Please wait - finding best movies...
Strangers awaken in individual holding cells with no memory of how they arrived. They realize if they don't acquire enough online "likes" in a timely manner, they'll die horribly at the hands of a sinister executioner.
Subgenre: | sword and sorcery |
Themes: | naturememorytortureprison |
Mood: | gore |
Characters: | self mutilationvillainpolice |
Story: | burnt alivehooded figurebody partssocial mediaexploding headbad decisionstorn apartsound effectsfigurefeelingdeviceideaalivecheapoutfit β¦gorytalkclaustrophobicbloodytoolboxrulesstoriesgruesomefunheadcontestantfranchisesnuffcheckeyessorcerycinematographercellmenacesocialcluecastingbodyattractionmakeupwhipfanteamexplosivetrappedskullhammermutilationgamesacrificeinternetsurvivalswordbloodviolence (See All) |
Jeff is an anguished man, who grieves and misses his young son that was killed by a driver in a car accident. He has become obsessed for revenge against the man and reckless with his wife and daughter. When Dr. Lynn Denlon, who has troubles with her marriage, is abducted by the deranged Jigsaw's app β¦rentice Amanda, she is brought to a gruesome warehouse to keep John Kramer alive in spite of having a terminal brain tumor. Amanda puts a necklace gadget full of explosives around Dr. Lynn's neck connected to John Kramer's life support system, and tells her that if he dies the device will explode. Meanwhile, Jeff is submitted to a sick game of forgiveness with surprising dark consequences. (Read More)
Subgenre: | survival horrorsadistic horror |
Themes: | torturemurderdeathrevengekidnappinginfidelitybetrayalextramarital affairpsychopathbrutalitysadismhome invasionmurder of a police officer |
Mood: | gore |
Locations: | hospital |
Characters: | self mutilationpoliceafrican americandoctorserial killernursedetectivepolice detectivepolice shootoutsingle father |
Story: | exploding headdevicealivegruesomemutilationgameviolencebloodfemale nuditysequelfemale frontal nudityflashbackbare chested malegunfight β¦female full frontal nudityphotographknifesurprise endingpistolshootoutcorpseblood splattercar accidentshot in the chestshot in the headshotgunslow motion scenevomitingheld at gunpointbombrevolvershot in the backdecapitationaxethroat slittingstabbed in the chestnonlinear timelinejudgesevered headchild in perilthird partshot in the legdrowninglatex gloveslocker roomrace against timeevil manexploding bodywitnesstrapsevered armdismembermentsingle parentsurgerychainsawsyringegothiclifting someone into the airloss of wifecaucasianvideotapeswat teambroken legreverse footagegash in the faceshot in the facestabbed in the headdisembowelmentbooby trapaccidental killingbroken armsevered legchainsequel to cult favoritegothsuffocationreturning character killed offgun in mouthshot in the necktimebombaciddrunk drivingfemale psychopathmind gamescalpelscene of the crimeloss of childshot in the throatfemale copslaughterhousemurder of a nude womansevered footapprenticebroken neckhookbrain tumorno endingstabbed in the footevil dollbrain surgerycriminal mastermindfrozen bodypower drilldummygame of deathentrailshypothermiafreeze to deathmurderer duoexposed braindrill in the headsplit headpig maskplaying godhead spinpig slaughterfamous themesuffocated with plastic bagnecklace bomb (See All) |
Arkin escapes with his life from the vicious grips of "The Collector" during an entrapment party where he adds beautiful Elena to his "Collection." Instead of recovering from the trauma, Arkin is suddenly abducted from the hospital by mercenaries hired by Elena's wealthy father. Arkin is blackmailed β¦ to team up with the mercenaries and track down The Collector's booby trapped warehouse and save Elena. (Read More)
Subgenre: | martial artssurvival horrorsadistic horrorhorror b movie |
Themes: | torturemurderdeathrevengekidnappingescapetrauma |
Mood: | gore |
Locations: | hospitalnightclub |
Characters: | self mutilationhusband wife relationshipfather daughter relationshipbrother sister relationshipserial killerfatheryounger version of charactermysterious villainserial murdererkiller dog |
Story: | exploding headteamtrappedskullviolencebloodfemale nuditysequelflashbacktwo word titlebare chested maledancingtitle spoken by characterexplosionparty β¦knifelesbian kisschasesurprise endingpistolcorpseshot to deathblood splatterfistfightshot in the chestshotgunslow motion scenepunched in the facecar crashsubjective cameramassacredeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headanti herochild in perilnews reportcharacter repeating someone else's dialoguestabbed in the backperson on firecharacter's point of view camera shotkicked in the faceskeletonexploding bodytrapcharacter says i love youmercenaryex convictsevered armobscene finger gesturedismembermentsyringegrenadeburned alivekilling an animalwarehousemass murdertied to a bedstabbed in the stomachspiderswat teammexican standoffcrushed to deathbroken legmasked mancamera shot of feetswitchbladesevered fingergash in the facejunkietitle appears in writingthrown through a windowassault riflebooby trapknife fighttitle at the endslaughterbody landing on a carraised middle fingerlens flarebroken armrescue missionsevered legmasked killerfirefightertorso cut in halfimpersonating a police officerserial murdercrucifixionstabbed in the handbrainwashingmazekilling a doggerman shepherdstandoffstabbed in the armhanging upside downbody in a trunkcrashing through a windowheld captiverazor bladecrushed headravestabbed in the shouldergraphic violencecheating boyfriendstabbed in the facehomeless personcut into piecesclose up of eyegrindhouse filmcaptivityreturning character with different actorcoercionbear traphung upside downflickering lightwoman punches a manswattied to a tablecadavercircular sawbreaking a car windowsevered tonguegiallo esquehearing aidstrapped to a bombpeepholearm casthuman skeletonstabbed through the chinlocked in a cageteam uptrip wireabandoned hotelhung from a hookiron maidenrube goldberg machinebuilding firefusepleading for helpclimbing down a ropenailed to a wall (See All) |
Fifteen years after a horrifying experience of abduction and prolonged torture, Lucie embarks on a bloody quest for revenge against her oppressors. Along with her childhood friend, Anna, who also suffered abuse, she quickly descends, without hope, into madness and her own delusions. Anna, left on he β¦r own begins to re-experience what Lucie did when she was only twelve years old. (Read More)
Subgenre: | sadistic horrorfrench horror |
Themes: | torturemurderdeathrevengesuicidefearescapeangerbrutalitysupernatural powerinsanitysadismcrueltyafterlifemurder of family β¦starvationlesbian love (See All) |
Mood: | gorenightmarebleakness |
Characters: | self mutilationhusband wife relationshipmother daughter relationshipbrother sister relationshipgirlyounger version of charactersuicide by gunshot |
Period: | year 1971 |
Story: | bloodyeyeshammermutilationviolencebloodfemale nudityf ratedone word titlebare chested malefemale rear nudityphotographtitle spoken by characterlesbian kisssurprise ending β¦showercryingbeatingcorpseshot to deathblood splattershot in the chesturinationface slapshot in the headshotgunpunched in the facevomitingdead bodybathroomhallucinationhandcuffsshot in the backthroat slittingprisonertied to a chairchild abusecultchild in perilpaingravebeaten to deathevil manwitnessmurdererhatewoundcaptivephone boothgrindhousevictimladderorphanagepresumed deadhaunted by the pastsufferingpunched in the stomachplot twistdead boychloroformatheistbrainwashingmysticismtestimonygun in mouthsuccessfriendship between womendisposing of a dead bodyhead bashed inecstasywrist slittingheld captivemercedes benzshot through the mouthevil womanchainedextreme violencegraphic violencemartyrmurderesshit with a hammertrapdoorfemale victimmurder of a nude womandragging a bodynew ageviolent deathstraight razorcaptivitybloody body of a childshacklestorture chamberlife after deathemaciationexposed breastfanaticismhandcuffed womanincarcerationskinned aliveperversitysingle locationsuperficialitytranscendencemartyrdomforce feedinghell on earthwoman as objectobjectificationabuse against womenfrench shock cinemapretensionsurvivor guiltnail in the headpseudo intellectualshroudvindicationhandcuffed behind backsecret entrancequest for knowledgelong sufferingsmashing through a windowhidden staircasehistorical referencefalling through a glass doorunderground complex (See All) |
Jigsaw and his apprentice Amanda are dead. Now, upon the news of Detective Kerry's murder, two seasoned FBI profilers, Agent Strahm and Agent Perez, arrive in the terrified community to assist the veteran Detective Hoffman in sifting through Jigsaw's latest grisly remains and piecing together the pu β¦zzle. However, when SWAT Commander Rigg is abducted and thrust into a game, the last officer untouched by Jigsaw has but ninety minutes to overcome a series of demented traps and save an old friend or face the deadly consequences. (Read More)
Subgenre: | survival horrorpolice procedural |
Themes: | torturemurderdeathrevengekidnappingrapepregnancyinvestigationbrutalityobsessiondepressionsadismmadness |
Mood: | gore |
Locations: | hospitalschoolhotelpolice stationmotelabandoned factory |
Characters: | self mutilationpolicehusband wife relationshipprostitutepolice officerserial killerdetectivehostagelawyerpolice detectivepolice shootoutpimpengineercoroner |
Story: | hooded figureexploding headhammergameviolencebloodnumber in titlemale nuditysequelflashbackmale frontal nudityfightphotographknifesurprise ending β¦pistolshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuebrawlheld at gunpointdead bodyinterrogationrevolvercriminalf wordbound and gaggedaxemassacrethroat slittingimpalementstabbed to deathsuicide attemptstabbed in the chesttied to a chairnonlinear timelinechild abusesevered headpolice officer killeddrug addictbeaten to deathkeyfbielectrocutionrace against timemissing personkicked in the facetrapthreatened with a knifesevered armdismembermentkillingcorrupt coprevelationsociopathcomafbi agentfourth partloss of wifevideotapeswat teamsevered handrapistcrushed to deathpresumed deadcrime scenefight to the deathstabbed in the throatgash in the facegunshot woundmutebroken glassjunkiestabbed in the legthrown through a windowdisembowelmentautopsybooby trapaccidental killingone dayeye gougingdisfigurementstabbed in the eyeabusive fathersevered legdead woman with eyes openlasersightpunchabusive husbandbloodbathmiscarriagemoral dilemmaphysical abusegothintestinesbarbed wirereturning character killed offshot in the neckclinicmind gamescalpelpolice interrogationglasswrist slittingdripping bloodcrushed headsawhanged manbleeding to deathshot through the mouthtwo way mirrorrighteous rageslaughterhousecut into pieceshit with a hammerblack copex wifecaptivityserial rapistfire alarmtortured to deathevil dollmausoleumpregnant woman murderedhotel managerwriting on a wallbodily dismembermentscalpinggame of deathviolent sexexposed braindeath trapstomachpig maskmouth sewn shutseedy moteleyes sewn shutfamous themefbi profilerloss of babymeat processing factory (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | independent filmcult filmslasher flicksurvival horrorsadistic horror |
Themes: | torturemurderkidnappingmarriageinfidelityescapeextramarital affairpsychopathcancerinsanityhome invasionclaustrophobiaself harm |
Mood: | gorecar chaseslasher |
Locations: | hospitalhotelurban setting |
Characters: | self mutilationpolicehusband wife relationshipfather daughter relationshipdoctorserial killerdetectivephotographerhostagekillerpolice detective |
Story: | bodytrappedgameviolenceone word titleflashbackgunsurprise endingpistolcorpseshotguncamerasecretbathroomrevolver β¦bound and gaggedthroat slittingstabbed to deathtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenedisembowelmentbooby trapbody countextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | independent filmcult filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
Themes: | torturemurderdeathsurrealismdrugsghostpsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia |
Mood: | gorerainhigh schoolnightmareslasherdarkness |
Locations: | small townairplaneroad trip |
Characters: | self mutilationvillainfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillerterroryounger version of characterdeafnessslasher killerserial murderergerman american β¦evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | exploding headgruesomeheadmutilationviolencebloodf ratedcharacter name in titlesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in title β¦title directed by femaledreamblood splatterrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hilldream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Set before the events of the previous films. As group of strangers awaken with no memory to find they have been involuntarily placed in a maze containing deadly traps, a young man whose job is to watch over the Cube endeavors to rescue a woman trapped within.
Subgenre: | survival horror |
Themes: | memorytorturedeathsurrealismfearescapevoyeurismpanic |
Mood: | gore |
Locations: | helicopterelevator |
Characters: | self mutilationreference to godlittle girlsniper |
Period: | 2000s |
Story: | exploding headtrappedsurvivalsequelflashbacksurprise endingrescuecomputerimpalementfishdream sequencedrawingkeyperson on fireexploding body β¦trapunderwaterchesssyringediseaseviruspuzzleback from the deadbarefootmanhuntco workersketchbooby trapalternate realitycanebody countroomprequelmemory lossvideo surveillanceparalysisspit in the facemathematicsacidshoeski masklocked in a roomburning manone eyed manobservationlobotomycount downsequel with unusual numbersketch artistblack outdart gunhuman guinea pighorror movie prequelpush buttontrapped in a roomblurry visionmother child reunionevaporation (See All) |
Ana goes home to her peaceful suburban residence, but she is unpleasantly surprised the morning that follows when her husband is brutally attacked by her zombified neighbor. In the chaos of her once picturesque neighborhood, Ana flees and stumbles upon a police officer named Kenneth, along with more β¦ survivors who decide that their best chances of survival would be found in the deserted Crossroads Shopping Mall. When supplies begin running low and other trapped survivors need help, the group comes to the realization that they cannot stay put forever at the Shopping Mall, and devise a plan to escape. (Read More)
Subgenre: | cult filmblack comedysuspensedark comedypost apocalypsesurvival horrorzombie apocalypseamerican horrorzombie outbreakfrench horrorcanadian horrorjapanese horror |
Themes: | murderdeathsuicidepregnancyfearbrutalitysadismapocalypsecannibalismself sacrificemadness |
Mood: | goredarknesshorror movie remakeblood and gore |
Locations: | hospitalhelicopterboatelevatorcitysex in showeryachtsewer |
Characters: | policezombiepolice officernursepolicemanbabyinterracial relationshipsecurity guardsniperterrorzombie baby |
Period: | 2000syear 2003 |
Story: | body partsexploding headtrappedsurvivalviolencebloodfemale nuditydogbare chested malegunexplosionsurprise endingpistolcorpseshot to death β¦blood splattercar accidentremakeshot in the headshotgunslow motion scenegunfightdead bodybathroomislandrevolverf wordsubjective cameragay sluraxevideo cameraambulancewomanmontageimpalementexploding carsevered headhit by a carshot in the legshot in the foreheadbinocularsprologuesuburbperson on firecharacter's point of view camera shotshot in the shoulderhairy chestchildbirthexploding bodyloss of fatherdie hard scenariodirectorial debutprofanityshot in the armhandgunsplatterchesschainsawmachismogolfwoundmass murdervirusloss of loved oneparking garageend of the worldgun fuback from the deadgun battleeaten aliverear entry sexshopping mallstabbed in the headinfectionaccidental killingsiegestabbed in the eyelens flaresurprise after end creditsbullet timetorso cut in halfpervertblood on camera lensliving deadkillhead blown offhideoutmallbullet balletshot in the eyeanarchyhillbillystrong languagegun duelfriends who live togetherconsumerismextreme violenceflesh eating zombiegraphic violencewalking deadcrowbarzombie violenceblack copstarvingbody partoutbreakzombie attackbitten in the throatmarinathroat rippingdoomsdaystudio logo segues into filmmidwestzombie childmayhembodily dismembermentflesh eatingactress breaking typecastevil deadgun storeanthropophagusgory violenceremake of cult filmzombificationairbageating human fleshhell on earthchainsaw murdercut in halfflesh eating zombiesdeadly diseasesurvivingend of civilizationcelebrity look alikezombie invasionviaducthuman versus undeadhuman versus zombiereference to dairy queenremake of sequel (See All) |
Deep in the lush jungles of the isolated Skull Island lies the habitat of the elusive, yet endangered and utterly vicious "Simian Raticus", or better known as by its common name, the Sumatran Rat-Monkey, a hideous mix of a virus-carrying slave-ship rat and a tree monkey. Presently, back in New Zeala β¦nd's Wellington, the oppressed Lionel Cosgrove who lives with his despotic mother Vera, has finally found his soulmate, Paquita, but sadly, his world will rapidly change when after a stroll at the local Zoo, a live specimen of the rare species will bite Vera. Now that she's got the "bite", with the infection spreading and turning Vera into a festering, puss-squirting living dead ravenous for flesh, things are bound to get out of hand, as an ever-growing collection of stiffs and other stimulant-enhanced zombie misfits detained in Lionel's house basement will demand immediate action. Poor Lionel he needs to step up and clear up the mess, but above all, summon the courage to confront his decomposing mummy and the family's ugly secret. Will he save the day? (Read More)
Subgenre: | independent filmmartial artscult filmblack comedydark comedyb movieb horrorbody horrorgross out comedyindependent horrorzombie outbreak |
Themes: | torturemurderdeathsurrealismbrutalitysadismexploitationcannibalism |
Mood: | gorespoof |
Locations: | backwoodsback country |
Characters: | self mutilationzombiepriestmotherterrorzombie lovezombie sexualityzombie babyzombie girl |
Period: | 1950s |
Story: | body partsexploding headalivemutilationviolencebloodone word titleflashbacktwo word titlepartyknifeblood splatterface slappunched in the facefalling from height β¦vomitinglow budget filmdecapitationimpalementtied to a chairsevered headanti herohit by a carcontroversydrowningbeaten to deathperson on firepoisonkicked in the faceattempted rapeexploding bodypremarital sexsevered armdismembermentundeadmonkeykilling an animalsevered handcovered in bloodcheating husbandback from the deadeaten alivemexicanreverse footagebloody noseinvasionspanishhit in the crotchcannibalgash in the facezookicked in the crotchbutchershovelstabbed in the headthrown through a windowsevered legnew zealandtorso cut in halfdead doglatinaliving deaddirector cameoburied alivespit in the facedomineering motherbody in a trunkhillbillydisembodied headextreme violenceflesh eating zombiewalking deadcut into piecestongue in cheekbreaking through a doorsevered footbutcheryheart in handzombie attackexploitation filmhead ripped offarm ripped offalternate versionstabbed in the mouthlawn mowerreanimationhand cut offface ripped offzombie childbodily dismembermentflesh eatingsevered facetrailer narrated by percy rodriguezanthropophagusover the topentrailshead cut in halfpart stop motionzombificationblenderleg ripped offstop motion scenegross outsex with the undeadzombie bitecult favoritejack danielscamera shot from inside human bodyhand through headsex with a zombieexploding eyeneedle in eyelawn gnomemutant babynagging motherwalking through a wallkilled with a lawnmowerzombie invasionforeign versiondead monkeyhouse burningzombie animallungs ripped out (See All) |
In order to avoid a ghostly figure in the road, high school senior Brent Mitchell wraps his car around a tree, killing his father. Constantly confronted by his mother's emotional collapse after the accident, Brent escapes into a marijuana fueled world of loud metal music to block the pain and guilt. β¦ Dejected and out of sorts, he has a shot at happiness with his girlfriend Holly, a grounded, caring girl with drop dead good looks, a dream date for the high school prom. But his plans are thwarted by a disturbing series of events that take place under a mirrored disco ball, involving pink satin, glitter, syringes, nails, power drills and a secret admirer. Brent has become the prom king at a macabre, sadistic event where he is the entertainment. (Read More)
Themes: | torturemurderdeathfriendshiprevengekidnappingdrugsjealousyfearescapeincestpsychopathdeath of fatherbrutalityobsession β¦dysfunctional familyinsanityhumiliationsadismunrequited lovecrueltycannibalismvengeancemadness (See All) |
Mood: | gorehigh schoolnightone night |
Locations: | small townaustraliapolice carsex in caroral sex in a car |
Characters: | self mutilationpolicefamily relationshipsmother son relationshipfather daughter relationshipteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boyhostageterrorself justice |
Story: | figuretoolboxhammersurvivalviolencebloodsexfemale nuditynumber in titledogbare chested malegunpartyknife β¦punctuation in titlecryingcell phoneblood splattercondomundressingrunningcar crashfightingflashlightstabbingstabbed to deathdrawinghit by a carfemme fatalemissing personscreamhigh school studentloss of fathertied upcharacter says i love youteenage sexpot smokingteen angstballoonragecaptiveloss of loved onedesperationvictimdead womanfemale killerconfrontationhatredmercilessnessgash in the facerejectionstabbed in the necktaking a pictureescape attemptheartdead manfamily dinnerdead motherphysical abuseparentspsychopathic killerstrugglerunning awaykilling a dogdead fatherlockerfemale psychopathdegradationmaking outinfatuationteenage daughterheld captiveobsessive loverazor bladepromatrocitycrazinesskiller childvolkswagenfatal attractionteenage crushmatricidesalthopelessnessrock climbingspoiled bratstabbed in the footforkhostilityenduranceemaciationhigh school dancerosesmale tied uprun over by a carhigh school prommad womandrill in the headsavagerycutterstruggle for survivalwill to liveprom queenself defencevictim invited to dinnerelectric drillprom dressmaking out in a cartroubled teenage girlfemale in brahole in the headprom kingbleeding footfemale jealousypsycho girl (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | suspensesupernaturalparanormalpsycho thriller |
Themes: | memorytortureprisonmurderdeathsuicidekidnappingmarriagerapeghostfearescapepsychopathsupernatural powerparanoia β¦drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | gorerainneo noirnightmareslasherdarkness |
Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
Characters: | self mutilationvillainpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipdoctortattoofemale protagonistserial killernursepolicemanlawyer β¦reference to godkillersecurity guardpsychiatristsheriffterrordoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | cellsurvivalviolencebloodsexfemale nudityf ratedfemale frontal nudityinterviewflashbackbare chested malegunkissfight β¦photographexplosionknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcorpseblood splattercar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingfoot chaseflashlightaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
Subgenre: | martial artscult filmblack comedychristian horror |
Themes: | tortureprisonmurderdeathrevengekidnappingbetrayalfeardrunkennessdeceptionvoyeurismangersupernatural powerpanicvengeance β¦murder of a police officerghost town (See All) |
Mood: | gore |
Locations: | bartrainchurchhotelsmall towndesertelevatormotelgas stationcampfirenew mexico |
Characters: | prostitutepolice officerpriesthostagetough guyvampireaction heroevil priest |
Period: | 1990s |
Story: | teamskullhammermutilationviolencebloodfemale nuditybased on novelnudityone word titlebare breastsfemale frontal nudityfemale rear nuditycigarette smokingphotograph β¦title spoken by characterexplosionpartyknifechasepistolfiretopless female nuditybeatingcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeface slapshotgunrescueslow motion scenepunched in the faceshowdownheld at gunpointcar crashinterrogationprostitutionvoyeurprayerrevolvershot in the backsubjective cameradecapitationgood versus evilcleavagegay slurbound and gaggedaxemassacreambulancethroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headanti heroscantily clad femaleritualsearchnews reportcigar smokingshot in the legtransformationshot in the foreheadpaingunshotlegendbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firemini skirtpay phonecharacter's point of view camera shotmissionknocked outlightningscreamshot in the shoulderpursuitcrossexploding bodyneck breakingtied upmercenaryshot in the armcult directorundeadpickup truckmachismowolfburned aliveno pantiesspearfarcemass murderjeepinjuryscene during opening creditstied to a bedsecurity cameracrucifixexploding buildingbuttocksphone boothsevered handeaten alivewatching televisionduct tape over mouthvisionthundercrossbowshot in the facehungershovelimmortalitycigarette lighterthrown through a windowslaughtergasolinelens flareburned to deathexorcismtelepathytorso cut in halfceremonystolen carsunsetcrucifixiongatebandagespit in the faceold dark housesuper strengthnudedisposing of a dead bodyfemale vampiregunslingernude girlbellsawed off shotgunlatinbitten in the neckman punching a womansunrisewindmillcarjackingriteiconvampire huntermind readingreliccamera focus on female buttvampire slayerfalling through the floorthroat rippingblood drinkingsuper speedsliced in twocardinal the priestnestarmored truckbitten on the armhand through chestmusic score composed by directorcablesteakstabbed in the heartburnt handstabbed in the foreheadover the topvampire bitevampire human lovemurdered priestcorrupt priestwooden stakebitten on the legpetrolvampire human relationshipfrenzysexy female vampirecauterizationmaster vampirenude woman tied uppadrerear end (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | cult filmblack comedysuspensepost apocalypsecreature featurezombie apocalypseamerican horrorsadistic horrorzombie outbreakfrench horrorcanadian horror |
Themes: | murderdeathsuicidefearracismbrutalitysadismgreedapocalypsecannibalism |
Mood: | goredarknessblood and goresequel to cult horror |
Locations: | urban settingcitytruckgas station |
Characters: | villainafrican americanprostitutezombie |
Period: | 1990syear 1995 |
Story: | body partsexploding headgruesomeviolencebloodfemale nuditysequelexplosionlesbian kisspistolshootoutcorpseshot to deathblood splattermachine gun β¦car accidentshot in the chestshot in the headrescuearrestshootingdead bodyjailriverdecapitationdeath of friendexploding carsevered headdouble crossshot in the legshot in the foreheadracial slurlimousineperson on fireelectrocutionkicked in the faceshot in the shoulderexploding bodyratmercenaryshot in the armcult directordismembermentundeadblood spatterarsonsplatterdisasterhead buttmachetevirusfourth partassaultsevered handskateboardrocket launcherend of the worldback from the deadeaten alivesevered fingerfight to the deathgash in the faceshopping mallbutcherdisembowelmentracistsiegesevered legethnic slursequel to cult favoritetorso cut in halfmexican americanbad guybeheadingliving deadkillgun in mouthskyscraperslashingfortressshot in the eyemeat cleaverburnt bodyshot through the mouthextreme violenceshot in the throatflesh eating zombiegraphic violencewalking deadbloody violenceburn victimshot in the crotchsevered footbutcheryevil clownbody partoutbreakzombie attackpittsburgh pennsylvaniastairwellbitten in the throatliquor storehung upside downdoomsdayauto theftsliced in twofireworklawnmowerbitten handbodily dismembermentflesh eatingdisturbingevil deadanthropophagusgory violencespear guneast coastzombificationhell on earthman eaterblown to piecesdrawbridgezombie biteabandoned citydeadly diseasebrutalmonster as victimhole through torsopiercing ripped outthrowbackzombie with gunzombie invasionzombie clown (See All) |
Sharon Da Silva wakes up every night screaming about "silent hill". Pursued by a police officer suspicious of her motives and swerving to avoid another child her adoptive mother crashes the car knocking herself unconscious. When Rose Da Silva awakens to find her adopted child is missing, she searche β¦s the fog and ash blanketed town for her beloved daughter. (Read More)
Themes: | torturemurderdeathfriendshiprevengesurrealismreligionbetrayalghostmonsterbrutalitysupernatural powersadismfaithhope β¦self sacrificemurder of a police officermissing childghost townreligious cult (See All) |
Mood: | gorerainnight |
Locations: | hospitalschoolhotelelevator |
Characters: | policemother daughter relationshipgirlpolice officernursepolicemanlittle girlwitchreligious fanatic |
Story: | trappedmutilationsacrificesurvivalviolencebloodfemale nudityflashbackgunphotographtitle spoken by characterknifepistolcell phoneblood splatter β¦car accidentrescuearrestshowdownbathroomdemonhandcuffsclassroomgood versus evilflashlightwomanbridgeimpalementstabbed in the chestmapnundouble crosscreaturebeaten to deathscreamingkeyperson on firemissing personcourtscardarkpolicewomanwaterfallhandgundismembermentburned alivegothicladderorphanagecompassionjanitorsufferingbased on video gametitle appears in writingcigarette lighterdark herofogsoulcliffsirentorso cut in halfheroismblood on camera lensbarbed wirefemale bondingfemale fighterhuman monsterbus stopburnt faceunconsciousnesshandcuffedpipeconscienceashesburnt bodypersecutioncar radiochild molesteradopted daughtermotorcycle copmurder of a nude womanimmolationsleepwalkingsecret roommissing daughterretreatknife in the chestmisthornhidden roomsliced in twomoral ambiguitycoal minebodily dismembermentwest virginiaabandoned minedaylimbohandcuffed womanskinned aliveburned at the stakesexy nursetown name in titlemultiple monstersmelting facemurder of a policewomanchain link fencesplit in twonightmare becomes realitysleeping on couchcatholic orphanagefundamentalist christianroom keywitch burninghandcuffed behind backschool roomsilent hillmaternal instincttorn fleshash falldead but doesn't know itmotherly instinctbarcelona chairdust mask (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
Themes: | torturemurderdeathescapepsychopathbrutalityinsanitysadismevilhome invasionexploitationcrueltymurder of a police officer |
Mood: | gorenightslasherblood and gore |
Locations: | strip clubtrying to escape |
Characters: | self mutilationvillainhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillerterrortalking to oneself in a mirrormysterious villainthe family β¦mysterious killerkiller dogdirector of photography (See All) |
Story: | trappedhammermutilationsurvivalviolencebloodfemale nuditycharacter name in titlebare breastsfemale frontal nudityflashbacktwo word titlefightcigarette smokingnipples β¦knifelesbian kisssurprise endingpistolbeatingcorpseblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilfoot chasegay slurflashlightstabbingimpalementstabbed to deathstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhidingspiderdesperationpsychocovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglarsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
Arthur and his two children, Kathy and Bobby, inherit his Uncle Cyrus's estate: a glass house that serves as a prison to 12 ghosts. When the family, accompanied by Bobby's Nanny and an attorney, enter the house they find themselves trapped inside an evil machine "designed by the devil and powered by β¦ the dead" to open the Eye of Hell. Aided by Dennis, a ghost hunter, and his rival Kalina, a ghost rights activist out to set the ghosts free, the group must do what they can to get out of the house alive. (Read More)
Subgenre: | supernaturalb moviesurvival horror |
Themes: | prisonmurderdeathrevengesurrealismmoneybetrayalghostmagicsupernatural powerinheritancebook of magic |
Mood: | gorehorror movie remake |
Locations: | bathtub |
Characters: | family relationshipsfather son relationshipfather daughter relationshipbrother sister relationshiplawyerwitchsingle father |
Story: | alivetrappedsacrificeswordviolencebloodfemale nuditynumber in titleexplosionchasepistoldigit in titleblood splatterremake β¦rescueslow motion scenerifleaxeimpalementchild in perildouble crossfemme fataleshot in the foreheadlimousinewidowerbaseball batlaptoploss of motherhaunted housepsychicdismembermentsplattersingle parenteyeglassesrevelationwhat happened to epiloguetape recorderbabysitterlifting someone into the airloss of wifeeccentricfaked deathmillionairedynamitearrowpipe smokinghit with a baseball batjunkyardlast will and testamentmachinescooterflareartifactnaked dead womancollectorintentionally misspelled titlecut into piecessliced in twoghost hunterghost childbroken backdismembered bodymixed alpha numeric titlesword caneovernight in a haunted houseglass house (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | torturemurderdeathrevengesuiciderapepsychopathinsanityevilcannibalismrape and revenge |
Mood: | goreslasher |
Locations: | desertwaternew mexico |
Characters: | villainserial killerterrorslasher killer |
Period: | year 2007 |
Story: | eyesteamtrappedsurvivalfemale nuditynuditybare breastssequelfightexplosionsurprise endingpistolfirelickingcorpse β¦shot to deathblood splattershot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilgay slurstabbingarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplattermaniacropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countaxe murderkilling spreenude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
Detective Hoffman is deemed hero after he saves a young girl and "escapes" one of Jigsaws game, or do it seems. Special Agent Strahm is suspicious of him after his assistant, Agent Perez dies. While Strahm dives into Hoffman's past, a group of 5 people who all helped burn a building which was suppos β¦edly abandoned are put to a series of tests, set up by the Jigsaw Killer. (Read More)
Subgenre: | survival horror |
Themes: | revengekidnappinginvestigationblackmailguilt |
Mood: | gore |
Locations: | hospitalwaterelevator |
Characters: | self mutilationdoctortattoobrother sister relationshipserial killerdetectiveself surgery |
Story: | exploding headgameviolencebloodsequelflashbackbare chested malefightexplosionsurprise endingpistolcell phonecorpseshot to deathblood splatter β¦shot in the chestshot in the headpunched in the facemaskheld at gunpointbombnumbered sequelreporterdecapitationstabbingthroat slittingsevered headpolice officer killeddrowningstabbed in the backkeyelectrocutionevil manspeechexploding bodyex convictarsoncorrupt coprevelationhead buttfbi agentloss of loved onevideotapepuzzlecrushed to deathbald manstabbed in the throatimpostorgash in the facestabbed in the neckbroken glassjunkiestabbed in the headstabbed in the legdeath of protagonistdisembowelmentbooby trapdeath of sisterblood on shirtbroken armboxfifth partnewspaper clippingframed for murderprequeltorso cut in halfgothelectricityreturning character killed offneedlegerman shepherdpromotiondouble barreled shotgunrazor bladesawbleeding to deathburnt bodyteamworkcountdowncut handdragging a bodysliced in tworogue coptied to a tabletime limitdecapitated bodycollargame of deathjigsawplanting evidencepig maskcrushed handfalse evidencependulumtape playercopycat murdertracheotomyfamous themeswastika tattoocellular phone tracevideo willhead bracesafe deposit box keystrongboxprequel to sequelloose ends (See All) |
200 years in the future a Martian police unit is dispatched to transport a dangerous prisoner from a mining outpost back to justice. But when the team arrives they find the town deserted and some of the inhabitants possessed by the former inhabitants of the planet.
Subgenre: | martial arts |
Themes: | murderdeathsuicidedrugsghostdrunkennessdeceptionseductionrobberyinsanityghost town |
Mood: | gore |
Locations: | trainpolice stationouter space |
Characters: | self mutilationpolicebrother brother relationshipzombie |
Period: | future22nd century |
Story: | teamsurvivalviolencebloodflashbackgunfightexplosionknifepistolshootoutcorpseshot to deathblood splatter β¦fistfightmachine gunshot in the chestblondeshot in the headshotgunpunched in the facegunfightbrawlshowdownheld at gunpointhand to hand combatjailhallucinationshot in the backdecapitationgangmassacremountainstabbingdeath of friendwomanthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headanti herokingpolice officer killedbeaten to deathperson on fireuniformpossessionknocked outexploding bodydie hard scenariosevered armcult directordismembermentgrenadenipples visible through clothingelectronic music scoretold in flashbacksevered fingerfight to the deathgash in the faceslaughterloss of brotherminingblonde womanatomic bombfinger cut offnuclearminerarcheologisthot air balloonmarsbreaking through a doorflashback within a flashbackcavernmars the planetleg woundpolicewoman killinghung upside downcut armhuman versus alienmartianmusic score composed by directorsevered facehandcuffed womanoutnumberedbattering ramdumb criminalhit with a rifle buttnuclear reactorlocked in a closetspace westernalien possessionclimbing up a wallhead on a stakethrown from a trainterraformingpolice station attackfuturistic trainpunch into the camerabody possessionalien organismmatriarchal societyfemale dominated societyrock music score (See All) |
LAPD lieutenant Mike Harrigan ('Danny Glover' (qv)) and his cocky detective partner Jerry Lambert ('Bill Paxton' (qv)) soon realize that what seemed a bloody feud between voodoo high priest King Willie's ('Calvin Lockhart' (qv)) Jamaican gangs and Ramon Vega's ('Corey Rand' (qv)) Colombian drug gang β¦ is actually the work of a scary third party. Peter Keyes's ('Gary Busey' (qv)) federal team shields the crime scene even for the LAPD, but after forensics proves it must be an alien, who keeps making victims, the chase brings them all together. (Read More)
Subgenre: | martial artscult filmblack comedysuspensecreature featuresurvival horror |
Themes: | murderdeathpregnancymonstergangstermurder of a police officer |
Mood: | goreneo noir |
Locations: | bartrainhelicoptercemeterylos angeles californiaurban settingpolice stationcityrooftoprooftop gunfight |
Characters: | policeafrican americanalienpolice detectivepolice shootoutpregnant womanpolice lieutenant |
Period: | 1990sfuture20th centuryyear 1997 |
Story: | bloodyfranchiseteamskullswordviolencebloodcharacter name in titlenumber in titlesequelmale frontal nuditymale rear nuditytwo word titlebare chested malefemale full frontal nudity β¦knifechasepistolshootoutwoman on topcorpsedigit in titleshot to deathblood splattermachine gunshot in the chestshot in the headslow motion scenegunfightfalling from heightshowdownheld at gunpointhand to hand combatsecond partcar crashnumbered sequelreportersubjective cameragood versus evilfoot chaseflashlightjournalistgangcaliforniawomanimpalementstabbed in the chestweaponsubwayexploding carsevered headno opening creditsfictional warspaceshipritualnews reportcigar smokingshot in the legnecklacetreeorganized crimecharacter repeating someone else's dialoguestabbed in the backpay phonelightningopening action scenehangingstreet shootoutpolicewomansevered armak 47machismohead buttcopgothichunterblockbusterswat teamphone boothgun battleseriesreverse footagedual wieldchaosthrown through a windowtough copraised middle fingerlasersightvoodoogovernment agentdrug lordgrenade launchertorso cut in halfinterrupted sexdesert eaglemarijuana jointinvisibilitygang warsecond in seriesgang violenceunited states of americapredatorsawed off shotguncrashing through a windowslaughterhousetoy gunarm cut offreference to john waynefemale gunfighterdreadlocksshoulder holsterautomatic weaponfalling off a roofsubway trainhung upside downrookie coppayphonehuman versus alienlifted by the throatbody armorbonesgreen bloodhuman preyheat wavehumanoid alieninfra redpreyalley fightxenomorphlos angeles police departmentliquid nitrogenhanged bodynude man murderedd box motion codeultraviolet lighttrailer narrated by don lafontainefalling through a rooftop windowsword caneinvisibility cloakfalling down an elevator shaftpunch into the cameracolombian drug cartelcauterizationinvisible monsterdriving a car without a doorantique gunhunting peoplepheromonesextraterrestrial alienalien spacecraftswitching characterstitle character not the main characterjamaican possepregnant policewomanspine rippinghuman hunted down for sportobject made of body partpredator chases prey (See All) |
In the taut thriller The Shallows, when Nancy (Blake Lively) is surfing on a secluded beach, she finds herself on the feeding ground of a great white shark. Though she is stranded only 200 yards from shore, survival proves to be the ultimate test of wills, requiring all of Nancy's ingenuity, resourc β¦efulness, and fortitude. (Read More)
Subgenre: | black comedysuspensefound footagefish out of watercreature featureaustralian horroramerican horrorspanish horror |
Themes: | murderdeathfearescapemonsterdeceptiondeath of motherparanoiacancerpaniccouragenear death experience |
Mood: | goredarknesspoetic justice |
Locations: | beachforestwaterseaoceanmexicotexasblood in watersea water |
Characters: | villainfather son relationshipfather daughter relationshipboyfemale protagonistsister sister relationshipthieflittle boyhispanicterroramericansingle fatherdriverself surgery |
Story: | body partstrappedsurvivalviolencebloodflashbacktwo word titlephotographchasesurprise endingfirecell phonecorpseblood splatterrescue β¦slow motion scenecamerabikinishowdownislandf wordsubjective cameraswimmingbrastabbingimpalementnonlinear timelineno opening creditsunderwater scenelooking at the cameranecklacetalking to the cameraracial slurflash forwarddangerscreamingwidowerelectrocutionattackrace against timetough girlstalkingsplit screendie hard scenarioloss of mothersingle parentstrong female characterrocktouristhelmetstealingwristwatchdesperationsurfingvictimsharkladderstrong female leadanimal attackeaten alivemexicanfemale warriorwoman in jeopardydivingtensionbraverysandhungerescape attemptdrunkaerial shotsexy womancellphonechainethnic slurfast motion scenetorso cut in halfclose up of eyestext messagingfinal showdownminimal castvomitwhaledead animalhomagesurferearringseagullyoung womandrunkardflarefoot closeupdolphinpursepredatorcoughingfemale heroepiloguesurfboardpalm treemedical studentcrabsoccer ballvideo footageold photographtextingin medias rescamera phonepsychotronic filmimprovised weaponflare gunmurder spreeanimal killinggrindhouse filmwavebilingualismshark attackextreme close upleg woundcat and mousejellyfishtalking to selfrescue attemptwine bottletime limitflesh eatingsingle set productiontalking to an animaltijuana mexicotidal wavestopwatchkiller sharkanchorlittle sistershoredehydrationhypothermiayelling for helpeating human fleshgreat white sharkpreyagainst the oddshell on earthman eaterreeftidecut off jeansbuoyjawsripped in halfcellular phonegangreneamerican touristtough womancontainmenthumpback whalesmiley faceflare gun as weaponman versus naturesunscreensurfer girlthrowbackone year lateropening creditsreference to steven seagal1 year latergoprofemale surfertalking to a birdalone against the oddsshark bitelow tidebitten in the legtext messaging on screenbig wavehigh tidebroken wingcalling someone buddy (See All) |
Cox and Hirsch play father and son coroners who receive a mysterious homicide victim with no apparent cause of death. As they attempt to identify the beautiful young "Jane Doe," they discover increasingly bizarre clues that hold the key to her terrifying secrets.
Subgenre: | supernaturalsupernatural horror |
Themes: | torturemurderdeathrevengefearbrutalitysupernatural powersadismevilcrueltypanicmysterious death |
Mood: | gorenightdarknessone nightblood and gore |
Locations: | elevatorpolice carstorm |
Characters: | policefather son relationshipzombiepolice officerbiblewitchsherifffathergirlfriendout of control |
Story: | eyessorcerymutilationviolencebloodfemale nuditycharacter name in titlenuditybare breastsfemale frontal nudityfemale full frontal nuditynipplestitle spoken by characterfire β¦topless female nuditybeatingcorpseblood splattercataxeman with glassesradioritualpaindangerdarkkillingundeadsplatterdestructionrevelationmorguewitchcraftaccidental deathdead womanhomicidecrime scenesufferingsonpower outageescape attemptdisembowelmentautopsyheartsurprisedead mandark pastbruisedead girldark secretblackoutscalpelbellbleedinghallwaynaked dead womanfrightmultiple murderscareorganloss of controlcorridortoothtortured to deathexaminationmultiple homicideliftsevered tongueevil powerdissectionevil forceaccidental murderbroken anklepower cuteviscerationforces of evilattempted escapekillingstorture victimlungsbroken bonedark forcestormy nightbruiseslungwhite eyesbroken wristmultiple killingforce of evilautopsy roomscar tissuemissing toothforces of darknessgrey eyescause of deathroman numeral (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror |
Themes: | torturemurderdeathfriendshipkidnappingfearescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation β¦paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | avant gardeslasherdarknessambiguous ending |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | self mutilationvillainfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillerterrortruck driverslasher killer β¦serial murdererself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | gruesomeskullhammermutilationsurvivalviolencebloodphotographknifechasesurprise endingvoice over narrationbeatingcorpseblood splatter β¦urinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsbarnloss of friendcookvandalismbeardspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinghell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film |
Themes: | murderdeathrevengesuicidefeardrunkennessescapedeceptionbrutalitysupernatural powerparanoiainsanitysurveillancehome invasionpanic β¦apocalypsecannibalismnear death experience (See All) |
Mood: | gorebehind the scenesnightmareambiguous ending |
Locations: | bartrainforestcemeteryairplaneairportwoodskitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire β¦train driver (See All) |
Characters: | father son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteacherzombiepolice officerstudentartistsecurity guardteacher student relationship |
Period: | 2010s |
Story: | hooded figurecellsurvivalswordviolencebloodbased on novelone word titledogfightcigarette smokingdancingtitle spoken by characterexplosion β¦partyknifechasesurprise endingpistolfirebased on bookcell phonebeatingdreamcorpseshot to deathblood splattershot in the chestshot in the headshotgunrescueslow motion scenecatbrawlfalling from heightshowdownrifleheld at gunpointbombshot in the backfoot chaseflashlightambushaxemontageimpalementstabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perilhit by a cardouble crosssearchtransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyperson on fireattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterfireplacebow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivormutantviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialeaten alivebarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosshovelstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murdermutationburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayc4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
Themes: | deathpsychopathsupernatural powerevil |
Mood: | goreraincar chaseslasher |
Locations: | chicago illinoisschool buswater gun |
Characters: | villainpolicehusband wife relationshipboyteacherserial killerkillerterrorslasher killerserial murderernew student |
Period: | 1990s |
Story: | exploding headgruesomebodybloodsequelcigarette smokingsingingpunctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond part β¦apostrophe in titlefoot chasebound and gaggedstrangulationambulancethroat slittingstabbed to deathstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturemaniacfalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedpsychosevered handblack humorbutchershovelstabbed in the legthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderpsycho killerpsychopathic killersuffocationbad guymadmanhiding in a closetevil spirithomicidal maniacclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollfoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
Allegra Geller, the leading game designer in the world, is testing her new virtual reality game, eXistenZ with a focus group. As they begin, she is attacked by a fanatic assassin employing a bizarre organic gun. She flees with a young marketing trainee, Ted Pikul, who is suddenly assigned as her bod β¦yguard. Unfortunately, her pod, an organic gaming device that contains the only copy of the eXistenZ game program, is damaged. To inspect it, she talks Ted into accepting a gameport in his own body so he can play the game with her. The events leading up to this, and the resulting game lead the pair on a strange adventure where reality and their actions are impossible to determine from either their own or the game's perspective. (Read More)
Subgenre: | independent filmblack comedyconspiracydystopiacyberpunkbody horror |
Themes: | murderdeathbetrayalpoliticsescapepanic |
Mood: | gore |
Locations: | forestwoodstruckmotelgas stationchinese restaurant |
Characters: | chinese food |
Period: | future |
Story: | devicebodytrappedgameviolencebloodsexone word titledoggunkissfightexplosionknifesurprise ending β¦fireshootoutshot to deathfoodmachine gunshot in the chestshot in the headcomputershootingriflebirthdaysciencetelephoneshot in the backassassineatingfishtonguecreaturevanpainstabbed in the backscreamingattackshot in the shoulderpursuittrustsurgerywaitergrenadedestructionbullethypodermic needleeggcagemutantdiseasetoyhidingvirtual realityrebellionschizophreniamechanicintrigueshot in the faceinfectionbounty hunteralternate realityskiingmutationintestinesparalysisshot in the neckspiral staircasesoupteethbleeding to deathgasmurder attemptgame playingschizophrenicbonefast food restaurantdouble agentfleeingpsychosissurgical operationcontaminationparallel worldflame throwerchopsticksassembly linereptiledissectionmultiple monsterspodbox cuttercomputer programneurosurgeonumbilical cordchaletthereminsimulatoramphibiancanadian science fictionirish wolfhoundsimulated realitytwo headed creaturefisheryblurred boundariesgame designersecurity checkpointjack knifemise en abymespinelizard monstersucking on one's fingerdownloadkissing feetrecursionproduct testingspinal corddisembodimentnervous systemeverything is not what it seems (See All) |
Heading home late one night after a party, Kate falls asleep while waiting for her train. She awakens to find herself trapped in the London underground, with all the doors locked for the evening. While being attacked by a co-worker who has followed her, a mysterious unseen creature drags him away an β¦d kills him. This begins a terrifying ordeal, as Kate and a young homeless couple are stalked through the dark tunnels by something dangerous with payback on its mind. (Read More)
Subgenre: | british horror |
Themes: | torturemurderrapeescapemonsterpsychopathinsanityillnesscannibalismabortionfear of sex |
Mood: | goreslasher |
Locations: | trainlondon englandenglandtunnelsewertrain tunnel |
Characters: | self mutilationfemale protagonistserial killersecurity guardacquaintance |
Story: | trappedviolencebloodone word titledogbare chested malefightcigarette smokingphotographknifechasesurprise endingbeatingcorpseblonde β¦punched in the facefalling from heightflashlightstrangulationthroat slittingimpalementstabbed to deathsubwaydrug addictbeaten to deathknocked outattempted rapedisappearancestalkingneck breakingtrapratthreatened with a knifedismembermentsurgeryundergroundbreaking and enteringcagesurvivorsecurity cameracovered in bloodfaked deathpuzzlecrushed to deathpresumed deadredneckgash in the facepunched in the stomachstabbed in the headhit on the headautopsyeye gougingstabbed in the eyebruisesodomycellarserial murdervideo surveillancehead woundhuman monstersubway stationescalatorunited kingdomhospital bedhead bashed inheld captivelocked doorcrushed headhallwaybleeding to deathsole black character dies clichedisfigured facehomeless persondeformitystrangled to deathchainsdragging a bodypeep holestupid victimgrindhouse filmsheltercandlelightno endingtrail of bloodsubway trainpower failurepretending to be deadsliced in twonight watchmanintoxicationmidnight movierape attemptstabbed in the crotchwalking caneabortion clinicrubber glovesvagrantlondon undergroundunderground tunnelthrown from a trainreference to george clooneysubway tunnelfingernail cut offcrawling through an air shaftblood drainingskin torn offfetus in a jarcut headventbreaking someone's neckhorror moviethe unknown (See All) |
Popular college student Laura (Alycia Debnam-Carey) has tons of friends, both on Facebook and IRL. She graciously accepts social outcast Marina's (Liesl Ahlers) online friend request, until Marina crosses the line and Laura unfriends her. To everyone's shock, Marina takes her own life in a ritual me β¦ant to torment Laura, which appears in a video posted on Laura's profile. Even though it wasn't Laura who posted the video, or other creepy content that begins appearing on her page, her Facebook friend count begins to dwindle as a result. When her real-life friends start dying mysterious, cruel deaths, Laura must figure out how to break the deadly curse before it's too late. (Read More)
Subgenre: | videoparanormal |
Themes: | deathfriendshiprevengesuicidebetrayalghostfearfunerallonelinesssupernatural powerbullyingunrequited lovepanicpolice investigationrape and revenge β¦end of friendship (See All) |
Mood: | mysterious |
Locations: | hospitalforestelevator |
Characters: | mother daughter relationshipfriendfemale protagonistmotherwitchdaughtergirlfriendself immolationex friend |
Story: | social mediafiguresocialinternetgunknifemirrorcomputerbirthdaycollegedemonstabbingstabbed to deathhit by a carbirthday party β¦ritualcursecollege studenthangingbasementhauntingoccultspiritloyaltyjoggingstabbed in the stomachwitchcraftorphanagestabbed in the neckone dayboyfriendlonerpsychoticlaptop computerreference to facebookcafeteriafacebookhoodiepsychotronic filmhouse fireyoung adultmental disordercreepycollege lifesocial networksocial outcastwaspgeneration yvengeful ghostmillennialvisualhorror filmdistortiontaggingshooting oneself in the headdormcross necklaceinternet addictionpulling hair outwasp nestshooting oneselflearning to walk (See All) |
A vigilante homeless man pulls into a new city and finds himself trapped in urban chaos, a city where crime rules and where the city's crime boss reigns. Seeing an urban landscape filled with armed robbers, corrupt cops, abused prostitutes and even a pedophile Santa, the Hobo goes about bringing jus β¦tice to the city the best way he knows how - with a 20-gauge shotgun. Mayhem ensues when he tries to make things better for the future generation. Street justice will indeed prevail. (Read More)
Subgenre: | cult filmblack comedyb movieabsurdismpunk |
Themes: | torturemurderrevengekidnappingdrugsrobberybrutalitysadismhomelessnessmurder of a police officerpolice corruption |
Mood: | gore |
Locations: | hospitaltrainpolice stationschool bus |
Characters: | father son relationshipbrother brother relationshipprostitutebabypimpshooting a police officerbaby killer |
Story: | exploding headrulestrappedmutilationviolencebloodfemale nuditycharacter name in titlebare breastsmasturbationcigarette smokingtitle spoken by characterpistoltelephone callcorpse β¦arcade gameshot to deathblood splatterfistfightshot in the chestshot in the headshotgunpunched in the facedead bodyprostitutionalcoholshot in the backdecapitationfoot chasenewspapergangaxemassacrevideo cameraimpalementcocainestabbed in the chestsevered headone man armychild in perilnews reportshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backelectrocutionknocked outkicked in the facedeath of childattempted rapedeath of brotherfishnet stockingsdeath of sonvigilantenewspaper headlinedismembermentcorrupt copchild murderak 47burned alivemacheteshot in the stomachscene during opening creditsspin offphone boothsevered handcovered in bloodgrindhouseblack humorgenociderapistcrushed to deathmasked manduct tape over mouthrampagepump action shotgunswitchbladesevered fingergash in the facestabbed in the neckpunched in the stomachshot in the facepedophiledisembowelmentcanecastrationlens flarebroken armflamethrowershot multiple timeshit with a baseball batblood on camera lensintestinesvideo tapebarbed wiremolotov cocktailgun in mouthhead blown offpolice chiefarcadehanging upside downhead bashed insawed off shotguntentaclestreet fightbased on short filmbumcrushed headski maskhanged manpawnshophomeless personwoman in a bikinifilmingdumpsterdeath of title characterspitting bloodhoboimprovised weaponshot in the crotchshopping cartsevered footimmolationbreaking a bottle over someone's headman with no namerecyclingfratricidecrime lordangry mobdrinking from a bottlecowardiceboom boxhung upside downsuit of armorflame throwerlawn mowertoastersanta claus suitlawnmowerchild killerwearing sunglasses insidewoman smoking cigarettebody armorfilicidered lighthanged womanmotorcycle ridingvhs tapebumper carhanged by the neckdeath of unclereference to mother teresacandollar billpawn shopelectrocutedfacial cutwhite suithospitalityice skatesmass child killinghack sawattempted kidnappingwearing sunglasses at nightstreet prostitutionfoiled robberypulling haircutting torchsuspended by armsmanhole coverneo 80sweapon in titleemergency surgeryhead crushedstilletoeating glasswelding maskbreaking an armbricklinrobber wearing a ski maskfire in a 55 gallon drumriding a freight train (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t β¦he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | martial artsblack comedysuspenseconspiracydystopiasurvival horrorpolitical conspiracy |
Themes: | murderdeathfriendshiprevengekidnappingbetrayalpoliticsfearescapedeceptioncorruptionpsychopathbrutalityparanoiainsanity β¦sadismsurveillancehome invasionexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
Mood: | gorenightslasher |
Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
Characters: | self mutilationafrican americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifle |
Period: | near future |
Story: | aliveheadsacrificesurvivalswordviolencebloodsequelflashbackbare chested malefightphotographexplosionknifechase β¦pistolfirecell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorgunfightbrawlshowdownrifleheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf worddecapitationflashlightbound and gaggedgangambushaxemassacreambulancedeath of friendmontagestabbed to deathmixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapsevered headman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carritualvanthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeevil manknocked outkicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gestureclass differenceswashington d.c.ak 47chainsawhand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | tragedypsycho thriller |
Themes: | torturemurderdeathrevengesuicidekidnappingrapepsychopathdeath of fatherbrutalitydeath of mothersadismevildeath of wifecannibalism β¦self sacrificemadnessmurder of familyghost town (See All) |
Mood: | goreslasherhorror movie remake |
Locations: | desertcavegas stationsuv |
Characters: | villainfamily relationshipsbrother sister relationshipteenage girlteenage boyserial killerbabykillerterror |
Period: | year 2006 |
Story: | eyesmutilationviolenceblooddogsurprise endingpistolblood splattercar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolver β¦foot chaseaxeimpalementstabbed in the chestexploding carsevered headcontroversyshot in the foreheadstabbed in the backperson on firevacationevil manbaseball batamerican flagglassesmurdererfirst partsevered armdismembermentkillingsplattermaniacclaim in titleburned alivekilling an animalmutantragewalkie talkievictimrapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminebody countaxe murdermutationsevered legkilling spreedeath of loved onemannequinserial murderpsychopathic killerbad guyhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violencehomicidal maniacexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
Loomis Crowley is testing the underground game Stay Alive with his friends Sarah and Rex. When the game is over, Loomis finds Rex and Sarah dead in their room, and he is pushed by a shadow from the staircase, breaking the banister and hanging the same way he died in the game. Loomis' sister, Emma, g β¦ives his game to his best friend, Hutch. They, and his friends Miller, Phineus with his sister October, Swink and Abigail play the game together. When Miller and Phineus die the same way they died in the game, the survivors disclose that the game is based on the life of the evil Countess Elizabeth Bathory. She was buried alive in the tower of her real state in the Geronge Plantation. With the police chasing them, and after the death of October, the survivors reach the house and try to find the corpse of the Countess to destroy her fiend. (Read More)
Subgenre: | videodisneysurvival horrorteen horrorsupernatural horrorslasher horror |
Themes: | murderdeathfriendshipdrugsghostfuneraldeath of motherhomelessnessenvironmentmurder of a police officer |
Mood: | high schoolslasher |
Locations: | carcemeterysinging in a carblood in car |
Characters: | policefriendbrother sister relationshipteenage girlteenage boylawyerwaitresspolice detectiveemployer employee relationshipchildhood friendyounger version of character |
Story: | exploding headalivegameviolencebloodflashbackmale rear nuditybare chested malefemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterchasesurprise endingfire β¦corpseshot to deathblood splattercar accidentmirrorshot in the chestslow motion scenecomputermaskbookcar crashprayerstabbingdeath of friendthroat slittingcocainestabbed in the chestchild in perilpolice officer killedvanperson on firedollhangingdiarydeath of brotherautomobilelaptopcharacter says i love youfull frontal nudityoccultburned alivelooking at oneself in a mirrorgroup of friendscaught having sexvirtual realityrealitystealing a carlow budgetconstruction sitecrossbowstabbed in the throatanimated sequencenew orleans louisianatitle appears in writingthunderstormroseblood on shirtbody countplayburned to deathloss of brotherlaptop computerinterrupted sexreflectionhackerbongapparitiontowerlightercomic reliefbroken mirrorhanging upside downchandelierplaying a video gamehanged mannaked dead womanmultiplayercrowbartrapdoorhouse firevideo gamehusband murders wifepeep holeplantationzippo lightergamersome scenes animatedthroat cutcarriagebloody body of a childcityscapehorse drawn carriagenail gunshackleschevrolethidden roomyoung3 dcountessnailchild killerzombie childred rosestabbed in the heartstabbed in the foreheadhanged by the neckinternet cafereal lifecomputer gamepig maskbaronesstitle appears in textworking lategroup of teenagersone way mirrorpontiacreflection in car mirrorbathorygame designerkilledshearsthroat slitblue collar workerreal worldlaw clerkliving in a vanmouth forced opengame reality crossoverhorror movieinside a computerreference to elizabeth bathory (See All) |
Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com β¦plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensestop motion animationcreature featureteen romancebody horror |
Themes: | murderdeathfriendshipfeardrunkennessescapemonsterdeceptionmilitaryparanoiaredemptionpaniccourageself sacrificenear death experience β¦unlikely hero (See All) |
Mood: | gorehigh schoolpoetic justiceone nighthorror movie remake |
Locations: | hospitalchurchforestcarhelicoptersnowmotorcyclecemeterysmall townwoodskitchenpolice stationpolice carouter spacesewer β¦car motorcycle chasemotorcycle chasetruck accident (See All) |
Characters: | self mutilationvillainpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girl β¦teenage boysoldiernursepriesttough guywaitressbiblesheriffhomeless manbiologistalcoholic drink (See All) |
Period: | 1980s |
Story: | menacebodyexplosivesurvivalviolenceblooddogguncigarette smokingexplosionchasesurprise endingpistolfirecorpse β¦blood splattermachine guncar accidentremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverscientistdecapitationorphanflashlightambushaxeambulancedeath of friendbridgefootballdinermapexploding carfalse accusationsevered headanti herodisarming someonechild in perilhit by a carcreaturepolice officer killedvannecklacetransformationdangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderfilm within a filmexploding bodydateratsevered armdismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachercrushed to deathsocial commentarybikereaten alivefemale warriormechanicrampagereverse footagebraveryu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiummutationjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage loveurban legendfirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemexperiment gone wrongmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stuntjumping from a carhazmat suitmotorcycle crashprojectionistyo yosinkmass deathbiohazardjarpart stop motionfreeze to deathbiological warfaregeiger counterblobmanholetown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerchild eatenface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikecrash siteevil preachertoilet plungerteen heroteen couple eaten (See All) |
Special Agent Strahm is dead, and Detective Hoffman has emerged as the unchallenged successor to Jigsaw's legacy. However, when the FBI draws closer to Hoffman, he is forced to set a game into motion, and Jigsaw's grand scheme is finally understood.
Subgenre: | survival horror |
Themes: | torturemurderrevengekidnappingdeceptionsadism |
Mood: | goredarkness |
Locations: | office politics |
Characters: | self mutilationsecurity guardsecretary |
Story: | gamesacrificeviolencenumber in titlesequelflashbacksurprise endingpistolnumbered sequeltoiletkeypoisontrapsevered armbullet β¦tape recorderroman numeral in titlepuzzlecrushed to deathback from the deadpresumed deaddisembowelmentbooby trapburned to deathgothintestinesreturning character killed offacidbroken mirrorfemale lawyermind gamescalpelwetting pantsaudio cassettelighting a cigarettecountdownsixth partcarouselchoicepool of bloodevil corporationbear trapevil dollsafe deposit boxpadlockaudio tapefingerprintshealth caresequel to cult filmgame of deathjigsawkicked in the ballsinsurance companycleaverhara kiridistorted voicehealth insurancepower cutpig maskhack sawfingerprintinginsurance salesmanone way mirrortape playerfamous themeholding one's breathpower sawsequel to cult movieacid bathsafe deposit box keyactuaryflash photographysteam pipeshackle (See All) |
A young woman, desperate to help her sickly brother, accepts a dinner invitation to what seems to be easy money. As soon as she arrives to dinner, she realizes that playing the "game" is deadly for its losers. She and several others spend the night being terriorized in a game of would you rather.
Subgenre: | slasher flickpsychological thriller |
Themes: | torturemurderdeathsuicidemoneypsychopathcancersadismwealth |
Mood: | slasher |
Locations: | water |
Characters: | self mutilationfather son relationshipdoctorbrother sister relationshipsoldierdriversuicide by pills |
Story: | whipgameguntitle spoken by charactersurprise endingpistolshowershot to deathblood splattershot in the chestshot in the headheld at gunpointstabbed to deathdrowningbeaten to death β¦electrocutionattempted rapedeath of brothercontestthreatwhippingheart attackinjurysevered handveteranpillsbraveryescape attemptbutlerstabbed in the legvegetarianeye gougingbody countcharacters killed one by onetabledinner partymake upsarcasmprizeleukemiaman punching a womanrazor bladewheelchair boundbleeding to deathshockcountdownchoicesole survivorinvitationfirecrackerdisableddinner tablerecovering alcoholictimerordersteakgame of deathplasticbreaking inwealthy familyphilanthropistholding breathholding one's breath underwatervictim invited to dinnermascaraholding one's breathholding someone's head underwatercountdown timermascara runningstabbed with an ice pickdunking head in waterhead dunked in waterforced eatingcountdown clockeye slitting (See All) |
An out-of-the-way diner becomes the unlikely battleground for the survival of the human race. When God loses faith in humankind, he sends his legion of angels to bring on the Apocalypse. Humanity's only hope lies in a group of strangers trapped in a desert diner with the Archangel Michael (Bettany).
Themes: | murderdeathlovesuicidechristmaspregnancydeceptiondeath of fathersupernatural powerdeath of motherfaithhopeapocalypseself sacrificemurder of a police officer β¦unlikely heroreligious faith (See All) |
Mood: | darkness |
Locations: | small townlos angeles californiadesertpolice cargas station |
Characters: | self mutilationhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshiptattoobrother brother relationshipteenage girlhostagewarriorreference to godwaitressinterracial relationshipshooting a police officerpregnant girlfriend |
Story: | trappedsurvivalswordviolencebloodone word titleflashbackbare chested malefightcigarette smokingexplosionknifesurprise endingpistolfire β¦voice over narrationcell phoneshootoutshot to deathmachine guncar accidentshot in the chestshot in the headshotgunslow motion scenefalling from heightvomitingrifleheld at gunpointbeercar crashcriminalshot in the backf wordgood versus evilflashlightdeath of friendimpalementdinerstabbed in the chesttied to a chairexploding carno opening creditsradiochild in perilhit by a carold womanshot in the foreheadmini skirtpossessionangeldeath of childchristmas treechildbirthexploding bodydeath of husbandtrapthreatened with a knifecoupleburned alivelooking at oneself in a mirrorcookcrucifixexploding buildingsevered handcrying manend of the worldfateback from the deadmechanicpump action shotgunveteransevered fingerfight to the deathgash in the facedeath threatm 16prophecybible quoteheavenjumping through a windowmurder of a childbody landing on a carsiegetrailerdaggergrenade launcheratheistman cryingshot through a windowbazookanarrated by characterbag over headpolice officer shot in the chestjukeboxstandoffacidgun held to headdisposing of a dead bodyhanging upside downbitten in the neckfinger cut offteethcar set on fireopen endedpolice officer shot in the headtear on cheekzippo lighterfratricidewingsbudweisermacemercyextinctionjumping from a rooftopice cream truckpower failurebattle axehand cut offwoman shot in the foreheadconvoychild killerextreme closeupmother daughter conflictmobile homedisobeying ordershelium balloonparadoxthrown through a windshieldsteakwalkerhit with a frying panfallen angelinsubordinationinstructionwoman with a gunno cellphone signalswing setpolice officer shot through the hearthook for handsaviordouble impalementexploding gasoline stationclimbing up a wallhumanity in perilbroken down carblisterice cream manraw meatquitting smokingarchangelbiting someonelocustangel wingsarchangel michaeldog tagshanging from the ceilingbegins with a quoteemergency broadcast systemsurvivalismbloody hand printexterminationpatrol carpolice officer shot in the foreheadshell casinghouseflyhuman racepregnant woman smokingboilsharpened teethangel gabrielartificial handblack and white televisionpossessed boystitching own woundcan of beerswarm of insects (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial artsconspiracydystopiafish out of watercyberpunkdark fantasy |
Themes: | murderdeathrevengekidnappingescapemonsterinvestigationsupernatural powersurveillancehome invasionpolice brutality |
Mood: | goredarknesspoetic justice |
Locations: | helicopterelevatorpolice stationrooftopsewer |
Characters: | self mutilationpolicefather son relationshipmother daughter relationshipdoctorfemale protagonistdetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughter |
Period: | future2010s |
Story: | whipexplosivesurvivalswordviolencebloodsequeltwo word titlebare chested malephotographexplosionknifechasesurprise endingpistol β¦fireshootoutbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescuepunched in the facebattlegunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashhandcuffsrevolvercombatkung fuscientistshot in the backsubjective cameradecapitationgood versus evilflashlightstrangulationaxemassacrethroat slittingimpalementstabbed to deathcolon in titlemixed martial artsstabbed in the chestsevered headno opening creditsanti herochild in perilhit by a carfictional warunderwater scenecreaturesearchnews reportshot in the legtransformationshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderinjectionexploding bodyneck breakingmercenarysevered armshot in the armhenchmanexperimentwerewolfhand grenadekilling an animalhypodermic needlegothicsecurity camerakicked in the stomachfourth partgiantjumping from heightparking garageaction heroineanimal attackgun fucrushed to deathsocial commentaryback from the deadfemale warriorstealing a carstabbed in the throatpartner3 dimensionalresurrectionshot in the facestabbed in the headstabbed in the leg3dpunched in the chestjumping through a windowthrown through a windowbody landing on a carknife throwingstabbed in the eyemutationflamethrowertelepathytorso cut in halfdesert eaglesuper strengthstabbed in the armshot in the eyescalpelgenetic engineeringdamman kills a womanscene of the crimebitten in the neckepiloguestabbed in the shouldershot in the throatopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All) |
Something has gone wrong at a remote scientific research station on Mars. All research has ceased. Communication has failed. And the messages that do get through are less than comforting. It's a level 5 quarantine and the only souls allowed in or out are the Rapid Response Tactical Squad - hardened β¦Marines armed to the teeth with enough firepower to neutralize the enemy...or so they think. (Read More)
Subgenre: | martial artssuspense |
Themes: | murdersuicidemonsterheromilitarybrutalitywrestlingfuture war |
Mood: | gorebreaking the fourth wall |
Locations: | wheelchairbaseballouter spacelaboratorysewer |
Characters: | self mutilationtattoobrother sister relationshipzombiesoldieralientough guyaction herobabe scientisthuman versus monster |
Period: | 21st century2020s |
Story: | exploding headsurvivalviolencebloodone word titlegunfightknifechasesurprise endingpistolshootoutcorpseshot to deathblood splatter β¦fistfightmachine gunshot in the chestblondeshot in the headslow motion scenegunfightbrawlfalling from heightvomitinghand to hand combatcombatscientistshot in the backsubjective cameradecapitationgood versus evilfoot chaseambushmassacreimpalementmixed martial artsaccidentsevered headanti herodisarming someonefictional warcreatureshot in the foreheadduellocker roomelectrocutionmissiontough girlopening action sceneexploding bodydie hard scenariomercenarysevered armbare chested male bondagemonkeychainsawmachismogrenadekilling an animalmousesergeantsevered handmexican standoffback from the deadgun battlealien invasionbased on video gameescape attemptspecial forcesdark heroautopsywisecrack humorcommandoslaughtersevered leggatling gunteleportationlaser gunmain character diestorso cut in halfclose up of eyesvillain played by lead actorstabbed in the handfirst person shooterbullet balletcommando unitcommando missionelectric shockbehind enemy linesgun duelbitten in the neckaltered version of studio logotop secretshot through the mouthquarantineshot in the throatparaplegiccommando raidcut into pieceselevator shaftimmolationmars the planethatchetstarts with narrationcaged animalcorporate crimesevered earaxe in the headstudio logo segues into filmarsenalsuperhumanhero kills a womanmartiansuper soldierdefibrillationfirst person perspectivespace marine2040smultiple monstersshot in the buttsign of the crossminigungenetic mutationportal to hellhigh tech weaponshumanoid monsterattack helicoptersearch and destroy (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β¦'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | independent filmcult filmsuspenseconspiracytragedyparanormal phenomenabody horror |
Themes: | torturemurderdeathsurrealismsuicidepregnancyescapeinvestigationdeceptionpsychopathbrutalitysupernatural powerterrorismsurveillancehome invasion β¦exploitationregret (See All) |
Mood: | gorecar chasenight |
Locations: | trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire |
Characters: | self mutilationdoctorbrother brother relationshipartisthitmansecurity guardprofessorhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer |
Period: | 1980s |
Story: | exploding headheadviolencebloodone word titleflashbackbare chested malecigarette smokingphotographtitle spoken by characterexplosionchasesurprise endingpistoltelephone call β¦firecorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapshot in the headshotguncomputerwritten by directorfalling from heightshowdownheld at gunpointcar crashinterrogationhallucinationrevolvertelephonescientistshot in the backsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologyman with glassescigar smokingshot in the legshot in the foreheadon the runduelscreamingperson on firefactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upevil manshot in the shoulderinjectionexploding bodyautomobileshot in the armcult directorpsychictraitorfalling down stairssabotagedestructionburned aliverevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothpress conferencevisitgrindhousedriving a carladdermind controlart gallerycrushed to deathreverse footagesurveillance camerablood on facegash in the faceshopping mallsculptureblack and white scenelaughterthrown through a windowopening a doormeetingburned to deathtelekinesisholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womancrashing through a windowlying on bedwoman kills a manshot in the handseizurebullet woundsuper powerburnt bodypsychic powershot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gunfade to blackdriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonethreatened with a gunmegacorporationthreat to killwaiting roomlooking at pictureshaking handsextrasensory perceptiontranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemdrill in the headcomputer programpharmaceuticalsbus crashdart gunscannerknocking on a windowside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpsehypodermicexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All) |
Ash is transported with his car to 1,300 A.D., where he is captured by Lord Arthur and turned slave with Duke Henry the Red and a couple of his men. When Ash is thrown into a pit, he defeats two monsters and wins respect of Arthur's army and vassals. The Wiseman points Ash as The Chosen One that wil β¦l retrieve the Necronomicon but Ash is only interested in returning home. When he learns that the only way to return to his time is using the Necronomicon, Ash decides to travel to the unholy land of the Deadites. The Wiseman advises that he must say the words "Klaatu Barada Nikto" to safely get the evil book. However, Ash forgets the last word and an army of the dead resurrects to attack Arthur fortress and recover the Necronomicon. The battle between the living and the dead is about to start and the support of Henry the Red is the only way to help Ash and Arthur to defeat the army of darkness. (Read More)
Subgenre: | sword and sorcerymartial artscult filmblack comedyabsurdismepicslapstick comedyfish out of watersteampunkdark fantasysword and fantasy |
Themes: | surrealismfearmonsterheromagicsupernatural powertime travelevilpanicbook of evil |
Mood: | gorespoofavant gardesequel to cult horror |
Locations: | forestcarcemeterydesertwoodsenglandcastle |
Characters: | zombiesoldiertough guywarrioraction herowitch |
Period: | 1990s20th centuryyear 1992 |
Story: | whipexplosiveskullswordviolencebloodsexnuditybare breastssequelkissfightsingingchasethree word title β¦surprise endingvoice over narrationblood splatterfistfighthorsecar accidentmirrorface slapshotgunbattlebookhand to hand combatrunningdemonfightingcombatdecapitationgood versus evilsword fightambushaxearmyimpalementmixed martial artsprisoneranti herodisarming someoneone man armyfictional warcreaturesearchgraveyardthird partgunshotduelone against manycurseprologueuniformactor playing multiple rolespossessionstatuelightningopening action scenescreamskeletonscarautomobilecabincult directordismembermentundeadbattlefieldstylized violencechainsawfireplacebow and arrowspearfarcequestcaptivesevered handknighttorchgun fuslavefull moondamsel in distressreverse footageshieldthundercrossbowhit in the crotchshot in the faceprophecypsychotronicmedieval timesarmorh.p. lovecraftsiegekingdomsword dueltragic herosequel to cult favoritearrowspelldoppelgangerlevitationgatespit in the facefreakarcherydouble barreled shotgunbeastfortressreluctant heroone linergun violencetrampolinewindmillchainedgravestoneblacksmithpigtailstongue in cheekbagpipeschosen onepitwinchester riflerepeating rifleshot with a bow and arrowalternate versionmistbattle axecult figureogrechemistryflaming arrowdukeprosthetic limbevil twincartcatapultvortexbannerevil deadbattering ramover the topsame actor playing two charactersnecronomiconpart stop motionanvilbraidslanceanimate objectminiature personhorseback14th centuryalternate endingsame actor playing two characters simultaneously on screencult film reference1300shuman duplicationenchantmentbook of the deadsalesclerkcitadelhead spinoldsmobileanimate skeletondiscount storedemonic undeadvoice over flashbackwise manskeleton warriorartificial handportcullistwo headed personmetal handwar crychainmailsumerian (See All) |
Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try β¦ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)
Subgenre: | suspensesupernaturalfound footagevideosurvival horrorpsychological thrillerpsychological horrorfolk horror |
Themes: | murderdeathfriendshipkidnappingbetrayalghostfearescapedeceptionsupernatural powerparanoiaevilpaniccampingnear death experience |
Mood: | gorerainambiguous endingmyth |
Locations: | forestsmall townnightclubwoodscampfiretunnel |
Characters: | self mutilationboyfriend girlfriend relationshiphostagewitchdeath of girlfriend |
Period: | 2010s |
Story: | teamtrappedsacrificesurvivalviolencebloodcharacter name in titlesequeltwo word titletitle spoken by characterchasesurprise endingcell phonecorpseblood splatter β¦rescuefalling from heightvomitingrunningriverf wordsubjective cameraflashlightdeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationapologyno opening creditsdouble crosscreaturesearchthird parttreelegendcursedangerscreamingcharacter's point of view camera shotmissing persontentknocked outcollege studentlightningactor shares first name with characterdisappearancebasementsuspicionprofanitysleepingfreeze frameheavy rainloss of friendwalkie talkieoverallsvideotapewristwatchyoutubeinterracial friendshipcrushed to deathbroken legtensionmercilessnessescape attemptblack and white sceneinfectionaerial shotattichandheld camerarainstormcharacters killed one by onetripteleportationtracking deviceyellingminimal castvomitold dark houseabandoned housedronenight visionno title at beginningfilm starts with textcabin in the woodsdeath of boyfriendcamcorderparasitewatching a videosymbolpentagrampsychotronic filmtime loopgrindhouse filmleg injuryno endingbanishmentmarylandbarricadefilm studentcamping triploss of girlfriendshaky camlost in the woodsrebootloss of boyfriendcrawlingvomiting bloodhearing noisesriver crossingcentipedetime paradoxmysterious noiselovecraftianbroken footdark forestno cell phone signalrunning in the darkblair witchcrossing a riveropening creditsbootstrap paradoxsleeping in the foresthouse in the woodsblair witch projectmysterious figure (See All) |
In the middle of a routine patrol, officer Daniel Carter happens upon a blood-soaked figure limping down a deserted stretch of road. He rushes the young man to a nearby rural hospital staffed by a skeleton crew, only to discover that patients and personnel are transforming into something inhuman. As β¦ the horror intensifies, Carter leads the other survivors on a hellish voyage into the subterranean depths of the hospital in a desperate bid to end the nightmare before it's too late. (Read More)
Subgenre: | b moviesurvival horrorbody horrorhorror b moviecosmic horror |
Themes: | naturemurderdeathlovesurrealismpregnancyfearmonsterinsanityevil |
Mood: | gorenightdarknessambiguous ending |
Locations: | hospitalsmall townpolice car |
Characters: | self mutilationdoctorpolice officernursepregnant womanpregnantgrandfather granddaughter relationshipcrying babyofficerpregnant teenagerpregnant girlstudent nurse |
Period: | 1980sfuturethe future |
Story: | hooded figureexploding headfunmakeuphammermutilationgamesurvivalviolencebloodtwo word titleguncigarette smokingknifepistol β¦firecorpseshot to deathblood splattermirrorrifledead bodyhallucinationhandcuffstelephoneshot in the backf worddecapitationflashlightaxestabbingstabbed in the chestcultradiodisarming someonecreaturetransformationon the rungunshotdrug addictdangerstabbed in the backscreamingattackon the roadscreaminjectiondarkisolationbasementthreatened with a knifehandgunblood spatterburned alivehypodermic needlemutantwalkie talkiemorguebossrealitypump action shotgunseriesvisionpower outagestabbed in the neckscissorseye gougingdisfigurementh.p. lovecraftgasolinestabbed in the eyemutationburned to deathsirensymbolismliving deadspecial effectsfire extinguisherphysicianpolaroidhospital roomflarescalpelcigarettedruggedtentacleretrogurneymacabregraphic violencelighting a cigaretteyoung man11 year oldriskbloody violenceroadhuman experimentvideo gamecut handalternate dimensionimmolationgrindhouse filmslimemad doctorsinistercat and mousethroat cutfacebloody facehuman experimentationred lightwoman in laborsedativefansstate troopertrianglecanuxploitationlynchianestranged wifehandcuffed to a bedmix uppolaroid photographanother dimensionhell on earthsecret experimentgenetic mutationtelescopic riflehorror filmknife in backalien parasitemute characterclaw hammerexperiencefire axethroat slashedtentaclescreaturescult memberrule of thumbcoredoused with gasolinehospital wardcosmicdisturbed persondragged along the groundhand cuthardwarehead bashinghole in the headmountain rangeshot gunslapped in the facemute manhandcuffed maninjured mancold opencrawling on the grounddrugged womanmise en scenecovered with bloodhuman body as an alien hostinjection in armmutated humanskeleton crew6 months laterhorror movietoo late (See All) |
Subgenre: | black comedyconspiracy |
Themes: | murderdeathbetrayalbrutalityexecutioncrueltypanicdying |
Mood: | gore |
Locations: | elevatorofficerooftop |
Characters: | boyfriend girlfriend relationshiphostagesecurity guard |
Story: | exploding headexplosivesurvivalviolencebloodguncorpseshot to deathblood splattershot in the headheld at gunpointaxestabbed to deathweaponshot in the forehead β¦beaten to deathbusinessmanmanipulationneck breakingcharacter says i love youthreatened with a knifefalling down stairswoundmass murdersecurity camerastabbed in the stomachhidingblack humorcrushed to deathmoralityblood on facefight to the deathdark humorbusinesswomanm 16co workerblood on shirtcorporationkilling spreemoral dilemmashot multiple timesmarijuana jointmolotov cocktailcafeteriahead blown offmegalomaniacstonersecurityoffice workercolombiameat cleavershot in the handcountdownsole survivordeath by gunshotelevator shaftarmoryloudspeakerintercomstairwellthreatened with a guncorporate executiveaxe in the headsecurity systemarsenalmost dangerous gametrackerheld hostagebusiness executivestabbed in the bellygame of deathcubiclesocial experimentoffice buildingblow torchbludgeoned to deathcleaveregocentrismbox cutterpower cutsavageryevil businessmanbogota colombiahit with a wrenchlast man standingpublic address systemwater coolerstuck in an elevatorticking clocklockdownhuman hunting a humanfire axesequel baitingmaintenance manbegging for mercysmoking a jointblood on floorstitching a woundcutting torchdeath of a co workergame of survivalexecution style shootingoffice cubicleco worker co worker relationshipant farmblood spattered facehiding under a deskself survivalcrushed skullcamera shot of a woman's feet in high heelskill or be killedmonitoring device (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
Subgenre: | suspenseslasher flickbody horroramerican horrorsadistic horrorspanish horrorcanadian horror |
Themes: | torturemurdersuicidefeardeceptioncannibalism |
Mood: | gorerainnightmareslasherblood and gore |
Locations: | new york cityboatvillagejungleamericarain forest |
Characters: | villainfather daughter relationshiptattoolawyerterroramerican abroadslasher killer |
Story: | body partsmutilationviolencefemale nuditymale frontal nuditymale rear nuditybare chested malelesbian kissthree word titlepistolcell phoneshot to deathblood splattershot in the chest β¦urinationwritten by directorvomitingmarijuanacollegeislandmale pubic haircolor in titlerivershot in the backdecapitationcookingthroat slittingimpalementsevered headdream sequenceritualroommatenecklaceshot in the foreheadcharacter repeating someone else's dialogueprotestcollege studentscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplattermachetespidercovered in bloodvictimbroken legmasked maneaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endeye gougingslaughterstabbed in the eyebody countbroken armsevered legcharacters killed one by oneenvironmentalismcapitalismactivisttorso cut in halfsatellitemarijuana jointbad guykillshot in the neckunited nationshomagehuman monsterflutenaivetyamazonslashingveganantbleeding to deathkiller childextreme violencemiddle classperugraphic violencereference to twittertied up while barefootcamera phonebloody violencedeforestationignorancesadistic psychopathenvironmentalistpsychotronic filmbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeast coasteating human fleshfemale genital mutilationman eaterhead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror |
Themes: | murderdeathkidnappingdeceptionincestpsychopathinsanitymental illnesssadismevilhome invasiongreedcannibalismwealthstarvation β¦claustrophobia (See All) |
Mood: | goresatireslasherdarknesssocial satire |
Locations: | los angeles californiaslum |
Characters: | villainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipterrorkiller dog |
Period: | 1990s |
Story: | trappedskullmutilationviolenceblooddogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathblood splattershot in the chestface slap β¦shotgunbirthdayflashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragestabbed in the stomachspiderpsychosevered handgrindhousesadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsoulbody countdead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
The Draytons - David, Steff and their son Billy - live in a small Maine town. One night a ferocious storm hits the area, damaging their house. The storm is accompanied by a strange mist. David and Billy and their neighbour Brent Norton go into town. There they discover that the mist contains some fr β¦ightening creatures, creatures intent on killing humans. (Read More)
Subgenre: | cult filmsuspensetragedycreature featuresurvival horrormonster movie |
Themes: | naturemurderdeathsuicidemarriagefearmonstermilitaryangersupernatural powerparanoiainsanitypanicapocalypse |
Mood: | gore |
Locations: | helicoptersmall townrural settinglake |
Characters: | father son relationshipteachersoldierlawyerartistbiblesuicide by hangingreligious fanaticmilitary policehuman versus monster |
Period: | 2000s |
Story: | rulestrappedmutilationsurvivalbloodbased on novelsex scenefighttitle spoken by characterknifesurprise endingfireblood splatterfistfightshot in the chest β¦face slapshot in the headpaintingneighborprayerrevolverscientistflashlightaxestabbingwomanarmystabbed in the chestfalse accusationchild in perilcreatureshot in the foreheadtreedangerperson on firebased on short storylightningtankhangingmanagerdie hard scenariohandgunchainsawexperimentropesupermarketdestructionmedicinespearloss of loved oneloss of wifedesperationmobtorchpreacherearthquakeeaten alivemechanicu.s. armythunderstormdeath of protagonistfogmurder of a childhighwaysiegedead boyflamethrowersirenwilhelm screamholding handshysteriafire extinguishergun in mouthbandagehuman sacrificeacidrestroomwhisperingburnt facedenialpharmacymercy killingtentacleman kills a womanbloody body of childhanged manshockexperiment gone wrongparasitestresstragic endingmainegrudgeburn victimalternate dimensionarmy baseassisted suicidehummergiant spidercowardicemovie posterchild killeddrugstorepower failuremistrunning out of gasbritish actor playing american charactergiant insectclothes linemercedescashierresentmentwoman shot in the foreheadfilicidestabbed in the bellybased on novellabiblical quotescience experimentbased on the works of stephen kingsingle locationpet foodvenomno cellphone signalboy killeddimensionchild shotmopchild shot in the headfalling treebattle tankzealotspiderwebcrazy womanlovecraftianmale soldierfeelings of guiltblack outproselytizingripped in halfbaseball cap worn backwardsmanuremaniaromantic kisssurvivalismvicodinpower generatorfather murders sonpainting as artmob rulem1 abrams tankelectrical generatorbehemothharbinger of deathinsect stingcommercial artisttownspeopleelectric lightgrocery marthouse by a lakehowitzersafety glasseschild killed by fathergroanreference to sesame streetstorm damage (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β¦ end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
Themes: | memorymurdersurrealismghostdancemonstertime travelsadismbook of evil |
Mood: | gorenightmareavant garde |
Locations: | forestairplanewoodskitchencastlestormbackwoods |
Characters: | self mutilationhusband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancer |
Period: | 1980s1990s20th centuryyear 1987 |
Story: | exploding headviolencebloodsexnumber in titlesequelkisschasethree word titlesurprise endingpantiesvoice over narrationsongunderwearblood splatter β¦mirrorshotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianodemonhallucinationdecapitationgood versus evilaxestabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonbasementhauntingratcabinsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
When detective Eric Matthews is called to a crime scene of a victim of Jigsaw, he finds a lead to the place where he is hidden. Once there, he realizes that Jigsaw trapped his son Daniel Matthews with three women and four men in a shelter, and they are inhaling a lethal nerve gas. If they do not use β¦ an antidote within two hours, they will die. Eric follows with increasing desperation the death of each member of the group in monitors, while trying to convince Jigsaw to release his son. (Read More)
Subgenre: | survival horrorsadistic horror |
Themes: | torturemurderdeathkidnappingbrutalitydrug usecancersadismpanicdrug addictionpolice brutality |
Mood: | gorenightmare |
Locations: | bathtubelevator |
Characters: | self mutilationpolicefather son relationshippolice officerserial killerdetective |
Story: | trappedviolencebloodsequelflashbackbare chested malesurprise endingpistolfirecorpseshot to deathblood splattershot in the headslow motion scenevomiting β¦second partflashlightdrug dealerthroat slittingimpalementsuicide attempttoiletstabbed in the chestchild in perillatex glovesargumentdrug addictelectrocutionbaseball battrapheroinarsoncorrupt copsyringeburned alivehypodermic needlegothictape recorderlifting someone into the aircrying womanvillainesscrying manbroken legmale underwearsurveillance camerajunkiespecial forcessafebooby trapblood on shirtpolice raidjuvenile delinquentcharacters killed one by onegothneedleshoutingmind gameshot in the eyedripping bloodrazor bladesawcowardcop killerflamepsychological torturespitting bloodman on firesole survivorracial stereotypetrapdoorsevered footcrooked copvcrknife in the chestantidoteevil dollcrematoriumoxygen maskbodily dismembermentbroken fingerlifting a female into the airlifting an adult into the airgame of deathfurnaceboxer briefsflamespig maskviolence against a childtorture deviceplaying godviolent copnerve gasvillain escapesfamous themeneedlesthroat slit (See All) |
The curse of the headless horseman is the legacy of the small town of Sleepy Hollow. Spearheaded by the eager Constable Ichabod Crane and his new world ways into the quagmire of secrets and murder, secrets once laid to rest, best forgotten and now reawakened, and he too, holding a dark secret of a p β¦ast once gone. (Read More)
Subgenre: | cult filmblack comedyfish out of watersteampunkdark fantasyamerican horrorsupernatural horrorgothic horroradult fantasy |
Themes: | tortureprisonmurderrevengemarriageghostjealousypregnancyheroinvestigationsupernatural powergreedmurder of familyamerican revolutionamerican mythology β¦beyond death (See All) |
Mood: | gorenightmare |
Locations: | new york citychurchcemeteryfarmtowntown bully |
Characters: | policehusband wife relationshipdoctorserial killerdetectivebullywitchsniper rifle |
Period: | 18th century1700s |
Story: | headskullswordbloodflashbacktitle spoken by characterfiredreamblood splatterhorsedecapitationsword fightaxestabbingimpalement β¦severed headcoffinchild in periltreelegendbased on short storycourtwighauntingloss of fatherblindfoldloss of mothercult directordismembermentsplatterchild murderoccultgothicfaintinglifting someone into the airwitchcraftspiderfaked deathcommunityveteranfight to the deathstabbed in the leghit on the headautopsypumpkinblack magiccrowtorso cut in halfhorseback ridingspellbeheadingscene before opening creditslast will and testamentevil spiritoutsidernaivetystepmothercornfieldpotionscarecrowfeverstabbed in the shoulderwindmillorchestral music scorerepeated linescytheman with no namejack o'lanterncontrolexpressionismbeetleflintlock pistolstagecoachsliced in twocardinal the priesttorture chamberextreme closeuphuman skullhorsemanjealous boyfriendmysterious eventsbased on legendconstablemagistratefainting manhorseback1790sdedicationnotarysororicidethrowing a knifegerman expressionismiron maidenjealous manjealous ragegeorgian eraheadlessarachnophobiaheadless horsemanportal to helldown blousedragged by a horseoptical illusionhorseback chasecovered bridgeknife in the thighkiss of deathamerican literatureflock of sheepflying batcostume horrorjumping from a moving vehicleautopsy roomman faintingquill pensleepy hollow new yorkmarriage certificatereference to washington irvingsharpened teethamerican folkloregathering woodgeorgian fashionlegendary characterlevitatingreference to ichabod cranereference to the legend of sleepy hollowwashington irvingchases on horsebackrecapitationshakingankhdesaturated colorsplaying a violinspinning camera shotwax sealdoor in the floorhessianjealous suitorparent killed in front of childtricome (See All) |