosscontroversypublic nuditylibraryauthorblack pantiesbeaten to deathstabbed in the backlocker roomwidowerattackfantasy sequencecharacter's point of view camera shotstatueevil manknocked outkicked in the facebaseball batlightningscreamattempted rapepranklong takemanipulationbodyguardinjectionfemale removes her clothesneck breakingpremarital sexthreatened with a knifecult directortypewriternewspaper headlinesexual fantasyexperimentelectronic music scorereference to adolf hitlerhypodermic needleheavy raintape recordersociopathcomared dressloss of loved onesex on floorkicked in the stomachmovie theaterblockbustereccentricwristwatchclassical musicclubirishrape victimmind controlrapistmilkstreet lifesocial commentarythugyogawoman in jeopardyreverse footageprison guardstealing a carministerhatredpool tabletitle appears in writingsculptureblack and white scenetime lapse photographypunched in the chestrivalbilliardsgang rapeaccidental killingfascismrainstormalternate realityhomoeroticismfemale doctorcanesocial workerpublic humiliationgrowing uprelease from prisonsexual assaultjuvenile delinquentalienationpolice inspectorsports carmoral dilemmairreverencefast motion scenedrugged drinkhit with a baseball batclose up of eyespervertchocolatevillain played by lead actorface maskbrainwashingforced to stripspit in the facemisogynistbeggarmini dressreference to the beatlesgovernorweightliftinganarchynihilismstrait jacketcrashing through a windowimmaturityvolunteerrehabilitationaudio cassettebritainfight the systemanarchistexperiment gone wrongfamous scorewet t shirtfisticuffsancient romecureharempsychological torturegang membercockney accentimprovised weapongang leaderspaghettimurder of a nude womanprison wardenfamous linejerkbreaking a bottle over someone's headclimbing out a windowsocial decayattempted robberycrime spreerecord storefemale journalistred wineslow motion action scenereference to ludwig van beethovenlibertymarinacult figureflirtationfamily abandonmenthuman experimentationman fights a womandebaucheryvicarspiked drinkconcert hallsex crimedehumanizationabsurd violenceanti socialpopsiclesubliminal messagebreakfast in bedhoodlumslangreference to draculafemale psychiatristpixelationgrand theft autobeethovenmultiple loverspsychological tormentphalluscountry homebowler hatlasciviousnessfilm with ambiguous titlegovernment officialenglish countrysideinvented languagered pubic hairwaking up from a comapolitical manipulationhanged childextreme filmflick knifereference to pink floydchild executioneye dropsyouth ganglong underwearclothes torn offshock therapywilliam tell overturecenturionjoyridegraphic nuditypet snakecat ladymanservantdriving in the wrong directionforced to watch rapeholding someone's head underwaterludwig van beethovenmilk bottleunprovoked violencehidden weaponsexual imagerynose bandagecensored rape scenetesticles squeezedwife raped in front of husbandclothes cut offerotic 70struncheonultraviolenceaversion therapybottle smashed over someone's headgang brawltorn pantieslistening to classical musicmoral reformationobjectified womanmen beating defenseless manreformed (See All)

Swimming Pool (2003) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Swimming Pool (2003)

Sarah Morton is a famous British mystery author. Tired of London and seeking inspiration for her new novel, she accepts an offer from her publisher John Bosload to stay at his home in Luberon, in the South of France. It is the off-season, and Sarah finds that the beautiful country locale and unhurri β€¦ed pace is just the tonic for her--until late one night, when John's indolent and insouciant French daughter Julie unexpectedly arrives. Sarah's prim and steely English reserve is jarred by Julie's reckless, sexually charged lifestyle. Their interactions set off an increasingly unsettling series of events, as Sarah's creative process and a possible real-life murder begin to blend dangerously together. (Read More)

Subgenre:
erotic fantasyerotic thriller
Themes:
writingsurrealismdeathmurderinfidelitydrugsmoneyjealousydrinkingdanceseductionobsessiondeath of mothersexualitycruelty β€¦dyingfalling in lovepolice investigation (See All)
Mood:
rainnightambiguous ending
Locations:
restaurantswimming poolmotorcyclebathtublondon englandwaterairportvillagecastlesex in a swimming poolsex in pool
Characters:
writerpolicefather daughter relationshipmother daughter relationshippolicemanlustolder man younger woman relationshipself discoverycheating girlfriend
Story:
speedobisexualitymale underwearvoyeurwoman on topfemale frontal nuditymale rear nudityfemale nuditymale nuditysex scenekissbloodmasturbationflashback β€¦two word titlefemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplesknifesurprise endingerectionpantiestelephone callfondlingunderwearsex on couchfoodblondecomputerdrinkbikinisecretbooksunglasseslingeriebeddead bodycafemarijuanabathroomswimmingcleavagebedroombraaxefemale pubic hairsubwayscantily clad femalefemme fatalecigar smokingskinny dippingpublic nuditystrippingmini skirtpassionvacationmoaningcover updiarysensualityscarcountrysidelaptopsleepingpubsexual fantasywaiterteen angstdesirecrucifixtowelwatching televisiondwarfshovelnovelistblack eyesexy womandark pastcasual sexmidlife crisisexhibitionismsunbathingwoman in bathtubnude swimmingcannabispromiscuous womanpublisherskirteditorrepressiongardenervillaforeignerexhibitionistwriter's blocknymphomaniacsurrogate mothereating disordercaressdigging a graveenigmaclothes rippingbilinguallawn mowernude sunbathingwheelbarrowenglishwomanmysterious pastfantasy becomes realityrebellious daughterambiguityfrenchwomansidewalk cafedrunken sexhit on the head with a rockpool cleanerdangerous friendlifting up dressgownburning evidencewet suitbistrospeaking frenchmystery writercrime writerdestroying evidenceinhibitionswim suitearplugreference to the marquis de sadeluberon (See All)

Quills (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Quills (2000)

The infamous writer, the Marquis de Sade of 18th Century France, is imprisoned at Charenton Insane Asylum for unmentionable activities. He manages to befriend the young Abbe de Coulmier, who runs the asylum, along with a beautiful laundress named Madeline. Things go terribly wrong when the Abbe find β€¦s out that the Marquis' books are being secretly published. The emperor Napoleon contemplates sending Dr. Royer-Collard to oversee the asylum, a man famed for his torturous punishments. It could mean the end of Charenton and possibly the Marquis himself. (Read More)

Subgenre:
independent filmsteampunkperiod piece
Themes:
writingmurderinfidelityrapeadulteryprisontorturesexualityhumiliationsadismcrueltymadnessfrench revolutionpriest in love
Mood:
gore
Locations:
paris francefrancewater well
Characters:
writerhusband wife relationshipdoctorpriestlustmaidevil doctor
Period:
19th century18th century
Story:
castrationscissorsbisexualmale pubic hairbare buttmale frontal nuditymasturbationbloodsexnudityone word titlebondage β€¦title spoken by charactersingingbased on playfirecorpseface slappaintingdecapitationtoplesssevered headnundream sequencevoice overvirginpassionattempted rapelong takestagewhippingdominationtransvestitepornographybuttockseccentricgossipsadomasochismcrying mancensorshiphypocrisyperversionhomoeroticismhorse and carriageasylumbeheadinglaundrynecrophiliaspit in the facecorporal punishmentconventemperorstage playinsane asylumfight the systemchainedatheismdecadenceguillotinedepravitypaperexcrementstagecoachsevered tongueexecutionerempire fashiontheater troupe1790slibertinechild bridechastitygrand guignolnapoleonquillsexual deviantpyromaniahuman excrementpet birdregency periodmarquis de sadeplay within a playsex degeneratewrongful commitmentquill penforbidden booknapoleonic eravow of chastity (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Blow Out (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blow Out (1981)

This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β€¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)

Subgenre:
independent filmcult filmconspiracyb horrorpsycho thrillerpolitical thrilleramerican horrorpolitical conspiracy
Themes:
deathmurderpoliticstorturefilmmakinginvestigationpsychopathparanoiaguiltsadismsurveillanceevilexploitationtechnologyclaustrophobia
Mood:
neo noirnightslasher
Locations:
train stationhospitaltrainsnowcityrooftoppennsylvaniacar in water
Characters:
doctorprostituteserial killerdetectivephotographerhitmankillervillainslasher killerserial murderermurder of a prostitute
Period:
1980swinter
Story:
white briefsgiallo esquehitchcockianbriefsmale underweardangervoyeurwoman on topfemale frontal nudityfemale nuditynuditybare breastsflashbacktwo word titlebare chested male β€¦guntitle spoken by characterknifechasesurprise endingshowercar accidenturinationrescuewatching tvlingeriealcoholtelephonereportercleavageassassindisguisebridgestabbed to deathpoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessmurdererfireworkscult directorgraffititrustkillingmaniactape recorderrecordingmutilationcaught having sexcrying womanmovie theaterphone boothpsychofroggrindhousevictimparadedead womanwatching televisionrampagewoman in jeopardydamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbody countcharacters killed one by onedead woman with eyes openkilling spreereckless drivingpsychoticpolitical corruptionpsycho killerfilm industryinterrupted sexserial murderpsychopathic killerbad guymadmantruthsubway stationtelevision newsblackoutmotel roomhomicidal maniacrestroomgovernortv reporterslashingwhodunitcarnageemergency roompresidential electionwoman in lingerienewscasttragic endingpresidential candidateenigmafemale victimstrangled to deathsadistic psychopathtapepsychotronic filmmurder spreetelevision reporterdisturbed individualbroken bottlegrindhouse filmwiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepydisturbingred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutesadisticaudio recordingdrive in classicwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All)

The Final Destination (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Final Destination (2009)

In a car race in McKinley Speedway, twenty-something Nick has a premonition of a deadly car crash with many casualties in the audience and convinces his girlfriend Lori and his friends Hunt and Janet to leave the place. They are followed by the security guard; a racist guy; a mother with her childre β€¦n and a mechanic, that are saved from death. When the racist guy and the mother die in mysterious and creepy incidents, Nick and Lori research and find many similar cases in Internet. They try to lure The Reaper to break the chain of deadly events and survive, but destiny does not help them. (Read More)

Themes:
deathdrunkennessdeath of motherdeath of wife
Mood:
nightmaregore
Locations:
hospitalbathtubcar explosion
Characters:
mother son relationshipboyfriend girlfriend relationshipsecurity guard
Story:
salonpremonitionscissorsvisiondreamwoman on topfemale nuditybloodsequelflashbackbare chested malefemale rear nuditycigarette smokingexplosionsurprise ending β€¦firecell phoneblood splatterfalling from heightcar crashdecapitationimpalementsuicide attemptexploding carsevered headnews reportracial slurbinocularscharacter repeating someone else's dialogueperson on fireproduct placementfilm within a filmpremarital sexshot in the armobscene finger gestureburned alivecowboy hatfourth partmovie theatercrushed to deathfull moonmechanicredneckmovie theatreconstruction siteattempted suicide3 dimensionalshopping mallshoveldeath of protagonistdisembowelmentracistraised middle fingercharacters killed one by onetorso cut in halfcoffee shopcartoon on tvescalatormallconstructioncar washshot in the eyehit by a truckexploding truckwhistlingshot in the handhanged manaltered version of studio logotow truckreference to googlerepeated linebeauty salonwoman in a bikinicut into piecesmemorialrace trackno survivorsstabbed in the mouthtamponnail gunlawnmowerscrewdriverchihuahuacountry clubfreak accidenthanged by the necktalking during sexkorean war veteranthrowing a rockchain link fencelawn mowingcut in halfhorseshoegolfingpedicuresplashed with water3d glassescar flipfire sprinklerslip and falldrain3d sequel to 2d filmtooth knocked outdragged by a cartrapped in a carflipping a coinshort circuittable sawcar engineoverflowing bathtubhead crushedtrampledpit stoptalking during a movieblow outdeath by falling objecthit with a golf ballsawdustcollapsing scaffoldhit by an ambulancelucky coinpopping the cork (See All)

Love (2015) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Love (2015)

Themes:
drugsbetrayaljealousysexualitycheatingregret
Locations:
cemeteryparis francebathtubsex in showersex in toilettwo in a bathtub
Characters:
love triangleamerican abroadneighbor neighbor relationshipart studentcheating on girlfriend
Period:
2010s
Story:
cutting hairbisexualitymale pubic hairbare buttwoman on topmale full frontal nudityfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditymale nuditysex scenekissone word title β€¦bare breaststhreesomefemale rear nudityfemale full frontal nudityejaculationnipplestitle spoken by characterlesbian kisserectionpantiestopless female nuditypenetrationblondewritten by directorcondomsex in bedlingeriemarijuanasex standing upneighbormenage a troisf wordbratoplessvideo cameracocainefemale pubic hairnonlinear timelinewhite pantieschildsmokingspermfemale full rear nuditywaterfalleuropeteenage sextopless womantransvestitesex toybuttocksproduced by directorart gallerynaked womanbreakup3 dimensionalnippletitle appears in writingmale full rear nudityunsimulated sexcasual sexexplicit sexdirector cameofingering vaginasnorting cocaineswingerex boyfriendhangovershoutingstonedpolice interrogationtopless girlsex clubbreastfilm starts with sexopiumunwanted pregnancysex shopvoice over inner thoughtsbutt nakeddiscothequedanish blondenext door neighborwoman's bare buttnew neighborgazebosex with neighborsmoking after sexswingers clubstream of consciousnessman and woman naked in bedbroken promisecircumcised penisfrench flagpenis in mouthexplicit fellationipple lickingunwanted childlicking someone's nippleslicking nipplesthree in a bedphotographsbroken condomcutting off hairblow to the headflamengopsychotropic drug (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Wages Of Fear (1953)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wages Of Fear (1953)

In the South American jungle supplies of nitroglycerin are needed at a remote oil field. The oil company pays four men to deliver the supplies in two trucks. A tense rivalry develops between the two sets of drivers and on the rough remote roads the slightest jolt can result in death.

Themes:
feardeathfriendshipsuicidemoneydrinkingmemorytheftillnessdyingunemploymentstarvation
Mood:
rain
Locations:
cemeterybarrestaurantmotorcycleairplanewatertaxiairportvillagerural settingtruckjungleroad moviecanyontruck accident
Characters:
catholichusband wife relationshipfather son relationshippolicefrienddoctorchildrensingerbrother brother relationshipboypolice officerpolicemandancerphotographerthief β€¦tough guynative americanwaitressfrenchgermanamericanamerican abroaddrivertruck driversuicide by hangingself destructivenessgerman abroadreligious statue (See All)
Period:
1950s
Story:
talking while drivinghaircutspidercrossdangerfemale nuditybased on novelblooddoggunfightcigarette smokingdancingexplosionsinging β€¦knifesurprise endingshowertelephone callfirecryingsongcorpseunderwearurinationface slapcameradrinklettervomitingriflebeertearsrunningdead bodycafeprayerguitarriversubjective cameranewspapercookingcandlemountainbridgedrivingcigar smokingchampagneon the roadhangingsleepingmachismoitalianshavingjeeptouristguitariststealingdesperationstreet lifebroken legclockpassportwhiskeytensionexplosivebraveryconstruction sitespanishjob interviewhungerinsectdrummermedical examinationbribeoilcigarette lightercard playingdynamiteexistentialismsirenreckless drivingpipe smokingfirefighterpost world war twospittingdrifterbandageconstruction workercrutchesbeggarstreet marketbugforeignercoca colaharmonicadrumlatin americatraffic jamlistening to a radiosaloonwhistlingsense of smellcactusfeverauto mechanicsouth americahammockcorrupt officialdemolitionriskindigenous peoplebroken bottleloudspeakervultureleg injuryvenezuelaexpatriaterocking chairbeetlecowardicefuneral processionfired from a jobmosquitocigarette holdervisabrandydying younglemonadebreaking glassexhaustionlife and deathoil industrysuicide missionlegagonybar ownerends with deathcoin tossoil companycraterleprosytestosteronemalariaair baseflourcementpin upreference to al caponeoil wellsplashed with watercar damageeye bandagerolling a cigaretterecklessnessitalian abroadtankeroil fieldcrude oilfrenchman abroadsaved from hangingpetrolchampagne bottleoutdoor showerthermosvibrationcaracas venezuelaheadlightsoil pipelinestuck in mudshiveringexplosive devicemountain roadair stripfalling rockrisk takingstarving to deathnitroglycerinework accidentfinancial troublelast chancenitroglycerinoil leakrun over by a truckburropith helmetcorsairfoot woundtruck radiocalabria italycorsicanoil derrick (See All)

Antichrist (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Antichrist (2009)

A couple lose their young son when he falls out of a window while they are having sex in another room. The mother's grief consigns her to hospital, but her therapist husband brings her home intent on treating her depression himself. To confront her fears they go to stay at their remote cabin in the  β€¦woods, "Eden", where something untold happened the previous summer. Told in four chapters with a prologue and epilogue, the film details acts of lustful cruelty as the man and woman unfold the darker side of nature outside and within. (Read More)

Subgenre:
cult filmexperimental film
Themes:
writinginsanityfearsurrealismdeathmurderlovetorturefuneralnaturebrutalityobsessiondepressionguiltgrief β€¦mental illnessevilcrueltypanictraumamadnessmythology (See All)
Mood:
gorerainavant gardeambiguous ending
Locations:
hospitaltrainforestsnowwaterwoodssex outside
Characters:
writerhusband wife relationshipfather son relationshipmother son relationshiplittle boylustself mutilationcrying babyself cannibalism
Story:
psycho sexualscissorsbare buttdreamwoman on topfemale frontal nudityfemale nuditymale nuditysex scenemasturbationbloodkissnudityviolenceone word title β€¦flashbackfightfemale full frontal nudityfingeringejaculationphotographknifeleg spreadingerectionpantiesshowercryingunderwearpenetrationface slapslow motion scenepaintingbooktearsrunningbathroomhallucinationstrangulationvagina spreadingstabbingbridgeclitorisbirdcontroversypainstabbed in the backprologueknocked outdeath of childfull frontal female nudityflowersdeath of sonsadnesscharacter says i love youcabinsleepingtherapytalking animalfaintinghappinesswitchcrafttherapistaccidental deathpart of trilogyteddy bearladders&mwindpillssufferingresearchbackpackloss of sonhit in the crotchironydark humorfalling to deathanxietyshoveldespairhypnosismedicationsculpturereference to satanblack and white scenehit on the headautopsyatticdeersnowinglanternunsimulated sexdead woman with eyes openmisogynygendersymbolismcrowman cryingmotherhooddementiahysterianotebookminimal castcremationfoxwoman cryinghikingvery little dialoguepolaroiddiggingmasochismx rayspreadeaglecabin in the woodsnihilismloss of childepiloguehearsehit with a shovelbattle of the sexespsychotherapysorrowwashing machinechapter headingsgrassdead birdfilm starts with sexstrangled to deathangstsex in natureclose up of eyetheologyantichristpsychosisextreme close upleg woundpanic attackstabbed with scissorsreference to sigmund freuduncircumcised peniswrenchgenital mutilationbitingfuneral processiongrievingblack and white segues into coloronanismbiblical referencewoman strangled to deathcaught in the rainfalling out a windowbad motherworshipfemale star appears nudethesiscuttingburned at the stakemedical examinerheavy breathingman carrying a womannameless characterdeath by strangulationpiggy back ridestuffed animal toyanxiety attacktwo in a showertoilet bowlmad womanfemale genital mutilationfoot injuryhuman naturescissoringfalling treeskylightuxoricidechaptersgrieving motherisolated houseirrational behavioropera ariaambiguous titletoolboxinjured animaltarkovskyesqueacornantssymbol in titletwo handerinsane womanstatuettedragging someoneedenkilling a birdwanting to dieburning a dead bodyspilled drinkvoice over readingwomen's studiesgrieving fatherfuneral cortegerag dollfinal solutionman strangles womanoaksleeping on the groundfoot bridgepipe wrenchwater faucetdead treefawnabusive wifeexcisionwrapped in a blanketflushing drugs down a toilethand drillsex wearing a condomtremblingblack and white prologuefear of abandonmentgrieving parentcrawling on the groundsurviving griefbottomless womanclimbing up a hillthe color greencutting someonegrief therapygrindstoneburrowclitoridectomyfemale masturbation outdoorslaying on grassself genital mutilationsexual hysteriatalking fox (See All)

Species (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Species (1995)

In 1993, the Search for Extra Terrestrial Intelligence Project receives a transmission detailing an alien DNA structure, along with instructions on how to splice it with human DNA. The result is Sil, a sensual but deadly creature who can change from a beautiful woman to an armour-plated killing mach β€¦ine in the blink of an eye. Government agent Xavier Fitch assembles a team of scientists and mercenaries to locate and destroy Sil before she manages to find a mate and breed. (Read More)

Subgenre:
suspensefish out of watercreature feature
Themes:
mysterious deathmurderrapeescapemonstervoyeurismseductionbrutalityobsessionsupernatural powerparanoiaunfaithfulnesssadismabduction β€¦cruelty (See All)
Mood:
gore
Locations:
trainswimming poolhelicopterlos angeles californianightclubdesertwaterelevatorouter spacegas stationsewersex in a swimming pool
Characters:
girlalienhitmanbabe scientist
Period:
1990s
Story:
eyebisexualitybisexualvoyeurwoman on topfemale frontal nuditymale rear nudityfemale nuditymale nuditybloodkisssexfemale rear nudity β€¦female full frontal nuditytitle spoken by characterleg spreadingchasepantiesunderwearmirrorblondeundressingthongbedbathroomsciencescientistdecapitationbraassassinbound and gaggedexploding cartonguefemme fataleon the runstrippingscreamingfugitivepassionopening action scenesensualitychildbirthkissing while having sexdominationdesiresexual attractionvillainessone night standrape victimsexual desirereverse footagesevered fingermercilessnessbroken glassstabbed in the headdead mangasolineattractionsexual assaultroomflamethrowergovernment agenttelepathydead girlblonde womanworld dominationdnaexperiment gone wrongpsychic powerpart computer animationgeneticsbagcloningdying during sexsexual obsessionregenerationwoman initiating sexhuman alieninterspecies sexmass killingvillainess played by lead actressmorphingeroticismbreedinglong tonguecocoonshape shifting aliengirl from outer spaceviolence against a childplaying godsecret government organisationtelepathsetisevered thumbalien dnasex with an alien womanmating instinctmessage from outer space (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

SalΓ², Or The 120 Days Of Sodom (1975) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

SalΓ², Or The 120 Days Of Sodom (1975)

Nazi-Fascist Northern Italy, 1943-44. Four senior members of government, aided by henchmen and Nazi soldiers, kidnap a group of young men and women. They hold them for 120 days, subjecting them to all manner of torture, perversion and degradation.

Subgenre:
cult filmtragedy
Themes:
insanitydeathmurdersuicidekidnappingrapebetrayaltorturedanceweddingvoyeurismpsychopathbrutalityhumiliation β€¦mental illnesssadismevilexecutioncruelty (See All)
Mood:
goresatireavant gardeambiguous ending
Locations:
churchbicycleitalycatholic church
Characters:
homosexualityteenagerteenage girlprostituteteenage boyvillainmaid
Period:
world war two1940s
Story:
graphic violencemale pubic hairvoyeurbare buttmale full frontal nudityfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditybased on novelmale nuditykissmasturbationbloodsex β€¦number in titleviolencebondagebare chested malegunfemale rear nudityfemale full frontal nudityinterracial sexdancingnipplessingingknifelesbian kisserectionpantiesfondlingcryingsongdigit in titleshot to deathunderwearblood splatterurinationface slapshot in the headplace name in titlebeddead bodypianosubjective cameragay slurcandlemansionstabbingthroat slittinghousefemale pubic hairjokescantily clad femaleradiocontroversypainpublic nuditybinocularsstrippingscreamingstorytellingevil manscreamhangingcity name in titlelong takebodyguardtraploss of motherwhippingcross dressingteenage sexpowercloseted homosexualburned alivenipples visible through clothingdresssexual abusehatmutilationeccentricbarefoot malevictimsadomasochismrapistsocial commentarysufferingwhipfascismperversioneye gougingwedding dressdisfigurementstabbed in the eyeroomsodomydead girlpervertmale objectificationhysteriaforced to stripspit in the facedefecationhuman monstersexual perversionsexual violencegun held to headvillamasochismdegradationanal rapefascistmale rapenihilismtransvestismbishopextreme violencemacabrechapter headingsmatricidesex with a minorquotationforced marriagecity in titlesexual humiliationmurder victimasphyxiationexcrementfetishismbrandingtortured to deathforkdebaucherysexual sadismsexual torturewaltzsexual crueltybanned filmbiblical referencefilicideplace in titleitalian cinemadehumanizationmealmidnight moviescalpingstabbed in the foreheadinfamyviolent sexperversityscatologysickostab woundmisanthropydeviant sexlibertinecoprophiliajumping from a windowbody mutilationcollectivismtorture deviceextreme filmurophiliabowel movementnotorietyhuman brandingfalling from a windowhyperrealismitalian fascismtongue rippingbarbarismscatforced sexual contactburning fleshfrench cinemabranding ironcoprophagiabroken ruleexcrement eatingmarquis de sadereference to danteeye removalsexual victimmental tortureadult actress playing minoranti nazismdeviant behaviorfake weddingcollectivist societyconga linereference to the marquis de sadesodomwash basinsocial masturbationfeces on faceleather obsessionsalobottom feeder (See All)

The Crying Game (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Crying Game (1992)

An unlikely kind of friendship develops between Fergus, an Irish Republican Army volunteer, and Jody, a kidnapped British soldier lured into an IRA trap by Jude, another IRA member. When the hostage-taking ends up going horribly wrong, Fergus escapes and heads to London, where he seeks out Jody's lo β€¦ver, a hairdresser named Dil. Fergus adopts the name "Jimmy" and gets a job as a day laborer. He also starts seeing Dil, who knows nothing about Fergus' IRA background. But there are some things about Dil that Fergus doesn't know, either... (Read More)

Subgenre:
sexual thrillerindependent filmmelodramapsychological dramapolitical thriller
Themes:
murderfriendshiprevengekidnappingprisonescapedeceptionterrorismblackmailredemptionsexualityfalling in loveunlikely friendship
Mood:
neo noirmurder plot
Locations:
barlondon englandrural settinggay barchase in the woods
Characters:
gay kisssingersoldierhostagetranssexualinterracial relationshipgirlfriend
Story:
hair salonbisexualityhairdressermale pubic hairmale frontal nuditysex scenethree word titlesurprise endingcryingshootoutblood splattermachine gunurination β€¦vomitingheld at gunpointf wordsuicide attemptjudgeassassinationcontroversyfemme fataleconfessionopening action scenestreet shootoutstalkingtrapirelandkissing while having sextransvestiteloyaltytitle based on songtied to a bedaccidental deathimpersonationfrogpromiseinterracial romancehaunted by the pastdeath threatplot twistlove at first sightbible quoteamusement parksurprisefull frontal male nudityterrorist groupconstruction workerlong hairgay romancescorpionactual animal killedtransvestismn wordfemale villainfablebritish soldiertraffic accidentfatal attractiontragic lovebmwbritish renaissancenorthern irelandassassination plotsuitorstockholm syndromecoercionmusical performancebad dreamcomradesexual orientationaliasirish republican armysecret lifesafe housedeadlinerun over by a carfreak accidentprison sentencebondingprotectorplatonic lovedoomed romancelesbian slurafrican angloburned with a cigaretteguinnesshomosexual interestguilt riddentransgender womangender bendingfemale terroristshocking truthtwisted loverevulsionromantic misunderstandingandrogynouscrackdownfalse identificationmale on male oral sexcricket balltaking the fallvomiting after sexfamous twistsexual disgustironic deathperson in hidingterrorist act (See All)

Don't Look Now (1973)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Don't Look Now (1973)

John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei β€¦ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)

Subgenre:
independent filmcult filmsuspensesupernaturalbritish horrorcult classic
Themes:
writingsurrealismdeathmurdermarriagedrinkingdrunkennessfuneralsupernatural powerguiltgriefmental illnessblindnessdeath of daughterafterlife β€¦death in childbirth (See All)
Mood:
gorerain
Locations:
hospitalrestaurantchurchhotelboatbicyclewaterairportrural settingpolice stationcityitaly
Characters:
family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipchildrenboygirlpolice officerserial killerpolicemanpriestsister sister relationship β€¦villainmaid (See All)
Period:
1970s
Story:
giallo esquepremonitionwidowmale pubic hairbare buttfemale frontal nuditymale frontal nudityfemale nuditymale nuditysex scenekissbloodbare breastsflashback β€¦cigarette smokingnipplesphotographknifechasethree word titlesurprise endingshowertelephone calltopless female nuditypunctuation in titlecorpseunderwearfoodhorsemirrorslow motion scenecatarrestlettervomitingapostrophe in titledead bodycafehallucinationprayersubjective cameracandleold manambulancewomanbridgeeatingfemale pubic hairnunbathpantyhoseold womandrowningflash forwardbased on short storycharacter's point of view camera shotsuitcasedollstatuereadingdeath of childcity name in titlepursuitsadnessratpsychicitalianoccultfaintingarchitectureloss of loved onebuttocksaccidental deathlossladderfatewhiskeydwarfhaunted by the pastnipplelostdeath of protagonistdead childpolice inspectorbrushing teethriding a bicyclemale objectificationapparitionimperative in titleseanceloss of daughterbroken mirrormarried couplestretchervenice italyloss of childblind womanmediummotorboatbishopcowgirl sex positionseizurepondbleeding to deathpsychic powerorchestral music scorebriton abroadbloody violencedeath by drowningpsychotronic filmchance meetingdressinggrindhouse filmmurder victimtrancecanalmosaicmental instabilitybritish accentgrievingunhappy endingraincoatgondolastained glass windowfemale star appears nudenude pantyhosescaffoldsibling relationshipmale in a showerdeliberate crueltygrieving mothermusic score features pianoprecognitiondead daughterthe color redtalking with the dead5 year oldartificial respirationspilled drinkstray catgrieving fatherchild drowningringing a bellsleazy giallodyetalking dollwomen's restroomreference to john miltonslashed to deathaccidental drowningmale star appears nudebegins with deathmultiple sex positionsprimal screamsaint nicholasboeing 727woman faintingexsanguinationgrieving parentdrowned bodysecond sightwoman getting dressedapplying mascaraitalian flagrefusing to believechurch restoration (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Biutiful (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Biutiful (2010)

Uxbal, single father of two children, finds his life in chaos as he is forced to deal with his life in order to escape the heat of crime in underground Barcelona, to break with the love for the divorced, manic depressive, abusive mother of his children and to regain spiritual insight in his life as  β€¦he is diagnosed with terminal cancer. (Read More)

Themes:
fearreligiondeathmurdermarriagedrugsmoneybetrayaldrinkingdrunkennessmemorydrug usecancerredemptionguilt β€¦griefillnessphotographyexploitationdyingpolice corruptionafterlifedying fatherdying from cancer (See All)
Mood:
rain
Locations:
train stationcemeteryhospitalbarbeachrestaurantschoolchurchforestsnownightclubwoodspolice carstrip clubmexico β€¦slumsex in a closet (See All)
Characters:
gay kissfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipdoctorchildrenbrother brother relationshipboybrother sister relationship β€¦prostitutegirlnursepolicemandancerbabylittle girllittle boychinesegay relationshipsingle fathergay fathercrying babychinese foodgay asianbaby boypolice violencereligious iconsex with brother in lawasking for forgiveness (See All)
Period:
2000s
Story:
briefsmale underwearspidercrossaccidentdreamfemale nuditykissbloodviolenceone word titlebare chested malefightcigarette smoking β€¦dancingphotographtitle spoken by charactersingingchaseshowertelephone callcryingcell phonecorpseunderwearfoodmirrorurinationface slapwatching tvdrinkarrestundressingthongvomitingtearsrunningbirthdaydead bodycafebathroomjailhallucinationtelephonesubjective cameraorphancookingwinecandlestrangulationdrug dealermontageeatingcocainetoiletimmigrantsubwayfishdinnerchild abuseapologycoffinmarriage proposalpaingravemicrophoneprologuemassageringflowerspursuithairy chesttragic eventdeath of soncharacter says i love yougay coupletrustsingle parentterminal illnessafricanbirthday cakecloseted homosexualtv newshuggingsyringemedicinebreaking and enteringwarehousehypodermic needlelooking at oneself in a mirrorcakebabysitterice creamcrucifixmorguedesperationgay parentstreet lifepillssufferingboxer shortsconstruction sitemourningbackpackmedical examinationmarital separationmale male kisspolice raiddead boyinjusticedead motherillegal immigrantowldormitorysuffocationg stringcremationconstruction workerbreast feedingrepeated sceneevictionsnorting cocainedead fathertv reporterblack marketconstructionclimbing through a windowdenialdying mansense of smellbreaking a windowmarriage problemsmediumsewing machinesitting on a toiletintentionally misspelled titledistrustbarcelona spainsleeplessness10 year oldpole dancerhappy birthday to youillegal immigrationspaghettimortuarywrapped in a towelstreet vendorchemotherapyasphyxiationbailbipolar disorderforkcrematoriumchild's drawingpneumoniadead parentsnoseblowing out candleheartbeatsparklerestranged couplemedical clinicwashing clothesatonementblood sampledead sonmass deathbed wettingdiamond ringout of body experiencetouching someone's breastsreference to mother teresaterminal cancerbelief in the afterlifeestranged wifesenegalsweatshopfastingwetting oneselffootbridgeodorreference to disneylandwraithbad newsdeath by suffocationviolence against a childembalmingcarbon monoxide poisoningface woundnude dancingprostate cancerseven year oldupside down viewwaiting in lineincontinencechinese immigrantmale wearing an earringsense of soundtalking with the deadhuman exploitationabandoned childadult diaperbeginning morphed with endingsenegalesemagnetic resonance imagingpounding on a doorreference to the united nationsbarred windowpyreneesreference to the dalai lamacommunicating with the deaddeath from cancerillegal workerkid artstrip club ownerboogerheaterdeath by asphyxiationmale ponytailreference to francisco francopierced eartalkativenessboy smoking a cigarettedead body on beachprostate exammisspelled worddead body floating in waterreference to jack danielsappliance storebody washed up on beachhitting a childsilent sceneblack marketeersurrealism sequenceurinating bloodmultiple tv screenssent to one's room (See All)

Friday The 13th (1980) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror
Themes:
mysterious deathinsanityfeardeathmurderrevengevoyeurismcorruptionpsychopathbrutalityhumiliationsadismevilcrueltytrauma
Mood:
gorenightslasherdarknessblood and gore
Locations:
carmotorcycleboatwaterwoodsrural settingpolice carlaketruck
Characters:
policeteenagerfriendteenage boypolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driverslasher killer β€¦mysterious villainserial murderer (See All)
Period:
1970s1950ssummer
Story:
giallo esquegraphic violencedangeraccidentvoyeurmale rear nudityfemale nuditymale nuditykisssexnumber in titleviolencebare breastsbare chested malefemale rear nudity β€¦nipplesthree word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationguitarsubjective cameradecapitationbedroombracandleold manaxemassacrestabbingwomanthroat slittingstabbed to deathdinersnakecultdream sequenceskinny dippingstrippingprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured faceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblouseremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

The Paperboy (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Paperboy (2012)

Eldest son Ward Jansen is a star reporter for a Miami newspaper and has returned home with close friend Yardley to investigate a racial murder case. Younger brother Jack Jansen has returned home after a failed stint at university as a star swimmer. To help give his life some direction, Ward gives Ja β€¦ck a job on their investigation as their driver. But into the mix comes the fiancee of the imprisoned convict who stirs up confusing feelings of love and lust for the young Jack. Meanwhile, Ward and Yardley's investigation stirs up deep-rooted issues of race and acceptance which could cause serious consequences for everyone involved. (Read More)

Themes:
deathmurderprisonweddinginvestigationvoyeurismunrequited lovemurder of a police officerfirst love
Mood:
raindancing in the rain
Locations:
barboat
Characters:
brother brother relationshipmaidolder woman younger man relationshipdriver
Period:
1960syear 1969
Story:
white briefsbriefsmale underwearvoyeurfemale frontal nuditymale rear nuditybased on novelfemale nuditymale nuditysex scenebloodmasturbationbare breastsinterviewtwo word title β€¦bare chested maleejaculationleg spreadingpantiesshowertopless female nudityvoice over narrationbeatingunderwearurinationblondeundressingbikinibathroomreportercleavagenewspaperaxethroat slittingstabbed to deathscantily clad femalepantyhoseracial slurhotel roomblack pantiessplit screentied upgirl in pantiescloseted homosexualmachetefloridafemale singerdead womanmiami floridaswampconvictvoice over letterpink pantiesnudemini dressnude girln wordgay brotheralligatorsome scenes in black and whitefacial scarwoman in a bikiniheatracial tensionoff screen murderhusband murders wifefake accentthroat cutwoman wearing black lingeriejellyfishundershirteyepatchurinating on someonestabbed in the bellysouthern gothicmotor boatfemale urinatingsleeper holdwoman wearing a miniskirtman wearing tidy whitieshiding in a treeman on a toiletdeath row inmateripping pantyhoseblack maiddancing in one's underwearwet underweardead woman in a chairmasturbation in publicfake british accentswimming in the oceanelectrified fencehandcuffed to a table (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

I Spit On Your Grave (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β€¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie
Themes:
feardeathmurderrevengekidnappingrapetorturevoyeurismseductionangerpsychopathbrutalityhumiliationsadismevil β€¦exploitationcrueltyvengeancerape and revengerevenge murder (See All)
Mood:
goreslasher
Locations:
new york citychurchforestcarsmall townbathtubbicyclewaterlakegas stationcountry
Characters:
writerfemale protagonistgirlserial killerkillerlustvillainserial murdererself justicesex with a stranger
Period:
1970s
Story:
graphic violencecastrationfemale killermale pubic hairvoyeurmale full frontal nudityfemale frontal nuditymale frontal nudityfemale nuditymale nuditybloodviolencebare breastsbare chested male β€¦gunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesknifeleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmriveralcoholtelephonecleavagenewspapergangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurderercabinhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragemutilationdesperationgrindhousevictimrape victimrapistredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversionbody countaxe murderbruisecharacters killed one by onekilling spreemisogynypsycho killerwoman in bathtubpervertserial murderpsychopathic killerkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencemurderesssmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

Adore (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Adore (2013)

Lil ('Naomi Watts' (qv)) and Roz ('Robin Wright (V)' (qv)) are two lifelong friends, having grown up together as neighbors in an idyllic beach town. As adults, their sons have developed a friendship as strong as that which binds their mothers. One summer, all four are confronted by simmering emotion β€¦s that have been mounting between them, and each find unexpected happiness in relationships that cross the bounds of convention. (Read More)

Themes:
feardeathfriendshiprevengemarriageinfidelityjealousyadulterypregnancydrinkingdrunkennessweddingvoyeurismmemoryextramarital affair β€¦divorcelonelinessdeath of fatherguiltunfaithfulnesstheatre (See All)
Locations:
cemeteryhospitalbarbeachhotelbuskitchenaustraliafranceofficeoceantownsuvrunning on a beach
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendboyfriend girlfriend relationshipsingerboyteenage girlteenage boydanceractorbabyactressbest friend β€¦reference to godaustralianex husband ex wife relationshipolder woman younger man relationshipgrandmother granddaughter relationshipyounger version of charactertheatre director (See All)
Period:
summer
Story:
crosswidowvoyeurbare buttdreamwoman on topmale rear nudityfemale nuditymale nuditykisssexf ratednudityflashback β€¦bare chested malefemale rear nudityfightcigarette smokingdancingphotographsingingleg spreadingpantiestelephone callcryingcell phonesongtitle directed by femalefoodmirrorblondeface slapcomputerdrinkbikinisex in bedsecretbookvomitingliebeertearssunglassesrunningbirthdaysex standing upneighborreference to jesus christtelephonef wordswimmingcleavagewineeatingapologychildscantily clad femalebirthday partyunderwater scenegraveyardbartenderflash forwardjeansgraveblack pantieschampagneauditionflowersdeath of husbandlaptopsadnessreunionsuspiciontearevelationlooking at oneself in a mirrorlistening to musichappinessagingwatching a movieswimsuitsurfingaudiencecoitusforbidden loveart galleryburialbald manbroken legministercard playingseasidecliffcopulationwedding receptionsunbathingphoto albumfemale female kissnew jobbirthday presentsydney australiaremorsereading aloudcrutcheslost lovesurferraft18 year oldtheatre productiondolphingiving a toastmother in lawbeach houselollipopswimming underwaterreverendsurfboardreading a booksurrogate motherlesbian subtextleg injuryleg woundremarriageoverhead shotbedtime storyhappy birthdayrearview mirrorsaying goodbyeplay rehearsalbreaking upsidewalk cafebased on novellatryst20 year oldunderwater fightsurrogate sonwoman directorleg in a casttravel agentcurtain callwetsuitphysical rehabilitationbank checkloversreference to george gershwin21st birthdaymusical productionreflection in a rearview mirrorantisepticreading a book to a childsurfing accidentwater wings (See All)

The Butterfly Effect (2004) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Butterfly Effect (2004)

Evan Treborn grows up in a small town with his single, working mother and his friends. He suffers from memory blackouts where he suddenly finds himself somewhere else, confused. Evan's friends and mother hardly believe him, thinking he makes it up just to get out of trouble. As Evan grows up he has  β€¦fewer of these blackouts until he seems to have recovered. Since the age of seven he has written a diary of his blackout moments so he can remember what happens. One day at college he starts to read one of his old diaries, and suddenly a flashback hits him like a brick! (Read More)

Subgenre:
paranormal phenomenacult filmpunk
Themes:
insanityreligiondeathsurrealismmurderloverevengesuiciderapejealousyprisonescapefuneralmemorytravel β€¦psychopathdeath of fatherparanoiatime travelcancerillnessabuseunrequited lovechildhoodtraumaamnesiainheritanceself sacrificepsychological trauma (See All)
Mood:
nightmarerainmoving
Locations:
cemeteryhospitalbarrestaurantschoolforesthotelbicyclewoodswheelchairslumsuvprison rape
Characters:
father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipboybrother sister relationshipteenage girlprostituteteenage boyteachergirlnursestudentbabyreference to god β€¦bullywaitresspsychiatristprofessorself mutilationchildhood friendfather in prison (See All)
Period:
future
Story:
castrationcrossmale pubic hairdreamfemale frontal nudityfemale nuditysex scenebloodkissviolenceflashbackdogbare chested malegun β€¦fightfemale full frontal nuditycigarette smokingexplosionknifesurprise endingpantiesshowertelephone callfirecryingbeatingunderwearsex in bedvomitingbeertearsanimal in titlelingeriecafecollegereference to jesus christtelevisioncleavagegay slurstrangulationvideo cameraambulancestabbingbasketballimpalementsuicide attemptstabbed in the chestfemale pubic hairnonlinear timelinechild abusescantily clad femalecoffindrawingchild in perilunderwater sceneroommategraveyardmarriage proposalracial slurflash forwardattempted murderdrug addictcursebeaten to deathstabbed in the backmini skirtpay phonedollknocked outreadingbaseball batuniversityscarbasementsevered armtherapyhatepornographydestinymedicinekilling an animalsociopathcaptivevandalismwatching a moviemovie theaternosebleedpsychologyhome moviemind controlcompassionfates&mtowelchokingmental institutionhaunted by the pastbraverycynicismhypnosishit on the headbutterflydynamitepedophilebilliardsaccidental killingdungeonmurder of a childconvictalternate realityfemale in showerbraindead dogmemory lossmale objectificationstabbed in the handnotebookpedophiliajunkyardplaying poolkilling a dogblue pantiesjournallost loveblackoutrepressionmale in underwearasthmaself defensefraternitysororityfilm starts with textwormhazingmailboxtestexamessaycrotch grabpsychotherapystresschild molesteryoung mangoth girlfirecrackerburning911kneelingpepper sprayrepressed memoryprosthetic limbmodel airplanechild herograve side ceremonyconvulsiontime travelerchild murders a childlung cancerchild pornographyalternate universealtering historyreference to robin hoodinhalerchildhood memoriescigarette burnsharddisturbed childhoodcat scanfatalismsedationfraternity househuman brainmemory lapsesleeping shirtlesschaos theorytoesdeath of a dogbutterfly effectaryan brotherhoodlighter fluidmk ultraunintended consequenceshypnotic regressionmace the repellentmale time travellerpsychotic childsleeping in underweartalking during a movieu haul truckartificial handbrain hemorrhagenumbnessmail bombchange historymorpho butterflybuilding model airplanechanging past event (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
insanityfearsurrealismdeathmurderfriendshipkidnappingrapetorturepsychopathdeath of fatherbrutalitydeath of mothersadismevil β€¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
nightmaregorecar chasenightslasherdarknessblood and gore
Locations:
hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend β€¦killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All)
Story:
giallo esquegraphic violencefemale killervoyeurdreamfemale frontal nudityfemale nuditybloodmasturbationf ratedviolencebare breastsflashback β€¦dogguncigarette smokingphotographknifelesbian kisschasesurprise endingshowertelephone callcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighbortelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationmurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disorderpolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

The Dead Zone (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
paranormal phenomenaindependent filmcult filmsuspensesupernaturaltragedyparanormalpsycho thrilleramerican horrorcanadian horror
Themes:
feardeathsurrealismmurderlovesuiciderapechristmasinvestigationdeceptionpsychopathsupernatural powerdeath of motherparanoiablackmail β€¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All)
Mood:
neo noirslasher
Locations:
hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck
Characters:
husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officerserial killernursephotographerbabylittle boyvillainpsychiatrist β€¦snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All)
Period:
world war two1980s1970swinterseeing the future
Story:
premonitionscissorsvisiondangeraccidentdreamfemale nuditybased on novelkissbloodflashbackphotographtitle spoken by characterexplosionchase β€¦surprise endingpistolfireshootoutcorpseshot to deathblood splattercar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolvertelephonef wordreportergood versus evilflashlightambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomamutilationexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenemercilessnessevacuationpsychotronicsenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant herohead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

Single White Female (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Single White Female (1992)

When a 'Single White Female' places an ad in the press for a similar woman to rent a room (to replace the boyfriend she's just left), all the applicants seem weird. Then along comes a level headed woman who seems to be just right. The new lodger has a secret past which haunts her.

Subgenre:
psycho thriller
Themes:
insanitydeathmurderfriendshipbetrayaljealousyescapeinvestigationobsessionmental illnessbreak up
Locations:
new york cityrestaurantbathtubnightclubelevatorkitchenapartmentsex in a chair
Characters:
homosexualboyfriend girlfriend relationshipfemale protagonistlust
Story:
hair salonmale pubic hairvoyeurbare buttfemale frontal nudityfemale nuditybased on novelmale nuditysex scenef ratedviolencedoggun β€¦ejaculationphotographknifelesbian kissthree word titlepantiesshowervoice over narrationhigh heelsunderwearmirrorface slaplettervomitinglingerierock musicbathroomneighborcolor in titlecleavagestrangulationstabbed to deathtied to a chairwhite pantiesscantily clad femalebirthday partyroommatefemme fatalestalkerhotel roomstabbed in the backbusinessmanmini skirtchampagnemistaken identitysuitcaseattempted rapeshot in the shoulderbasementlaptoprattwinmaniaceavesdroppinganswering machinesociopathsexual attractionice creamvandalismfull moonremote controlshot in the faceshoppingheadphonesmedicationadvertisingsexual harassmentbookstorestabbed in the eyeduct tapenervous breakdownpuppyphysical abuseengagement ringwoman in bathtubdead dogfianceelaundryinsecurityfemale bondingschemeassumed identityspiral staircasefemale removes her dressstairwaywalletlegsfemale psychopathpolaroidearringanimal abusebusiness cardloss of sisterperfumelook alikecheating boyfriendlesbian subtextnon statutory female on male rapesuicide noteunwanted kissnew york skylineclerkpet catkicked in the groinsurprise party555 phone numbercrime of passionweepingbipolar disorderborderline personality disorderdyed hairscrewdrivershoe storecomputer programmerdeath of petconciergewind chimesoftwaremeat hookpillow talkdangerous friendclassified adpersonality disorderlabrador retrieverstiletto heelscat loverfemale on male somnophiliaman raped by womanshoeboxshot through a pillowantisocial personality disorderpersonals columnscrambled eggrape by deceptionpsychopathycracking knuckle joint (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Three Colors: White (1994) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Three Colors: White (1994)

Karol (Polish) marries Domininque (French) and moves to Paris. The marriage breaks down and Dominique divorces Karol, forcing him into the life of a metro beggar and eventually back to Poland. However, he never forgets Dominique and while building a new life for himself in Warsaw he begins to plot.. β€¦. (Read More)

Subgenre:
black comedy
Themes:
surrealismdeathmurderfriendshiprevengemarriagemoneyprisondrinkingweddingfuneralmemoryrobberydivorce β€¦corruptiontheftobsessionhumiliationcrueltyvengeancewealthcheating (See All)
Mood:
nightmare
Locations:
cemeterychurchcarsnowairplaneparis franceairportcourtroomfrancerunning after a car
Characters:
husband wife relationshippolicefriendbrother brother relationshippolice officerlawyerthieffrenchex husband ex wife relationship
Period:
winter
Story:
hair salonhairdressertombscissorsmale underwearsex scenebloodkisssexnumber in titlesequelflashbackbare chested maleguncigarette smoking β€¦pistoltelephone callfirecryingbeatingcorpseunderwearblondepunched in the facewritten by directordrinkarrestvomitingtearssecond partbeddead bodycolor in titleriverf wordold manstrangulationbridgesuicide attemptimmigrantsubwaymapjudgetrialcoffingraveyardpaingravehotel roombinocularsbusinessmankeypay phonesuitcasestatuechristmas treecourtbusinessbodyguardgiftcharacter says i love youhandgunsleepingtypewriterarsonpickup truckshavingcard gameslow motioninjuryhong konghidingphone boothpart of trilogybridefaked deathburialscamgas maskpassportguardboxer shortsintriguepartnerhomelesscigarette lightercard playingcon artistpolandcanebruisepigeonsign languagecoinholding handsframed for murdervodkaimpotencechristmas presenthit in the facelong hairlast will and testamenttelephone boothstreet marketphone sexloancredit cardobsessive lovecrushed headhearsemoney launderingrags to richesfablesexual frustrationbeauty salonequalityholebeggingtrunkmetrosilhouettecasketrebirthluggagecard trickwarsaw polandinterpreterreference to charlie chaplinhandkerchiefautomated teller machinelongingpadlockvolvohand on crotchneon signbusiness partnerphone booktear gasdesertiongarbage dumpsecond in trilogywashing hairhair stylistbusiness dealbeauticianconveyor beltparis metrowedding dayreturn homesearch warrantfaking own deathcombelderly manfaxbuskingpanhandlingdeath certificateblank bulletdiplomareference to brigitte bardottelephone bookpretending to sleepbaggagepaper shredderconsulatepole the personhired assassinfrench lessonlost luggageshiveringsummonsbaggage claimpolish immigrantbaggage handlerdivorce courtswallowing a keybusiness mancurrency exchangeunconsummated marriagecivil courtexecutorfrancfrozen riverarmed guardbrothholding a gun to someone's headsliding on icepolish mantoilet stoolcompany ownerland salereflection in picture frame glass (See All)

Risky Business (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Risky Business (1983)

A suburban Chicago teenager's parents leave on vacation, and he cuts loose. An unauthorised trip in his father's Porsche means a sudden need for lots of money, which he raises in a creative way.

Subgenre:
cult filmteen movieerotic fantasy
Themes:
friendshipdrugsmoneyjealousyvoyeurismrobberywrestling
Mood:
high schoolcar chase
Locations:
cartaxiairportchicago illinoiscar in waterschool nursesex in a chair
Characters:
father son relationshipmother son relationshipteenagerfriendprostituteteenage boypimpdancing in underwear
Period:
1980s
Story:
white briefsbriefsmale underwearvoyeurwoman on topfemale frontal nudityfemale nuditymale nuditysex scenemasturbationsextwo word titlebare chested maledancing β€¦partypantiesshowertelephone callunderwearblondeslow motion sceneundressingbedmarijuanabathroomprostitutiontelephonecleavagebedroomhousesubwaywhite pantiesscantily clad femalestrippingfantasy sequenceprankpremarital sexdirectorial debutclass differencesteenage sexsexual fantasyshavingteen angstdesirenipples visible through clothingpokersexual attractiongroup of friendsice creamred dressblockbusterblack humorsexual desireunderage drinkingburglarysex talkpanties pulled downsexual humorattractionextortionliving roomwrestlermale in showerclose up of eyespractical jokedockcar drivingfemale removes her dressstairwaymini dresscall girlbikeporschedrug humorsex on stairspoker gameoverhearing sexsubway trainshort shortsfemale in a showerhome alonesodaadolescent boysexual jokecounting moneylifting weightsburgermale in a showerkissing in publicauto repairdark glassesbutt grabelectric razorwearing sunglasses at nightweight trainingtransvestite prostitutelake michiganfifty dollar billcollege boundfaberge egghigh school wrestlingalone in houseadult actor playing minorbaby picturecollege interviewtrashed housepop quiz (See All)

Naked Lunch (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Naked Lunch (1991)

Not an adaptation of beat writer William S. Burrough's novel but a mix of biography and an interpretation of his drug- induced writing processes combined with elements of his work in this paranoid fantasy about Bill Lee, a writer who accidentally shoots his wife, whose typewriter transforms into a c β€¦ockroach and who becomes involved in a mysterious plot in North African port called Interzone. Wonderfully bizarre, not unlike Burrough's books. (Read More)

Subgenre:
gay interestexperimental filmdark comedycyberpunk
Themes:
writingsurrealismmurderdrugsadulterylesbianismseductiontravelparanoiadrug addiction
Locations:
new york citybarbeachbus station
Characters:
homosexualitywriterhomosexualdoctoralien
Period:
1950s
Story:
bisexualfemale nuditybased on novelmale nuditysex sceneguntitle spoken by characterpistolinterrogationcafehallucinationdinersubwayman with glasses β€¦shot in the foreheaddrug addictfugitivepoisonactor playing multiple rolessecret agenttypewriterhypodermic needletalking animalloss of wifebreakfastmale prostitutewhipimpostorinsecthousekeeperalienationvoodooparrotdoppelgangercockroachmarketmeatbugborder crossingaccidental shootingshoeglasstransvestismmanuscriptpawnshopticketbird cagegiant insectwoman shot in the foreheadheadexterminatornorth africaphallic symbollynchianbazaarrepressed homosexualreportkafka esquecentipedefilm with ambiguous titlejazz scoreuxoricidereality vs fantasypowderquack doctorbreathboy eatenblurred boundariesinner turmoilpsychological disintegrationmedina saudi arabiatalking anuswriter's muse (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Divide (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Divide (2011)

Nuclear explosions force the residents of a New York apartment block to run from the building. However, the explosions force them into a basement. Eight residents are holed up in the building's bomb shelter. They must acclimatise to each other in difficult, cramped conditions.

Subgenre:
post apocalypsesurvival horror
Themes:
insanityrapetortureapocalypse
Locations:
new york city
Characters:
gay kissmother daughter relationshipbrother brother relationshipsoldierlawyer
Story:
white briefsbriefsmale underwearmale rear nuditymale nuditybloodtwo word titlebare chested maleexplosionfireshot in the chestundressingsurvivalcandle β€¦axethroat slittinggunshothairy chestbasementtied updestructionshot in the stomachcrying womansafedead manmale male kisslanternduct tapesodomyshaved headgirl in bra and pantieswoman cryingbrooklyn bridgeloss of childfinger cut offterrorist attackoverhead camera shotnorth koreaman on firenuclear explosionhalf brothershelteroverhead shottrail of bloodman dressed as womanweldingbomb sheltererectile dysfunctionhitting a womanman dressed as a womansexual favorviolent sexcity in ruinsshaving headwall safehair lossradiation sicknesshead shavingbody mutilationbroken glassesreflection in eyetrapped in a roomstruggle for survivalunwanted sexual advancesdestruction of cityfallout shelterseptic tankcut to piecesmedical labrationbuilding superintendentchopped up bodyradiation suitopen woundsurvival kit (See All)

Final Destination 3 (2006) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Final Destination 3 (2006)

When Wendy Christensen has a vision of an accident on the roller coaster, resulting in her and her friends' deaths, she instantly begins to panic and gets off the ride, causing a few of her friends to get off as well. The remaining friends, including Wendy's boyfriend, are stuck on the roller coaste β€¦r and find themselves involved in the accident. With death waiting around the corner, Wendy and Kevin Fischer must try and work out death's plan, before they and the remaining survivors end up dead. (Read More)

Themes:
deathfuneralvoyeurismsupernatural powerguiltsadismcheating death
Mood:
gorerain
Locations:
new york citytruck accident
Characters:
teenage girlbest friend
Story:
premonitionvisionconvertibleaccidentvoyeurdreamfemale frontal nudityfemale nuditybloodviolencesequeldancingphotographexplosion β€¦surprise endingpantiesfireblood splatterhorsecar accidentblondeshot in the headcomputercamerafalling from heightcar crashmanhattan new york citydecapitationcleavagevideo cameraambulanceimpalementsubwaysevered headscantily clad femalethird partperson on fireelectrocutionmini skirtscreamskeletongymtragic eventratobscene finger gesturefireworksgirl in pantiespickup truckwolfburned aliveno pantiesheavy rainloss of friendfatecrushed to deathcannonfannippleamusement parkexploding headpanties pulled downshadowtrailercharacters killed one by onefortune tellerworld trade center manhattan new york citypigeontorso cut in halfgothgraduationhysteriacremationpink pantiesblue pantiesthong pantiesroller coasterferris wheelkitelocked doorcrushed headcoincidencewarningjockdeath of boyfriendburnt bodyclueacoustic guitartheme parkscaregoth girlscytheimmolationextremetarot cardforkliftsignno survivorsnail gundigital camerabodily dismembermentgrave side ceremonydead teenagerhelium balloonloss of boyfriendfreak accidentsparklerlifting weightstrain crashwind chimehand cameratanning beddrive thrucannonballfootball practicehorseshoealternate endingvision of the futuredizzinesstrain derailmentflipping a cointanning salondesk bellsparksnarrow escapeforgeslurpingpopping balloonsoccer practiceapprehensionforeshadowgust of windhonking a hornrunaway vehiclevisible thong straps (See All)

Heavenly Creatures (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Heavenly Creatures (1994)

Based on the true story of Juliet Hulme and Pauline Parker, two close friends who share a love of fantasy and literature, who conspire to kill Pauline's mother when she tries to end the girls' intense and obsessive relationship.

Subgenre:
independent filmgay interestcult filmcoming of agemelodramastop motion animationteen moviedocumentary footage
Themes:
writinginsanityreligionsurrealismdeathmurderlovefriendshipmarriageinfidelitychristmasadulterylesbianismextramarital affairdivorce β€¦theftobsessionredemptionunfaithfulnessillnesshollywoodwealthmadness (See All)
Mood:
goremoving
Locations:
hospitalbeachbathtubwoodsbicycle accidentfire escape
Characters:
homosexualitywriterfamily relationshipshusband wife relationshipfather daughter relationshipteenagermother daughter relationshipfriendsingerbrother sister relationshipteenage girlfemale protagonistteacherstudentdancer β€¦photographerpriestthieflove trianglebibleprofessoraunt niece relationship (See All)
Period:
1950s
Story:
bisexualitydreamkissbloodflashbacktwo word titledancingtitle spoken by charactersingingpartylesbian kisspantiesbased on true story β€¦telephone callvoice over narrationcryingsongblood splatterface slapswordarrestsecretletterhallucinationreference to jesus christclassroomorgysubjective camerabraambulancestabbingmontagenonlinear timelineapologydrawinggarter beltritualvirginbeaten to deathscreamingfired from the jobfantasy sequencepassionchristmas treediaryfilm within a filmchildbirthcinemaclasstherapyrecord playerteen angstwhat happened to epilogueloss of virginityslow motionrecordingstealingmovie startherapistpsychologypsychologisttennisvirginitypassportrole playingrampageunderage drinkingnewsreel footagetheatre audienceheavenhit on the headschool uniformchoirkingdompuppywishnew zealandpost world war twosexual awakeninghysteriaapparitionhead woundschemetrue crimefriendship between girlsfantasy worldcollege professorcathedraleating disorderparoleteenage crushopposites attractbus ridematricidesick childsex with a minorshrinelesbian subtexthymnteenage girl in underwearcoughing bloodshared bathtuberculosisaltarbludgeoningunicornstory tellingbrickboarding housegirls' schoolchristmas gifttrolleyphonograph recordpretending to be deadart classcounselorgym classheadmistresscorrespondencenylonstenoralternate worldpretendingbludgeoned to deathradio programrecord albummarriage counselorfantasy lifebikingprivilegeyear 1954reference to orson wellesyear 1953reference to doris daymimingvoice over writingcourt jestersurrogate daughternew year's resolutionplaying dress upfoster daughtersecludedsuspected lesbianchild psychologyspoiledreference to james masoncontemplating deathmovie magazineclay modelshared hallucinationmodeling clayplasticenethrowing a stone into water (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β€¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
independent filmcult filmamerican horrorsadistic horror
Themes:
insanitydeathmurderrevengesuicidekidnappingrapetortureescapeinvestigationvoyeurismseductionpsychopathbrutalityhumiliation β€¦sadismevilabductioncrueltyvengeancemadnessrape and revengerape and murder (See All)
Mood:
nightmaregorehigh schoolslasher
Locations:
cemeteryswimming poolforestlakerunning through the woods
Characters:
family relationshipsfather son relationshippoliceteenage girlserial killerreference to godkillervillainsheriffterrorslasher killerserial murdererself justice
Period:
1970s
Story:
graphic violencecastrationfemale killerconvertiblevoyeurfemale frontal nudityfemale nuditybloodviolencedoggunfemale rear nudity β€¦fightfemale full frontal nudityknifepantiesshowershot to deathblood splatterurinationremakeshootingbeerbirthdaymarijuanafoot chasebound and gaggedgangconcertstabbingthroat slittingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringfemale removes her clothesmurdererchickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralessmaniacchainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creammutilationgrindhousevictimrape victimrapistpeeping tomhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertserial murderpsychopathic killerprayingbad guymadmancannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violencehomicidal maniacelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthreading a newspaperchild molesterbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

Bitter Moon (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bitter Moon (1992)

British couple Fiona and Nigel Dobson are sailing to Istanbul en route to India. They encounter a beautiful French woman, and that night Nigel meets her while dancing alone in the ship's bar. Later he meets her crippled American husband Oscar, who tells him their story. While living in Paris for sev β€¦eral years trying to be a writer, he becomes obsessed with a woman he met by chance on a bus. He tracks her down and they start a steamy love affair. Soon Oscar finds himself enslaved body and soul by her love, and continues to tell Nigel the details of this relationship in various stages over a number of visits to Oscar's cabin. (Read More)

Subgenre:
black comedypsycho thriller
Themes:
writingdeathmurderrevengesuicidemarriageinfidelityjealousyadulterypregnancylesbianismdrinkingdrunkennessweddingextramarital affair β€¦obsessionunfaithfulnesshumiliationsadismabusebreak upcrueltyabortion (See All)
Mood:
rainmurder suicide
Locations:
hospitalbarrestaurantairplaneparis francebathtubbusnightclubelevatorwheelchairseashipsex in showerstorm at sea
Characters:
writerhusband wife relationshipprostitutegirlnursedancerwaitressolder man younger woman relationshipfrenchpimp
Story:
haircutaccidentbisexualbare buttfemale frontal nuditymale rear nudityfemale nuditybased on novelmale nuditykissbloodsexflashback β€¦doggunfightcigarette smokingdancingnipplesphotographpartylesbian kissleg spreadingerectionshowertelephone callcryingbeatingunderwearfoodurinationface slapshot in the headwatching tvcomputerdrinkundressingshootingvomitingtearscafecandlebandstrangulationeatinggarter beltspankingfemme fataleshot in the legauthorbinocularswidowerchampagneumbrellaproduct placementpassionstorytellingvacationinjectionpigwhippingsex toyshavingsyringediscored dresssadomasochismcarnivals&mmilkpicnicbroken legtarget practicecynicismamusement parkcard playingbathingblack eyetuxedoinsulthousekeeperbrushing teethmiscarriagepromiscuityadulterous wifeparalysisgun in moutheiffel tower parismasochismcostume partyferris wheelrazorcripplefootsie under the tablepearl necklacekarmacruise shiprainbowfatal attractionbeggingmerry go roundsex shopbow tiedragging a bodyzippo lighterfemale to male footsie playingplaying footsiedance classwomen's bathroomconcussionpoodletoasterfemale stockinged footnew year's eve partydrinking from the bottlesex addictfoot massagesex gamehand kissingbottled waterbouquet of flowersskeleton costumeconfettiseasicknessparty hattrust funderotic dancingcarnival ridehopscotchplaying catchfeznotre dame cathedralstraight edge razorhot chocolateerotic dancenirvanareference to the titaniccroissanthit by a vanwedding photographsee through gownvacuum cleaningfire placelatex dressbridge the card gamereference to henry millersashchinese characterslapping a womandriving capslurping a drink with a strawdrink umbrellafoghornocean voyagewool hatno smoking signport holeocean cruisetraction (See All)

Shutter Island (2010) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Shutter Island (2010)

It's 1954, and up-and-coming U.S. marshal Teddy Daniels is assigned to investigate the disappearance of a patient from Boston's Shutter Island Ashecliffe Hospital. He's been pushing for an assignment on the island for personal reasons, but before long he wonders whether he hasn't been brought there  β€¦as part of a twisted plot by hospital doctors whose radical treatments range from unethical to illegal to downright sinister. Teddy's shrewd investigating skills soon provide a promising lead, but the hospital refuses him access to records he suspects would break the case wide open. As a hurricane cuts off communication with the mainland, more dangerous criminals "escape" in the confusion, and the puzzling, improbable clues multiply, Teddy begins to doubt everything - his memory, his partner, even his own sanity. (Read More)

Subgenre:
cult filmsuspensepsycho thrillerconspiracy theory
Themes:
insanitysurrealismdeathmurderrevengeprisontortureinvestigationdeceptionmemorypsychopathparanoiaguiltexecutionholocaust β€¦traumapsychological trauma (See All)
Mood:
nightmarerainneo noirambiguous ending
Locations:
cemeteryhospitalsnowboatwoodsseashipcavestormcar explosionwater gun
Characters:
alcoholichusband wife relationshipdoctortattoogirlsoldierserial killernursedetectivereference to godlittle girlpsychiatristamerican abroadgerman soldier β€¦talking to oneself in a mirrorcolleague colleague relationshipself delusionamerican in europeamerican in germanygerman doctor (See All)
Period:
world war two1940s1950syear 1945
Story:
tombfemale killerwidowmale pubic hairdreammale full frontal nuditymale frontal nuditymale rear nuditybased on novelmale nuditykissbloodviolenceinterviewflashback β€¦two word titlebare chested malegunfightcigarette smokingphotographtitle spoken by characterexplosionsurprise endingpistolshowerfirecryingcorpseshot to deathblood splattershot in the chestslow motion scenepunched in the facesecretvomitinglierifleheld at gunpointplace name in titledead bodyinterrogationhallucinationhandcuffsislandrevolvershot in the backf wordfoot chasestrangulationmassacreexploding carman with glassesno opening creditsdream sequenceradiodrawinggraveyardcigar smokingracial slurgunshotfbiattackfantasy sequencemissing personcover uplightningscardisappearanceinjectionhairy chestwitnessratsuspicionmurderercharacter says i love yougardenhandguntherapychild murdercold warexperimentcaptainsyringemedicinerevelationreference to adolf hitlermass murderjeepgothiccagelistening to musictape recorderwoman with glassesjail cellfbi agentcrying womanpsychologybarefoot malecovered in blooddead womanschizophreniachokingmental institutionrole playingguardprison guardimaginationwindblood on faceboston massachusettsmanhuntpower outageshot in the facemental hospitalplot twistpost traumatic stress disorderdelusionconcentration campdead manracistrainstormcliffdisfigurementfemale doctornotebarefoot femaleasylumchaincellarferrypipe smokingarrogancemale in showerdead girllighthousetaking a showerbarbed wiremental patienthysteriaillusioninvestigatorharborbrainwashingnotebookdockspiral staircasebottlealarmdead childrenfenceblackouthomicidal maniaccamera shot of bare feetfemale psychopathstabbed in the armblood stainhospital roomfortresshurricaneinsane asylumgramophonebunk bedpipeashespondcar set on firebadgelighting a cigarettemurderesspsychotherapycelldeath of familyfemale prisonerdead wifejailbreakdeath by drowningtoy guntraumatic experienceportwet clothesdeath by gunshottiehouse on firehusband murders wifepunch in faceknocked out with a gun buttmale vomitingfortphonographworld war two veteranscreaming womanwrapped in a towelcryptinfanticidered herringescaped mental patientfedorabloody body of a childpolice partnerwardentalking to oneselfhysterical womandustmedical experimentmental asylumnecktielearning the truthbrain surgerypretending to be someone elsemausoleumtorture chamberhuman experimentationfemale serial killerrepressed memoryu.s. marshalhysterical outburstorderlychild murdererfilicideblood on handsscarred facesedativelobotomytalking to the deaddark and stormy nightpsychotherapistconfinementfantasy scenefemale psychiatristelectric fenceseasicknesslake housewar traumafemale murdererfalling treehallucinogenreference to j. edgar hooverdeath camppyromaniacsecret experimenttaking a pilltideyear 1952murder by drowningreality vs fantasymigrainehole in chestyear 1954heavy smokerphilosophical conversationsetting a firehallucinogenic drugfbi investigationanagramreference to franz kafkaspeaking germantalking with the deadcontainmentcriminally insanehysterical manlighting someone's cigaretteregressionhidden agendareference to johannes brahmschild drowningmass executionpipe smokerpsychematchstickpsychiatric nursereference to gustav mahlertriple child murdercagedlighting a matchtalk to the deadarrogant manmemory gamesparanoid schizophrenictaking notesface injuryphone line cutphotosensitivitypsychotic killerelongated cry of nonew colleaguetalking to a dead bodytraumatic shockaltered perceptiondachau concentration campdenouementdrowned bodyleaky rooflunacymother murders own childblind eyecarrying a childdetective as protagonistisland fortressseaside clifftaking a medicationtalking to one's dead wifeturned into dustboston accentexperimental therapytalking to one's dead husbandchild killed by motherdeputy marshalmigraine headachemurderer as protagonistpicture of hitler (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lovelace (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lovelace (2013)

Themes:
feardeathfriendshipmarriagerapemoneydrinkingvoyeurismdivorcehumiliationexploitationadoptiondrug addiction
Locations:
new york citybeachrestaurantswimming poolhotelbathtubtaxiairportpolice carmoteldeath in a car accident
Characters:
catholicwriterhusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendsingerprostitutepolice officerpolicemandancerphotographeractress β€¦reference to godfilmmakerfilm directorpimpgo go dancerex policemanwriting a book (See All)
Period:
1970syear 2002year 1970
Story:
briefsmale underwearconvertiblebare buttfemale frontal nudityfemale nuditykissbloodsexcharacter name in titlenudityviolenceone word titleinterviewflashback β€¦bare chested malegunfemale rear nudityfightcigarette smokingdancingejaculationphotographtitle spoken by charactersingingpartychasepantiesbased on true storytelephone callcryingbased on booksongbeatingunderweartesticlesfoodface slapwatching tvcameradrinkundressingbikinisunglassesrunningcar crashcafemarijuanaprostitutionjailreference to jesus christprayertelephonef wordswimmingbandname in titleeatingcocainedinerclitoriswhite pantiesapologyman with glassesunderwater scenemarriage proposalcoffeepainflash forwardskinny dippinglimousinehotel roommicrophonepay phonechampagneauditionpassionflowersdomestic violencemanipulationpursuithairy chestreference to william shakespearetrustgirl in pantiessexual fantasysex toyeyeglassesapplausepot smokingwhat happened to epiloguediscoinjurytape recorderwoman with glassesjail cellwatching a moviecrying womanmovie theaterfloridahome moviephoto shootrear entry sexpillssufferingthunderpunched in the stomachporn starmiami floridatheatre audienceproducerblack eyemustachebruiseabusive husbandsunbathingwoman cryingrepeated scenefamily reunionpublishersnorting cocaineautographporn industryjukeboxvacuum cleanerfilm projector18 year oldfilm cameraloanporn actressfallinggiving a toastpool partyroller skatingdomestic abusestation wagonford mustangnervousnessprice of fameundressing someonecounter culturekiss on the cheekslapsexual humiliationsurname as titleadult filmmakingsubject name in titleends with biographical notesred carpetcoercionearringsabusive relationshipdoorbellmakeup artistrestaurant owneroysteradult film actressadult film starpornography actressblow up dollmalibu california21 year oldairport securitylie detectoraudio flashbackpill poppingblowing bubblesreference to grace kellysomersaultfreckleshit in the stomachfacial bruisefinancierirsmother slaps daughterpolygraphsexual revolutionvagina slurrollerskating rinkreference to johnny carsonadult bookstorechoking someoneadult film actorbell bottomsex u.s. marinegolden age of pornimitating fellatioreel to reel tape recorderwomen wearing a one piece swimsuitpulling down pantsroller rinkhusband wife fightkissing someone's stomachthrowing a telephonecollect call (See All)

Sea Of Love (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sea Of Love (1989)

Frank Keller is a New York detective investigating a case of a serial killer who finds the victims through the lonely hearts column in newspapers. Keller falls in love with Helen, the main suspect in the case.

Subgenre:
erotic thriller
Themes:
deathmurderjealousyinvestigationseductionextramarital affairparanoiaalcoholismpolice investigation
Mood:
neo noir
Locations:
new york cityrestaurantelevatorapartmentpolice station
Characters:
alcoholicpoliceafrican americanpolice officerserial killerdetectivepolice detectivepolice lieutenant
Period:
1980s
Story:
white briefsbriefsmale underwearmale rear nuditymale nuditybloodbare chested maleguncigarette smokingtitle spoken by charactersurprise endingcryingshot to deathshot in the headarrest β€¦dead bodyrevolvermanhattan new york citynewspaperfemme fatalegunshotsmokingshot in the shoulderspeechhandgunkissing while having sexrecord playerwaiterballoonelectronic music scoretitle based on songmale bondinghomicideapartment buildinggrocery storeboxer shortsbuddyblood on facesong in titledead mansuspectmidlife crisiswedding receptionvodkainvestigatorbuddy copjacketinfatuationobsessive lovewoman wearing only a man's shirtfatal attractionsingletelephone conversationphonographshoe storeafrican american manpastichepersonal adfemale star appears nudesource musicex husbandnewspaper adpeppertitle as songnaked dead mantitle from songlurecop having sex with suspectmusic score features saxophone45rpm record (See All)

The Girl On The Train (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Girl On The Train (2016)

The Girl on the Train is the story of Rachel Watson's life post-divorce. Every day, she takes the train in to work in New York, and every day the train passes by her old house. The house she lived in with her husband, who still lives there, with his new wife and child. As she attempts to not focus o β€¦n her pain, she starts watching a couple who live a few houses down -- Megan and Scott Hipwell. She creates a wonderful dream life for them in her head, about how they are a perfect happy family. And then one day, as the train passes, she sees something shocking, filling her with rage. The next day, she wakes up with a horrible hangover, various wounds and bruises, and no memory of the night before. She has only a feeling: something bad happened. Then come the TV reports: Megan Hipwell is missing. Rachel becomes invested in the case and trying to find out what happened to Megan, where she is, and what exactly she herself was up to that same night Megan went missing. (Read More)

Subgenre:
suspensemelodramapsychological thriller
Themes:
feardeathmurderfriendshiprevengemarriageinfidelitybetrayaljealousypregnancydrunkennessescapeinvestigationdeceptionvoyeurism β€¦memoryextramarital affairangerpsychopathparanoiadepressionredemptiongriefhome invasionpanicunemploymentamnesiaaffairpolice investigation (See All)
Mood:
nightmareneo noir
Locations:
train stationnew york citybarrestauranttrainforestcarmotorcyclebathtubwoodsapartmentpolice stationpolice cartunnelsex in shower β€¦sex in the woodssex in woods (See All)
Characters:
alcoholichusband wife relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipfemale protagonistdetectivebabyartistpolice detectivepsychiatristex husband ex wife relationshipcrying babypolice sergeant
Story:
dangervoyeurbare buttdreamwoman on topfemale frontal nuditymale rear nuditybased on novelfemale nuditysex scenebloodmasturbationkissf ratednudity β€¦violencebare breastsinterviewflashbackbare chested malefemale rear nuditynipplesphotographknifesurprise endingpantiesshowertopless female nudityvoice over narrationcryingcell phonebeatingcorpseblood splatterblondeslow motion scenecomputerarrestsex in bedsecretpaintingrunninghallucinationalcoholcriminalf wordsubjective cameranew yorkstrangulationtoplesswomanstabbed to deathnonlinear timelinebrunettefalse accusationno opening creditsdrawingdouble crossnews reportattempted murderpublic nuditystalkerbeaten to deathfired from the jobfantasy sequencecharacter's point of view camera shotmissing personcover upknocked outfemale full rear nuditymanipulationdisappearancestalkingdeath of husbandlaptoppolicewomanpremarital sexsuspiciongardenprofanitytherapycheating wifehatemaniactopless womaneavesdroppingrevelationaddictionsociopathjoggingbeardbuttockscrying womantherapistdriving a carart galleryfollowing someonenaked womanblood on facestabbed in the throathatredpool tablestabbed in the necknippleblood on shirtcellphonebalconyred pantiesdark pastdivorceephonefemale in showerabusive husbandneighborhoodswearingmiscarriagelyingnannywoman in bathtubmemory lossimpotencetaking a showerdark secretviolence against womenreference to facebookplaying pooltwist endingnudesuit and tiegolf clubblackoutrear nudityshoutingwhodunitfacebooknihilismstrong languageman kills a womanscene of the crimewoman kills a mancowgirl sex positiondomestic abusenymphomaniacfemale coptragic pastimprovised weaponflashback within a flashbackalcoholics anonymousnakedwrongful arrestbreaking a bottle over someone's headbreaking a mirrorsex from behindjealous husbanddrunken womanloss of memorysex addictiondecomposing bodyenglishwoman abroadborderline personality disorderfemale in a showerlearning the truthbutt nakedsex addictbritish actor playing american characterdead husbandsnorricamwoman's bare buttbeer bottlehit with a rockmissing womanipadsex with neighborwoman in a bathtubdrunk womanbludgeoned to deathmurder of a pregnant womantherapy sessionfemale full back nudityunreliable narratorquitting jobex husbandwoman showeringbare assnaked outdoorspool ballcorkscrewsplashed with watergrabbed by the throatwoman beaterman and woman naked in bednihilistbath tubnude showerself defenceshoweringnarcissistic personality disorderpositive pregnancy testwriting on a mirrorcowgirl sexmentally disturbed personlipstick on mirrornaked woman in beddiscovering one is pregnantwife kills husbandgaslightinggetting drunknude outsidefemale back nuditykilled with a knifesplashing wateralcoholics anonymous meetingnude woman in showervoice messagedeath of ex husbandangry husbandburner phone (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Very Long Engagement (2004) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Very Long Engagement (2004)

Five desperate French soldiers during The Battle of the Somme shoot themselves, either by accident or with purpose, in order to be invalided back home. Having been "caught" a court-martial convenes and determines punishment to be banishment to No Man's Land with the objective of having the Germans f β€¦inish them off. In the process of telling this tale each man's life is briefly explored along with their next of kin as Methilde, fiancee to one of the men, tries to determine the circumstances of her lover's death. This task is not made any easier for her due to a bout with polio as a child. Along the way she discovers the heights and depths of the human soul. (Read More)

Subgenre:
epicperiod drama
Themes:
feardeathmurderfriendshiprevengemarriageinfidelitychristmasghostjealousyadulteryprisonpregnancydrinkinginvestigation β€¦memoryextramarital affairtheftdeath of fatherdeath of motherpovertyunfaithfulnessexecutionhopeadoptionblindnessvengeancewealthamnesiacheatingstarvationrevenge murder (See All)
Mood:
nightmarerain
Locations:
train stationcemeteryhospitalbarrestauranttrainchurchmotorcycleairplaneparis franceboatbathtubbusbicycleelevator β€¦wheelchairfarmfrancetruckmuseumtunnelairshipwar zonebus accidentmilitary hospitalmilitary cemeteryairplane bomb (See All)
Characters:
husband wife relationshipfriendsingerboyteenage girlprostituteteenage boyfemale protagonistgirlsoldiernursedetectivephotographerpriestthief β€¦single motherpsychiatristfrenchgermanpimpself mutilationuncle niece relationshipaunt niece relationshipfiance fiancee relationshipmilitary officergerman soldierfrench soldierblood revenge (See All)
Period:
1920s1910s
Story:
haircutspidercrossaccidentwidowdreambased on novelfemale nuditysex scenemasturbationkisssexnudityflashbackdog β€¦guncigarette smokingphotographexplosionsingingpistoltelephone callvoice over narrationcryingsongcorpseunderwearfoodmachine gunmirrorurinationface slapcatcameradrinkbattlelettershootinglierifletearsbombdead bodycafecriminalcombatsubjective cameraorphanbound and gaggedwinedisguisestabbingeatingarmyprisonerhousenonlinear timelinenunchildbathfemme fatalegraveyardfive word titlepainattackumbrellamassagemissing persontankfarmerdeath of brotherdisappearancesadnessratworld war onegardenfireworkslove interestkissing while having sextypewriterbattlefieldrecord playertwenty somethingprivate detectiveeyeglassescaptainhand grenadesyringegrenadewoundhypodermic needlecakehelmetsurvivorrecordingtied to a bedmousepatientcrucifixloss of loved onesergeantgaggedrailway stationend of the worldfateburialcannonfloodbombingveteransufferingbootsanimated sequencepost traumatic stress disorderblack and white sceneblack and whitedungeonslaughterlieutenantfieldpajamaswar crimechallengemudlighthousebarbed wirebeheadingdead animalpost warlocal blockbusterpostcardspiral staircasestreet marketbroken mirrorasthmaanarchypocket watchbayonetdeath penaltyday in titleshot in the handashestop secretcowardmarriage engagementchapelpostmanmusic boxtitle same as booksome scenes in black and whiteteenage crushcarpentercircular staircasemailmanbrittanysurrendertrapdoorpolishbiplanefirecrackerguillotinewar criminaltrenchcryptchildhood sweetheartpancakechurch belldeserterred crosscourt martialmascotventriloquistcorporalfreezingfrench armywhorehousepneumoniaartilleryhangarwoman in a wheelchaircrawlinggunpowderseine riverunwed motherwelderhands tied behind backsyphilischurch choirtrain crashcold the temperaturehand woundmorse codemulezeppelinpoliodeliriumbell toweryear 1917life insuranceburning a photographtrench warfaredead horsemilitary enlistmentperiscopereference to joan of arcstabbed with a bayonetwar injurypostal workerpyromaniacwar victimwhat ifpardonmarseille provencebed riddenyear 1919gendarmehard laborrationingwar atrocityhot chocolatependulumtubaclassified informationbicycle messengerdistress signalgangrenemilitary secretregimentarmisticedinosaur skeletonmaraudersepiaalbatrossno man's landfrontlinecondemned to deathhydrogensenegalesetruffleaerial bombinginquestyear 1920ardenneslighthouse keeperstabbed in the buttlourdes francemess hallsome scenes in muted colortrenchesperigordcircumstantial evidencebotanic gardencountry bumpkinreference to baudelairesearching for the truthspanish fluself inflicted woundstabbed with a glass shardswimming championburned handinfantrymanmechanical handrun over by a trucksoaking one's feetsuperimpositionanimate toyartificial handdug outfour leaf clovermustard gasreference to marshal petainshow offgravelbotanical gardenunexploded bombbomb craterbretonsete franceverdunvintage film cinematographycorsicandog flatulencepick up sticksroazhonsea birdsepia tinted sceneshooting a mirrorstretcher bearertelephone wireticket inspector (See All)

Videodrome (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Videodrome (1983)

Max Renn runs a TV channel, and when looking for new material to show--he discovers "Videodrome." His girlfriend, Nicki Brand, goes to audition for the show, and Max gets drawn into the underlying plot that uses the show as its front for a global conspiracy.

Subgenre:
independent filmcult filmsuspenseconspiracyvideocyberpunkbody horrorcorporate conspiracy
Themes:
insanityfearsurrealismdeathmurderrevengesuicidebetrayaltortureescapedeceptionseductionparanoiaexploitationpanic β€¦philosophytechnology (See All)
Mood:
nightmaregoresatireambiguous ending
Locations:
restauranthotelapartmentusa
Characters:
lustjapanesepsychiatristprofessorsecretaryself mutilationengineerwriter directorself inflicted gunshot woundsuicide by shootingsuicide by shooting one's self in the head
Period:
1980s
Story:
dangerbare buttdreamfemale frontal nuditymale rear nudityfemale nuditymale nuditymasturbationbloodsexnudityviolenceone word titleflashback β€¦bare chested malegunfemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterexplosionsurprise endingpistolfirecorpseshot to deathblood splattershot in the chestface slapshot in the headwritten by directorcondomheld at gunpointbombhallucinationtelevisiontelephonebound and gaggedstrangulationtied to a chaircultanti heroassassinationdouble crossnews reportshot in the foreheadattempted murderlimousinemicrophonefantasy sequenceauditionlong takemanipulationscarexploding bodypremarital sexshot in the armlove interestwhippingcult directorpizzapornographyrevelationelectronic music scoregothicshot in the stomachscene during opening creditsred dresstied to a bedmediavideotapecovered in bloodgrindhousevirtual realitysadomasochismmind controlmilksocial commentarywhipdark humordisembowelmentperversionalternate realitycorporationkilling spreegothintestinesvideo tapemysterious manbrainwashingworld dominationnight visionelectronic musicblack marketradio stationpiercingpornographersnuff filmfight the systemfilmed killinghomeless persontelevision setceomurder spreephilosophersocial decayvcrextreme close upman slaps a womanshoulder holstersex on first dateman slaps womanreference to sigmund freudhidden guntv stationtalk show hosttumorgarroteman hits womanconferencejamaicanhand through chestvisionaryradio hostactress breaking typecastremadeabsurd violenceheadsetsubliminal messagetrailer narrated by percy rodriguezacting musiciancanuxploitationabandoned shipentrailssatellite dishassimilationvirtualityabandoned churchillegalityspectacleshole in chestpinunderground pornographymovie reality crossovervideo recordercable tvtv show within a filmtrade showtelevision executiveblurred boundariesboat yardopticiangimp masktoronto canadapirate broadcastsatellite televisiontelevision as portaldesensitizationvideo libraryagony aunt (See All)

Oldeuboi (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Oldeuboi (2003)

Abducted on a rainy night in 1988, the obnoxious drunk, Oh Dae-Su, much to his surprise, wakes up locked in a windowless and dilapidated hotel room, for an unknown reason. There, his invisible and pitiless captors will feed him, clothe him and sedate him to avoid committing suicide, and as his only  β€¦companion and a window to the world is the TV in his stark cell, the only thing that helps Oh Dae-Su keep going is his daily journal. But then, unexpectedly, after fifteen long years in captivity, the perplexed prisoner is deliberately released, encouraged to track down his tormentor to finally get his retribution. Nevertheless, who would hate Oh Dae-Su so much he would deny him of a quick and clean death? (Read More)

Subgenre:
martial artscult filmconspiracy
Themes:
writinginsanityfeardeathmurderlovefriendshiprevengesuicidekidnappingmoneyjealousypregnancydrinkingtorture β€¦incestmemoryangerlonelinessdeath of motherguilthumiliationsurveillancedeath of wifemadnessfather daughter incestmurder of mothermurder of sister (See All)
Mood:
rainneo noirhigh school
Locations:
new york cityrestauranthotelsnowbicycletaxielevatorpolice stationrooftopchinese restaurantcatholic school
Characters:
catholichusband wife relationshippolicefather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdoctortattoosingerbrother sister relationshipbabyolder man younger woman relationshipself mutilationcatholic priest β€¦suicide by gunshotchinese foodmysterious villainsuicide by jumpingjapanese food (See All)
Story:
hair salonscissorshaircutfemale nuditybloodkissviolenceone word titleflashbackdogfightcigarette smokingphotographtitle spoken by charactersinging β€¦knifechasesurprise endingshowertelephone callvoice over narrationcryingcell phonesongbeatingcorpseblood splatterfistfightfoodurinationshot in the headslow motion scenewatching tvcomputercameradrinkundressingbrawlsecretfalling from heightshootingbookvomitingheld at gunpointhand to hand combatsunglassesrunningbirthdaycafebathroomhallucinationprayermanhattan new york citytelevisionfightingsubjective cameranewspaperflashlightbased on comic bookstrangulationstabbingmontageeatingsuicide attempttoiletsubwaynunanti heropainon the runflash forwardbeaten to deathprologuebased on mangafantasy sequencepay phonefugitiveumbrellacharacter's point of view camera shotsuitcasebaseball batringdiarylong takebodyguardinjectionsplit screentied uptrustflirtingeavesdroppingtv newsgamehypodermic needletape recorderfaintingcomic bookrecordinghong kongcaptivehammerbrother sister incestschizophreniagas maskremote controlhaunted by the pastbloody noseinnocenceanimated sequencehatredkickingmutebroken glassnewsreel footagetitle appears in writinghypnosisbible quotedeath of sisterbody landing on a carprison cellsnowingworld trade center manhattan new york cityframed for murderphoto albumsinimprisonmentearphonesnotebookbirthday presentbandagekoreatelephone boothkoreangun held to headanimal crueltytape recordinganthypnotismwrongful convictionaudio cassetteteethsouth koreaextreme violencemurder of wifesushioctopusin medias respsychological torturedeath by drowninghit with a hammerwrongful imprisonmenthusband murders wifedelivery boystockholm swedenflash camerastabbed with scissorsswedishpassing out911chopstickshandkerchiefhair dryerpenthousesevered tonguekilled in an elevatorfoster parentschoolmatechat roompleadingcuckoo clockice pickinternet cafereference to princess dianahypnotistwallpaperear bleedingimmunityknife in backtongue cut outclaw hammerdumplingsedationseoul koreaschool yearbookstabbed in the eartooth ripped outwanting to dielaser pointersense of tastepost hypnotic suggestionshadow boxingthrown from a buildingmemory gamescuff linksbrother murders sisterschool matesuppositorysurveillance vanbiting a handpunching one's fist into a wallteeth extractiondental tortureshower captooth tortureobscure meaningsilent henchman (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Shipping News (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Shipping News (2001)

An inksetter in New York, Quoyle returns to his family's longtime home, a small fishing town in Newfoundland, with his young daughter, after a traumatizing experience with her mother, Petal, who sold her to an illegal adoption agency. Though Quoyle has had little success thus far in life, his shippi β€¦ng news column in the newspaper "The Gammy Bird" finds an audience, and his experiences in the town change his life. Then he meets the widow Wavey... (Read More)

Subgenre:
tragedy
Themes:
deathkidnappingmarriageinfidelityrapeadulterypregnancydrunkennessinvestigationmagicincestmemoryangerpovertyredemption
Mood:
nightmarerain
Locations:
hospitalbarsnowsmall townboatnightclubvillagewoodsrural settinglakeshipcanadaoceancampfirestorm β€¦boat accident (See All)
Characters:
writerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrendetectivemusicianphotographerbabylittle girlsingle motherlittle boyemployer employee relationship β€¦single fatherfishermanaunt nephew relationship (See All)
Period:
winter
Story:
urnaccidentwidowdreamwoman on topbased on novelsex scenekissflashbackphotographpartythree word titlepantiescryingcorpse β€¦car accidentrescuecomputercamerathongvomitingtearscar crashislandrivertelevisiontelephonereporterdecapitationsurvivalnewspaperbracandleambulancebridgedinerhousemapfishdinnerdrivingsevered headritualsearchvoice overgraveyardbartendercursewidowerfactorydolllightningscreamisolationunderwaterreference to william shakespearetypewriternewspaper headlinesingle parentchainsawiceropetraditionpirateteawoundreference to adolf hitlerbabysitterbuttockstimeirishjournalismcompassionback from the deadwatching televisionremote controlhaunted by the pastlandscapethunderplaygroundjob interviewsuperstitionice skatingice hockeyseasidecasual sexmarital problemferryweathersymbolismadulterous wifeauntbandageparenthoodmetaphoraccordionmental retardationoutsidersweatnewspaper articlekiteleukemiahearsebody bagfeverashesrainingsewing machinewakestorygravestonecarpenterritemortalitycustomnewspaper editorcar wreckatlantic oceanmoosestarting overvisionscadaverpulitzer prize sourceancestordesertioncableouthousepaper airplaneprinterwirepatternpiracyincest rapenewfoundland canadanewspaper officehockey gamedeath in familyice skatescovenursery schoolnotesabusive wifecapsizeibmcairnreference to robert burns (See All)

Blue Velvet (1986) is one of the best movies like De Vierde Man (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blue Velvet (1986)

College student Jeffrey Beaumont returns to his idyllic hometown of Lumberton to manage his father's hardware store while his father is hospitalized. Walking though a grassy meadow near the family home, Jeffrey finds a severed human ear. After an initial investigation, lead police Detective John Wil β€¦liams advises Jeffrey not to speak to anyone about the case as they investigate further. Detective Williams also tells Jeffrey that he cannot divulge any information about what the police know. Detective Williams' high school aged daughter, Sandy Williams, tells Jeffrey what she knows about the case from overhearing her father's private conversations on the matter: that it has to do with a nightclub singer named Dorothy Vallens, who lives in an older apartment building near the Beaumont home. His curiosity getting the better of him, Jeffrey, with Sandy's help, decides to find out more about the woman at the center of the case by breaking into Dorothy's apartment while he knows she's at work. What Jeffrey finds is a world unfamiliar to him, one that he doesn't truly understand but one that he is unable to deny the lure of despite the inherent dangers of being associated with a possible murder. Still, he is torn between this world and the prospect of a relationship with Sandy, the two who are falling for each other, despite Sandy already being in a relationship with Mike, the school's star football player. (Read More)

Subgenre:
independent filmcult filmpost modern
Themes:
surrealismdeathmurderkidnappingdrugsrapejealousygangstervoyeurismpsychopathobsessionblackmailsurveillancealcoholismblindness β€¦murder of a police officerpolice corruptionamerican mythology (See All)
Mood:
nightmaregoresatireneo noircar chaseavant garde
Locations:
hospitalsmall townnightclubbrothel
Characters:
father son relationshippolicemother son relationshipfather daughter relationshipsingerserial killerstudentdetectivelove trianglepolice detectivevillainolder woman younger man relationshipwriter directoramateur detectiveshooting a police officer β€¦go go dancer (See All)
Story:
talking while drivinggraphic violenceconvertiblemale pubic hairvoyeurmale full frontal nudityfemale frontal nuditymale frontal nuditymale rear nudityfemale nuditymale nuditysex scenesexnudityviolence β€¦two word titlegunfemale rear nudityfemale full frontal nudityknifeleg spreadingcorpseshot to deathface slapshot in the headsecretbeerhallucinationcolor in titlerevolvergood versus evildrug dealerdinerfemale pubic haircontroversyfemme fataleshot in the foreheadpublic nuditysuburbstripteasewigsilencercult directorcorrupt copbreaking and enteringtitle based on songmutilationwalkie talkiedrug abuseassaultsadomasochismpeeping tombroken legwoman in jeopardyswitchbladedark humorinsectpsychotronicsong in titleblack eyemusical numberperversionmisogynyblack bra and pantiesdoppelgangerhiding in a closetforced to stripsex slavemasochismstrokescene of the crimeamericanashot in the handurinatingwoman in lingerielip synchingflamegrasswaking upbutcher knifepsychotronic filmdreamingsexual obsessionsexual humiliationstairwellhardware storetitle appears in songsevered earsexual predatorhigh school footballoxygen maskhandballexterminatorfire engineblack lingerieloss of innocencestrong sexual contentgomorrahymuscle carinnocence lostlounge singerclichekidnapped childtouching someone's breastspsychological abusemystery womanspying on someonehornsdance partyhyperrealismfull circlekiller coprobinpaladinsexual aberrationmiddle americaheineken beernon statutory female on male rape attemptamyl nitratefront yardhorusalienated sexualityosirissmall town stereotypekidnapped manman in disguisekabuki makeup (See All)

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy
Themes:
insanityfeardeathmurderfriendshiprapeghostpregnancymonsterinvestigationpsychopathbrutalitysupernatural powerdepressionsadism β€¦eviltrauma (See All)
Mood:
nightmaregoreslasher
Locations:
hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident
Characters:
alcoholicfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernurse β€¦babyartistreference to godlittle girlsingle motherwaitresskillerlittle boyvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
spiderdangeraccidentbare buttdreamfemale nuditybloodsexf ratednudityviolencebare breastssequelflashbackbare chested male β€¦gunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingblood splatterfoodcar accidentslow motion scenewatching tvfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibraryscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendcrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to De Vierde Man?
<< FIND THEM HERE! >>