Please wait - finding best movies...
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | heistsupernaturalsuspenseblack comedycoming of agecult filmmartial arts |
Themes: | supernatural powerpanichome invasionevilsurveillanceparanoiadeath of fatherrobberyseductiondeceptionescapefearbetrayalkidnappingsuicide …friendshipmurderdeathrevengesurrealism (See All) |
Mood: | nightmaregore |
Locations: | catholic churchrooftopshippolice stationairporttaxilondon englandairplanecemeterychurchschool |
Characters: | catholic priestcatholicsecretaryprofessorbiblesecurity guardchristianityinterracial relationshipwarriorvampirethiefhostagepriestdoctorfather daughter relationship |
Period: | 2000s |
Story: | silver bulletneon signdeath of mentorjourney shown on mapdouble crossevil manpolice interrogationancient vampiresexy female vampirevampire slayerfemale vampiregood versus eviltwo way mirrorairplane crashthreatened with a knife …foot chasezero gravity sexantique gunblood suckingstabbed through the backreference to bram stokernude female silhouettereference to judas iscariotretina scan fakedantique storemaster apprentice relationshipretina scanblood transfusionreference to judasvan helsingindestructibilityturbulenceestranged daughtervoice recordinggarden shearsout of body experiencefangbloodlustantique dealerstabbed in the heart1790smardi grasneoncoming out of retirementsilverdeath of title characterman fights a womanleechsunlightmushroom cloudweaponrystakeinvulnerabilitymistrecord storetelevision reporterglowing eyesstupid victimregenerationcockney accentmind readingfingerprintwoman fights a manopen endedvaultfilmed killingwoman kills a mancrashing through a windowbody bagbitten in the neckoffscreen killingone linersunrisecomputer hackergreenhousestabbed in the armcomputer crackertelevision newscameramansuper strengthconfessionalburned to deathimpersonating a police officerdraculacrucifixionlevitationenglishman abroadnews reportergothbullet timetombbattelepathykilling spreefemale reporterstabbed in the eyewisecrack humorjumping through a windowbooby trappunched in the chestnew orleans louisianaswampmentorhypnosisimmortalitystabbed in the throatresurrectionmercilessnesshatredburglarycrossbowinterracial romancereverse footageexplosiveback from the deadrampageparking garagemind controlcarnivaljumping from heightskullkicked in the stomachsecurity camerascene during opening creditsstealingcrucifixhypodermic needlegothicburned alivestylized violencerevelationwolfdestinytraitorropewerewolfpremarital sexundeaddirectorial debutsevered armneck breakingcrosssuicide attemptinjectionmanipulationsensualitycollege studentkicked in the facehangingknocked outlightningrace against timeproduct placementperson on firestabbed in the backattempted murderkeycursepilotlibraryflash forwardracial slurtransformationnews reportfemme fatalepolice officer killedsearchcoffinsevered headmapstabbed in the cheststabbed to deathdeath of friendmixed martial artsthroat slittingimpalementdisguisemassacrestrangulationold manambushcandleflashlightbedroomsurvivaldecapitationshot in the backf wordreference to jesus christhandcuffshallucinationinterrogationbedhand to hand combatheld at gunpointshowdownpaintingfalling from heightbrawlarrestswordpunched in the faceslow motion scenerescueshotgunshot in the chestmirrorblood splatterfistfightshot to deathcorpsedreampistolsurprise endingchaselesbian kissknifepartyexplosionphotographcharacter name in titlebare chested malenumber in titleviolenceflashbackgunsexfightblood (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerpanicsurveillanceparanoiadeath of fatherseductiondeceptionescapefearbetrayaldeathmurder |
Mood: | gore |
Characters: | security guardwarriorvampirehostage |
Story: | double crossevil manfemale vampirethreatened with a knifestabbed through the backsilverman fights a womansunlightglowing eyesregenerationmind readingwoman fights a manopen endedwoman kills a manstabbed in the arm …super strengthburned to deathbullet timestabbed in the eyejumping through a windowpunched in the cheststabbed in the throatresurrectionmercilessnesscrossbowreverse footageexplosiveback from the deadjumping from heightkicked in the stomachsecurity camerahypodermic needlegothicburned alivestylized violencerevelationtraitorwerewolfdirectorial debutsevered armneck breakingsuicide attemptinjectionmanipulationkicked in the faceknocked outlightningstabbed in the backtransformationfemme fatalesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushflashlightsurvivaldecapitationshot in the backinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyexplosionbare chested malefightbloodviolenceflashback (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Subgenre: | supernaturalblack comedymartial arts |
Themes: | supernatural powerpanicevilsurveillanceparanoiaseductiondeceptionescapefearbetrayalkidnappingsurrealismmurderfriendshipdeath …revenge (See All) |
Locations: | rooftoplondon englandairplanecemeterychurch |
Characters: | professorsecurity guardwarriorthiefhostagepriestdoctor |
Story: | double crossgood versus evilairplane crashthreatened with a knifefoot chaseman fights a womanstupid victimregenerationcockney accentmind readingwoman fights a manopen endedwoman kills a manbitten in the neckoffscreen killing …tombtelepathywisecrack humorpunched in the chestimmortalityresurrectionmercilessnessreverse footageback from the deadrampagemind controlskullkicked in the stomachsecurity camerahypodermic needlegothicdestinyundeadinjectionmanipulationknocked outlightningrace against timeproduct placementattempted murdercursepilotflash forwardtransformationnews reportfemme fatalepolice officer killedcoffinstabbed in the cheststabbed to deathdeath of friendmixed martial artsthroat slittingmassacrestrangulationambushflashlightshot in the backhallucinationhand to hand combatheld at gunpointshowdownbrawlpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsedreampistolsurprise endingchaseknifeexplosionbare chested maleflashbackbloodfightviolence (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | martial arts |
Themes: | panicsurveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathmurderrevenge |
Mood: | nightmaregore |
Locations: | rooftop |
Characters: | professorbiblesecurity guardhostagedoctorfather daughter relationship |
Story: | double crossevil mangood versus evilairplane crashthreatened with a knifewoman fights a manopen endedwoman kills a manbitten in the neckstabbed in the armsuper strengthburned to deathenglishman abroadbullet timestabbed in the eye …booby trappunched in the cheststabbed in the throatmercilessnesshatredjumping from heightkicked in the stomachsecurity cameracrucifixhypodermic needleburned alivestylized violencerevelationtraitorropeundeadsevered armkicked in the faceknocked outrace against timeperson on firestabbed in the backsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushflashlightsurvivaldecapitationshot in the backinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionviolencefightbloodflashback (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
Subgenre: | black comedycult filmmartial arts |
Themes: | supernatural powerpanicdeceptionfearbetrayalkidnappingdeathrevengemurder |
Mood: | gore |
Locations: | church |
Characters: | vampirehostagepriest |
Story: | sexy female vampirevampire slayerfemale vampiregood versus evilstabbed in the heartmind readingbitten in the necksunrisesuper strengthburned to deathcrucifixiontelepathyimmortalitycrossbowskull …security camerascene during opening creditscrucifixburned alivewolfundeadneck breakingcrosssuicide attemptknocked outlightningperson on firestabbed in the backtransformationnews reportsearchsevered headmapstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacredecapitationshot in the backinterrogationheld at gunpointshowdownpunched in the faceslow motion scenerescueshotgunshot in the chestblood splattershot to deathcorpsepistolchaseknifepartyexplosionphotographbloodviolence (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
Themes: | supernatural powerdeceptionfearbetrayalkidnappingsuicidesurrealismrevengemurderdeath |
Locations: | london englandchurch |
Characters: | warriorvampirehostage |
Story: | evil mangood versus evilthreatened with a knifefangcoming out of retirementsilversunlightglowing eyesregenerationbitten in the necksuper strengthburned to deathdraculabatimmortality …stabbed in the throatresurrectionhatredback from the deadskullcrucifixgothicburned alivestylized violencewolfdestinydirectorial debutsevered armcrosslightningperson on fireattempted murderstabbed in the backcurseflash forwardtransformationmapstabbed in the cheststabbed to deaththroat slittingimpalementmassacreambushcandlehand to hand combatshowdownfalling from heightswordpunched in the faceslow motion scenerescueblood splattercorpsesurprise endingchaseknifeexplosioncharacter name in titlebare chested malebloodflashbackviolence (See All) |
Subgenre: | supernaturalblack comedycoming of agemartial arts |
Themes: | supernatural powerpanicparanoiadeath of fatherrobberydeceptionescapefearbetrayalkidnappingrevengedeathsurrealismmurderfriendship |
Mood: | nightmare |
Locations: | shiplondon england |
Characters: | warriorthiefhostagefather daughter relationship |
Story: | evil mangood versus evilthreatened with a knifefoot chaseglowing eyescockney accentsuper strengthburned to deathbullet timebatwisecrack humorpunched in the chestmentormercilessnesshatred …reverse footageexplosivemind controljumping from heightkicked in the stomachscene during opening creditsburned alivestylized violencewolftraitorsevered armmanipulationknocked outstabbed in the backtransformationfemme fatalesevered headmapstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementdisguisemassacrestrangulationambushcandledecapitationshot in the backinterrogationhand to hand combatshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsesurprise endingchaseknifeexplosioncharacter name in titlebare chested malebloodflashbackfightviolence (See All) |
Subgenre: | suspensemartial arts |
Themes: | panicsurveillanceparanoiadeceptionescapefearbetrayalkidnappingsuicidemurderrevengedeath |
Characters: | interracial relationshiphostagedoctor |
Story: | double crossthreatened with a knifefoot chasefilmed killingwoman kills a manstabbed in the armsuper strengthkilling spreestabbed in the eyepunched in the chestrampagekicked in the stomachsecurity camerahypodermic needlerevelation …directorial debutneck breakinginjectionkicked in the faceknocked outstabbed in the backattempted murderstabbed in the cheststabbed to deathdeath of friendmixed martial artsimpalementstrangulationambushbedroomshot in the backf wordinterrogationbedhand to hand combatheld at gunpointshowdownbrawlpunched in the facerescueshot in the chestmirrorblood splatterfistfightcorpsepistolsurprise endingchaseknifecharacter name in titlebare chested malefightbloodflashbackviolence (See All) |
Since the dawn of civilization, he was worshiped as a god. Apocalypse, the first and most powerful mutant from Marvel's X-Men universe, amassed the powers of many other mutants, becoming immortal and invincible. Upon awakening after thousands of years, he is disillusioned with the world as he finds …it and recruits a team of powerful mutants, including a disheartened Magneto, to cleanse mankind and create a new world order, over which he will reign. As the fate of the Earth hangs in the balance, Raven with the help of Professor X must lead a team of young X-Men to stop their greatest nemesis and save mankind from complete destruction. (Read More)
Subgenre: | suspensecoming of agemartial arts |
Themes: | supernatural powerpanicsurveillancedeceptionescapefearbetrayalkidnappingmurderdeathsurrealismrevenge |
Mood: | nightmare |
Locations: | taxiairplane |
Characters: | professorwarriorthiefhostagefather daughter relationship |
Story: | double crossgood versus evilthreatened with a knifefoot chaseman fights a womaninvulnerabilityregenerationmind readingwoman fights a manfilmed killingwoman kills a manoffscreen killingsuper strengthburned to deathlevitation …bullet timetombtelepathykilling spreejumping through a windowpunched in the chestmentorimmortalitystabbed in the throatresurrectionmercilessnessreverse footageback from the deadrampagemind controlkicked in the stomachburned alivestylized violenceneck breakingkicked in the faceknocked outlightningrace against timeproduct placementflash forwardtransformationnews reportpolice officer killedsevered headmapstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementdisguisemassacrestrangulationambushflashlightsurvivaldecapitationshot in the backhand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueblood splatterfistfightcorpsepistolsurprise endingchaseknifeexplosionphotographcharacter name in titlebare chested maleflashbackgunfightbloodviolence (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerhome invasionsurveillanceescapekidnappingrevengedeathmurder |
Mood: | gore |
Locations: | rooftoppolice station |
Characters: | security guardwarriorvampirehostagedoctor |
Story: | good versus evilstabbed in the heartsilverregenerationwoman fights a manopen endedbitten in the neckstabbed in the armsuper strengthtelepathystabbed in the eyejumping through a windowpunched in the cheststabbed in the throatresurrection …explosiveback from the deadparking garagejumping from heightkicked in the stomachsecurity camerahypodermic needlegothicwerewolfsevered armneck breakinginjectionkicked in the facestabbed in the backtransformationnews reportsearchsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationflashlightsurvivaldecapitationshot in the backhandcuffshand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the facerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionphotographbare chested maleviolenceblood (See All) |
Subgenre: | supernaturalsuspenseblack comedymartial arts |
Themes: | supernatural powerpanicevildeceptionescapefearbetrayalkidnappingdeathsurrealismrevengemurder |
Locations: | church |
Characters: | warriorthiefhostage |
Story: | double crossgood versus evilthreatened with a knifeman fights a womanglowing eyesmind readingwoman fights a manwoman kills a manburned to deathtelepathybooby trappunched in the chestimmortalityresurrectionmercilessness …crossbowreverse footageback from the deadmind controljumping from heightkicked in the stomachburned alivestylized violencerevelationwolftraitordirectorial debutmanipulationkicked in the facestabbed in the backflash forwardtransformationfemme fatalestabbed in the chestmixed martial artsimpalementmassacreambushcandlehallucinationhand to hand combatshowdownbrawlswordpunched in the faceslow motion scenerescueshot in the chestmirrorfistfightcorpsesurprise endingchaseknifeexplosioncharacter name in titlebare chested maleviolencefightbloodflashback (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter …mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
Subgenre: | heistblack comedymartial arts |
Themes: | supernatural powerpanicsurveillancerobberydeceptionescapefearbetrayalkidnappingsuicidemurderdeathrevengesurrealism |
Locations: | rooftopairportairplane |
Characters: | security guardwarriorthiefhostagefather daughter relationship |
Story: | double crossairplane crashstabbed in the heartglowing eyesregenerationmind readingfilmed killingsuper strengthburned to deathimpersonating a police officertelepathywisecrack humorjumping through a windowbooby trappunched in the chest …immortalityexplosiverampagemind controljumping from heightskullkicked in the stomachsecurity camerahypodermic needleburned alivestylized violenceneck breakinginjectionmanipulationkicked in the faceknocked outlightningrace against timeperson on firestabbed in the backracial slurtransformationfemme fatalesevered headmapstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushsurvivaldecapitationshot in the backhallucinationhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestswordpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingknifeexplosionphotographbare chested maleflashbackviolencefight (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | suspenseblack comedycoming of agecult film |
Themes: | supernatural powerdeceptionescapefearbetrayalkidnappingmurderfriendshiprevengedeath |
Mood: | gore |
Locations: | police station |
Characters: | vampirethiefhostagefather daughter relationship |
Story: | double crossgood versus evilthreatened with a knifefoot chaseblood suckingblood transfusionbloodlustsunlightinvulnerabilitybitten in the neckone linersuper strengthburned to deathjumping through a windowpunched in the chest …immortalitystabbed in the throatmercilessnessreverse footagescene during opening creditsgothicburned aliveropeundeaddirectorial debutneck breakingmanipulationrace against timeproduct placementperson on fireattempted murdertransformationfemme fatalepolice officer killedstabbed in the cheststabbed to deaththroat slittingmassacrestrangulationflashlightshot in the backf wordheld at gunpointshowdownbrawlpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionbare chested malegunfightviolenceblood (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | suspenseblack comedymartial arts |
Themes: | supernatural powerpanichome invasionsurveillancedeceptionescapebetrayalkidnappingrevengesurrealismmurderdeath |
Mood: | gore |
Locations: | rooftopairplane |
Characters: | security guardwarriorhostagedoctor |
Story: | double crossevil mangood versus evilfoot chaseinvulnerabilitycockney accentwoman kills a mancrashing through a windowoffscreen killingstabbed in the armsuper strengthburned to deathenglishman abroadbullet timekilling spree …stabbed in the eyejumping through a windowpunched in the cheststabbed in the throatresurrectionmercilessnessback from the deadrampageparking garagemind controljumping from heightkicked in the stomachburned alivestylized violencepremarital sexdirectorial debutsevered armneck breakingmanipulationkicked in the faceknocked outperson on fireattempted murderstabbed in the backfemme fatalepolice officer killedsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementdisguisemassacrestrangulationambushsurvivaldecapitationshot in the backf wordinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosioncharacter name in titlebare chested maleviolencegunbloodflashbackfight (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
Subgenre: | black comedymartial arts |
Themes: | supernatural powerdeath of fatherseductiondeceptionescapefearbetrayalkidnappingmurderdeathrevengesurrealism |
Locations: | ship |
Characters: | warriorthiefhostage |
Story: | double crossevil mangood versus evilthreatened with a knifeout of body experienceglowing eyesvaultsuper strengthburned to deathtombtelepathywisecrack humorbooby trappunched in the chestswamp …immortalitystabbed in the throatresurrectionmercilessnessburglaryreverse footageback from the deadmind controlkicked in the stomachburned alivestylized violencedestinysevered armlightningrace against timestabbed in the backlibrarytransformationsevered headstabbed in the cheststabbed to deathmixed martial artsimpalementmassacreold manambushbedroomsurvivaldecapitationbedhand to hand combatshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshot in the chestfistfightcorpsesurprise endingchaseknifeexplosionbare chested maleviolencefightflashbackblood (See All) |
Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.
Subgenre: | heistsuspensecult filmmartial arts |
Themes: | panichome invasionsurveillanceparanoiarobberyseductiondeceptionescapebetrayalkidnappingsuicidedeathmurderrevenge |
Locations: | rooftoppolice stationairporttaxiairplanecemetery |
Characters: | security guardwarriorthiefhostagepriestdoctor |
Story: | double crossevil mangood versus evilfoot chaseblood transfusioncoming out of retirementmushroom cloudcockney accentfingerprintwoman fights a manfilmed killingcrashing through a windowbody bagoffscreen killingcomputer cracker …super strengthbatjumping through a windowbooby trappunched in the chestmercilessnessburglaryexplosiveparking garagejumping from heightkicked in the stomachsecurity camerahypodermic needlestylized violencerevelationropeneck breakinginjectionkicked in the faceknocked outrace against timeproduct placementstabbed in the backkeynews reportfemme fatalepolice officer killedstabbed in the chestmixed martial artsimpalementdisguisemassacrestrangulationambushshot in the backhallucinationinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyexplosionphotographbare chested malefightflashback (See All) |
Subgenre: | suspenseblack comedymartial arts |
Themes: | panicparanoiaseductiondeceptionescapefearbetrayalsuicidemurderrevengedeath |
Mood: | gore |
Locations: | rooftop |
Characters: | warrior |
Story: | double crossthreatened with a knifefoot chaseneoncoming out of retirementman fights a womanfingerprintwoman fights a manopen endedcrashing through a windowstabbed in the armenglishman abroadpunched in the cheststabbed in the throatmercilessness …kicked in the stomachstylized violenceneck breakingmanipulationkicked in the faceproduct placementattempted murderstabbed in the backstabbed in the cheststabbed to deathmixed martial artsthroat slittingmassacrestrangulationambushsurvivalshot in the backf wordhand to hand combatheld at gunpointshowdownpaintingfalling from heightbrawlpunched in the faceslow motion sceneshotgunshot in the chestmirrorblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyexplosionphotographcharacter name in titlenumber in titleflashbackfightbloodgunviolence (See All) |
The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, … a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)
Subgenre: | supernaturalblack comedy |
Themes: | supernatural powerdeceptionescapebetrayalkidnappingdeathsurrealismrevengemurder |
Locations: | catholic churchtaxiairplanechurch |
Characters: | catholic priestbiblewarriorhostagepriest |
Story: | double crossgood versus evilthreatened with a knifestabbed through the backman fights a womanglowing eyesregenerationmind readingopen endedoffscreen killinggreenhouseburned to deathenglishman abroadtelepathyimmortality …resurrectionreverse footageback from the deadmind controlcrucifixgothicburned alivestylized violencerevelationtraitormanipulationlightningrace against timestabbed in the backcurseflash forwardfemme fatalecoffinstabbed in the cheststabbed to deathdeath of friendimpalementmassacrestrangulationcandlesurvivalshot in the backhallucinationinterrogationheld at gunpointshowdownfalling from heightswordrescueshotgunshot in the chestcorpsedreampistolsurprise endingknifeexplosionflashbackbloodfightviolence (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit …ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
Subgenre: | suspenseblack comedycult film |
Themes: | supernatural powerpanicevilparanoiadeceptionescapefearbetrayalkidnappingsurrealismmurderdeath |
Mood: | gore |
Locations: | catholic churchrooftoppolice stationcemeterychurchschool |
Characters: | catholic priestbiblechristianityhostagepriest |
Story: | double crossevil mangood versus evilinvulnerabilitymind readingsuper strengthburned to deathlevitationgothtelepathykilling spreejumping through a windowpunched in the chestresurrectionmercilessness …back from the deadmind controlskullscene during opening creditsgothicburned aliveundeadsuicide attemptmanipulationknocked outrace against timeperson on fireattempted murderflash forwardpolice officer killedcoffinimpalementflashlightsurvivalshot in the backhallucinationhandcuffsheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the chestblood splatterfistfightshot to deathcorpsesurprise endingknifeexplosionphotographfightviolencebloodflashbackgun (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
Subgenre: | suspenseblack comedymartial arts |
Themes: | panichome invasionparanoiaseductiondeceptionescapefearbetrayalkidnappingmurderrevengedeath |
Mood: | gore |
Locations: | rooftopairporttaxilondon englandairplane |
Characters: | hostagefather daughter relationship |
Story: | double crosstwo way mirrorthreatened with a knifefoot chaseneonman fights a womanwoman fights a manwoman kills a manstabbed in the armenglishman abroadpunched in the cheststabbed in the throatmercilessnessjumping from heightkicked in the stomach …scene during opening creditsstylized violencerevelationtraitorropepremarital sexneck breakingmanipulationsensualitykicked in the faceknocked outrace against timeproduct placementstabbed in the backattempted murderflash forwardnews reportfemme fatalepolice officer killedstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementdisguisemassacrestrangulationambushsurvivalshot in the backf wordinterrogationbedhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaselesbian kissknifepartyexplosionphotographbare chested maleflashbackgunviolencebloodfight (See All) |
A group of thieves steal a rare gem, but in the process, two of the men double cross the leader of the thieving group, Patrick, and take off with the precious stone. Ten years later, prominent psychiatrist Nathan Conrad is invited to examine a disturbed young woman named Elisabeth. Patrick immediate …ly kidnaps Nathan's daughter, forcing Nathan to attempt to get Elisabeth to reveal a secret number which will ultimately lead Patrick to the whereabouts of the precious gem that has eluded him. (Read More)
Subgenre: | heistsuspenseblack comedy |
Themes: | panichome invasionsurveillanceparanoiadeath of fatherrobberydeceptionescapefearbetrayalkidnappingdeathrevengefriendshipmurder |
Locations: | police stationcemetery |
Characters: | security guardthiefhostagefather daughter relationship |
Period: | 2000s |
Story: | double crosstwo way mirrorthreatened with a knifefoot chasewoman fights a manwoman kills a manoffscreen killingstabbed in the armcomputer crackerenglishman abroadexplosiveparking garageskullkicked in the stomachsecurity camera …scene during opening creditshypodermic needlerevelationcrossinjectionmanipulationknocked outrace against timeattempted murderflash forwardracial slurpolice officer killedcoffinmapstabbed in the cheststabbed to deathdeath of friendambushflashlightshot in the backf wordhandcuffsheld at gunpointshowdownbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionphotographbloodflashbackviolencefight (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | suspenseblack comedymartial arts |
Themes: | panichome invasionsurveillanceparanoiadeceptionescapefearbetrayalkidnappingdeathrevengefriendshipmurder |
Mood: | gore |
Locations: | rooftopairportchurch |
Characters: | warriorhostagepriest |
Story: | evil manthreatened with a knifefilmed killingstabbed in the armburned to deathbullet timebooby trappunched in the cheststabbed in the throatmercilessnesshatredparking garagekicked in the stomachsecurity cameraburned alive …manipulationkicked in the faceknocked outrace against timeproduct placementperson on firestabbed in the backattempted murderflash forwardracial slurnews reportsevered headmapstabbed in the cheststabbed to deathdeath of friendmixed martial artsmassacreambushflashlightsurvivaldecapitationshot in the backf wordhand to hand combatheld at gunpointshowdownbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolchaseknifeexplosionphotographbare chested malefightviolencebloodflashback (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle …dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
Subgenre: | suspensemartial arts |
Themes: | panicsurveillanceparanoiadeath of fatherdeceptionescapefearbetrayalkidnappingsurrealismmurderrevengedeath |
Locations: | rooftopshiplondon englandchurch |
Characters: | security guardwarriorhostagepriestdoctorfather daughter relationship |
Story: | double crossgood versus evilthreatened with a knifefoot chasewoman fights a manwoman kills a mancrashing through a windowstabbed in the armpunched in the cheststabbed in the throatcrossbowjumping from heightkicked in the stomachsecurity camerahypodermic needle …stylized violencerevelationdestinyropeneck breakinginjectionmanipulationkicked in the faceknocked outrace against timestabbed in the backflash forwardstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushshot in the backhallucinationhand to hand combatpaintingbrawlswordpunched in the faceslow motion scenerescueshot in the chestfistfightshot to deathcorpsesurprise endingchaseknifeexplosionphotographbare chested maleflashbackviolencebloodfight (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | black comedymartial arts |
Themes: | paranoiadeceptionescapefearbetrayalkidnappingdeathfriendshiprevengemurder |
Mood: | gore |
Locations: | rooftoplondon englandcemetery |
Characters: | warriorhostagepriestfather daughter relationship |
Story: | journey shown on mapdouble crossgood versus evilthreatened with a knifeman fights a womanwoman fights a manopen endedwoman kills a manpunched in the cheststabbed in the throatmercilessnesshatredexplosiveburned alivestylized violence …revelationtraitorsevered armknocked outlightningrace against timestabbed in the backlibrarytransformationsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacreambushsurvivaldecapitationhallucinationhand to hand combatheld at gunpointshowdownpaintingfalling from heightbrawlswordpunched in the faceslow motion scenerescueblood splatterfistfightcorpsepistolsurprise endingchaseknifepartyexplosionfightflashbackgunbloodviolence (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi …nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
Subgenre: | suspensemartial arts |
Themes: | supernatural powerpanicsurveillanceparanoiadeath of fatherdeceptionescapefearbetrayalkidnappingrevengedeathmurder |
Mood: | nightmare |
Locations: | rooftopairplanecemetery |
Characters: | warriorhostage |
Story: | double crossgood versus evilairplane crashthreatened with a knifeinvulnerabilityglowing eyesfingerprintopen endedfilmed killingcrashing through a windowcomputer hackercomputer crackersuper strengthburned to deathlevitation …batfemale reporterjumping through a windowbooby trappunched in the chestimmortalityhatredreverse footageexplosiverampagejumping from heightkicked in the stomachscene during opening creditsburned alivestylized violencerevelationpremarital sexsevered armmanipulationkicked in the faceknocked outlightningrace against timeproduct placementstabbed in the backflash forwardtransformationnews reportcoffinstabbed in the cheststabbed to deathdeath of friendimpalementdisguisemassacrestrangulationambushhallucinationhandcuffshand to hand combatheld at gunpointshowdownpaintingfalling from heightbrawlarrestswordpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsedreampistolsurprise endingknifepartyexplosionphotographcharacter name in titlebare chested malebloodflashbackfightviolence (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | supernaturalcult film |
Themes: | supernatural powerpanicparanoiadeceptionescapefearbetrayalkidnappingrevengedeathsurrealismmurder |
Mood: | gore |
Locations: | rooftopairplane |
Characters: | warriorvampirehostagedoctor |
Period: | 2000s |
Story: | double crossfemale vampiregood versus evilairplane crashthreatened with a knifefoot chaseblood suckingglowing eyesregenerationmind readingstabbed in the armtelepathyreverse footagemind controlstylized violence …revelationdestinysevered armknocked outlightningrace against timeattempted murderstabbed in the backcurseflash forwardtransformationfemme fatalesevered headstabbed in the cheststabbed to deathimpalementambushflashlightdecapitationshowdownbrawlarrestswordpunched in the faceslow motion scenerescueblood splattercorpsesurprise endingchaseknifeexplosionphotographbare chested maleflashbackfightbloodviolence (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, …to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
Subgenre: | black comedycult filmmartial arts |
Themes: | evilsurveillancedeath of fatherrobberydeceptionescapebetrayalkidnappingdeathrevengefriendshipmurder |
Locations: | rooftoppolice stationtaxi |
Characters: | warriorthiefhostagefather daughter relationship |
Period: | 2000s |
Story: | double crossgood versus evilfoot chasefilmed killingwoman kills a manbody bagcomputer crackercameramanimpersonating a police officernews reporterkilling spreejumping through a windowbooby trappunched in the chestmercilessness …hatredreverse footageexplosivejumping from heightkicked in the stomachsecurity camerastylized violencerevelationropekicked in the faceknocked outrace against timeproduct placementnews reportpolice officer killeddeath of friendmixed martial artsdisguisemassacrestrangulationambushflashlightshot in the backhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchasepartyexplosionphotographbare chested malefightbloodviolenceflashback (See All) |
CIA chief Hunley (Baldwin) convinces a Senate committee to disband the IMF (Impossible Mission Force), of which Ethan Hunt (Cruise) is a key member. Hunley argues that the IMF is too reckless. Now on his own, Hunt goes after a shadowy and deadly rogue organization called the Syndicate.
Subgenre: | suspensemartial arts |
Themes: | surveillancedeceptionescapebetrayalkidnappingdeathrevengemurder |
Locations: | london englandcemetery |
Characters: | security guardhostage |
Story: | double crossfoot chaseman fights a womanrecord storewoman fights a manwoman kills a mancomputer hackerstabbed in the armimpersonating a police officerenglishman abroadwisecrack humorjumping through a windowreverse footageparking garagekicked in the stomach …scene during opening creditsrevelationneck breakingmanipulationkicked in the faceknocked outrace against timestabbed in the backkeyflash forwardfemme fatalemapstabbed in the cheststabbed to deathmixed martial artsdisguiseambushshot in the backhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the chestfistfightshot to deathpistolsurprise endingknifephotographbare chested maleviolenceflashback (See All) |
This is the origin story of former Special Forces operative turned mercenary Wade Wilson, who after being subjected to a rogue experiment that leaves him with accelerated healing powers, adopts the alter ego Deadpool. Armed with his new abilities and a dark, twisted sense of humor, Deadpool hunts do …wn the man who nearly destroyed his life. (Read More)
Subgenre: | black comedymartial arts |
Themes: | supernatural powerdeceptionescapebetrayalkidnappingdeathmurderfriendshiprevenge |
Mood: | gore |
Locations: | taxiairplane |
Characters: | interracial relationshipwarriorhostagedoctor |
Story: | double crossevil mangood versus evilthreatened with a knifeman fights a womaninvulnerabilityregenerationcockney accentmind readingwoman fights a manoffscreen killingone linerstabbed in the armsuper strengthburned to death …englishman abroadbullet timetelepathykilling spreewisecrack humorpunched in the chestimmortalitystabbed in the throatmercilessnesshatredrampagejumping from heightscene during opening creditsburned alivestylized violencepremarital sexdirectorial debutneck breakinginjectionkicked in the facerace against timeperson on firestabbed in the backtransformationnews reportsevered headmapstabbed in the cheststabbed to deathmixed martial artsimpalementmassacrestrangulationambushdecapitationshot in the backf wordhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolchaseknifeexplosionphotographcharacter name in titlebare chested maleflashbackfightbloodviolence (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
Subgenre: | suspenseblack comedymartial arts |
Themes: | supernatural powerparanoiaescapefeardeathmurder |
Mood: | gore |
Characters: | professordoctor |
Period: | 2000s |
Story: | evil manthreatened with a knifestupid victimregenerationwoman fights a manbody bagoffscreen killingwisecrack humorjumping through a windowresurrectionback from the deadrampagekicked in the stomachhypodermic needleundead …severed armneck breakinginjectionkicked in the facerace against timestabbed in the backpilotflash forwardtransformationsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushflashlightsurvivaldecapitationshot in the backhand to hand combatheld at gunpointshowdownfalling from heightpunched in the facerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosioncharacter name in titlebare chested malenumber in titlefightviolencebloodflashback (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t …o end all wars, Diana will discover her full powers and her true destiny. (Read More)
Subgenre: | coming of agemartial arts |
Themes: | supernatural powerpanicparanoiadeceptionescapefearbetrayalrevengesurrealismmurderdeath |
Locations: | shiplondon englandairplanechurch |
Characters: | secretarywarrior |
Story: | death of mentordouble crossevil mangood versus evilthreatened with a knifeantique dealerman fights a womaninvulnerabilitywoman fights a manopen endedvaultwoman kills a mansuper strengthlevitationbullet time …jumping through a windowpunched in the chestmentorimmortalitymercilessnesshatredjumping from heightkicked in the stomachstylized violencerevelationdestinyropekicked in the faceknocked outlightningrace against timeattempted murderpilotflash forwardmapstabbed in the cheststabbed to deathmixed martial artsdisguisemassacreshot in the backinterrogationhand to hand combatheld at gunpointshowdownpaintingfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyexplosionphotographcharacter name in titlebare chested maleflashbackfightviolence (See All) |
Subgenre: | suspensemartial arts |
Themes: | panichome invasionsurveillanceparanoiarobberydeceptionescapefearbetrayalkidnappingfriendshipdeathmurder |
Locations: | rooftop |
Characters: | security guardwarriorhostagedoctorfather daughter relationship |
Story: | double crossgood versus evilfoot chasemaster apprentice relationshipman fights a womancockney accentwoman fights a manvaultcrashing through a windowoffscreen killingcomputer crackerenglishman abroadbooby trappunched in the chestmentor …mercilessnessexplosivecarnivaljumping from heightkicked in the stomachgothicstylized violencepremarital sexmanipulationcollege studentkicked in the faceknocked outlightningrace against timeattempted murderlibrarynews reportpolice officer killedmixed martial artsambushflashlightinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightcorpsepistolsurprise endingchaseknifeexplosionphotographcharacter name in titlebare chested malegunsexbloodfightviolenceflashback (See All) |
HITMAN: AGENT 47 centers on an elite assassin who was genetically engineered from conception to be the perfect killing machine, and is known only by the last two digits on the barcode tattooed on the back of his neck. He is the culmination of decades of research and forty-six earlier Agent clones -- … endowing him with unprecedented strength, speed, stamina and intelligence. His latest target is a mega-corporation that plans to unlock the secret of Agent 47's past to create an army of killers whose powers surpass even his own. Teaming up with a young woman who may hold the secret to overcoming their powerful and clandestine enemies, 47 confronts stunning revelations about his own origins and squares off in an epic battle with his deadliest foe. (Read More)
Themes: | supernatural powersurveillancedeath of fatherdeceptionescapebetrayalkidnappingsuiciderevengedeathmurder |
Mood: | gore |
Locations: | rooftopairport |
Characters: | hostagedoctorfather daughter relationship |
Story: | two way mirrorthreatened with a knifefoot chaseinvulnerabilitywoman kills a mancrashing through a windowcomputer hackergreenhousesuper strengthtelepathyjumping through a windowbooby trappunched in the chestparking garagekicked in the stomach …security camerascene during opening creditshypodermic needlestylized violencedirectorial debutneck breakinginjectionkicked in the faceknocked outrace against timeproduct placementmapstabbed in the cheststabbed to deathmixed martial artsimpalementdisguisestrangulationambushsurvivaldecapitationshot in the backhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingknifeexplosionphotographcharacter name in titlenumber in titleflashbackviolence (See All) |
With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c …ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)
Subgenre: | suspensecoming of agemartial arts |
Themes: | supernatural powerhome invasionsurveillanceparanoiadeath of fatherrobberydeceptionescapefearbetrayalkidnappingsuicidemurderdeathfriendship …revenge (See All) |
Locations: | rooftopairportlondon englandairplanechurch |
Characters: | secretarysecurity guardwarriorhostage |
Story: | double crossthreatened with a knifefoot chasecoming out of retirementman fights a womanwoman fights a manopen endedwoman kills a mancrashing through a windowsuper strengthlevitationkilling spreewisecrack humorjumping through a windowbooby trap …punched in the chesthypnosishatredexplosiverampageparking garagemind controljumping from heightkicked in the stomachsecurity camerastylized violencerevelationsevered armneck breakingsuicide attemptmanipulationkicked in the faceknocked outrace against timeflash forwardtransformationnews reportstabbed in the chestmixed martial artsdisguisestrangulationambushflashlighthandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionphotographcharacter name in titlebare chested malebloodfightviolenceflashback (See All) |
Air travel is the safest, the FAA says. But the FAA never figured the risk with Charles Rane on board. "The Rane of Terror" has masterminded four terrorist attacks. Soon there will be a fifth -- and that's bad news for the passengers on Flight 163. But there's good news too: the man in seat 57! Wesl …ey Snipes plays John Cutter, an undercover security operative who enters the lavatory and exits to find Rane (Bruce Payne) and his gang have taken over. Cutter's next move is clear. Do. Or be done to. (Read More)
Subgenre: | suspenseblack comedycult filmmartial arts |
Themes: | panicparanoiadeceptionescapefearbetrayalkidnappingmurderdeathrevenge |
Mood: | gore |
Locations: | airportairplane |
Characters: | warriorhostage |
Story: | double crossevil mangood versus evilthreatened with a knifefoot chaseone linerwisecrack humorjumping through a windowpunched in the chestmercilessnessreverse footagecarnivaljumping from heightkicked in the stomachneck breaking …kicked in the faceknocked outrace against timepilotmixed martial artsthroat slittingdisguisestrangulationambushsurvivalshot in the backhandcuffshand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionnumber in titleviolencebloodfightflashbackgun (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
Subgenre: | martial arts |
Themes: | home invasiondeath of fatherdeceptionbetrayalkidnappingdeathmurderrevenge |
Mood: | nightmaregore |
Locations: | cemeterychurch |
Characters: | biblewarriorvampirehostagepriestfather daughter relationship |
Story: | vampire slayergood versus evilthreatened with a knifecoming out of retirementbitten in the neckconfessionalcrucifixionjumping through a windowpunched in the chestcrossbowjumping from heightskullkicked in the stomachcrucifixstylized violence …revelationsevered armneck breakingcrosskicked in the facelightningrace against timeperson on firestabbed in the backtransformationcoffinsevered headstabbed in the cheststabbed to deaththroat slittingimpalementmassacreambushflashlightsurvivaldecapitationinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshotgunshot in the chestblood splatterfistfightcorpsesurprise endingchaseknifeexplosionphotographcharacter name in titlebare chested maleviolencegunbloodfightflashback (See All) |
Now that Dom and Letty are on their honeymoon and Brian and Mia have retired from the game-and the rest of the crew has been exonerated-the globetrotting team has found a semblance of a normal life. But when a mysterious woman seduces Dom into the world of crime he can't seem to escape and a betraya …l of those closest to him, they will face trials that will test them as never before. From the shores of Cuba and the streets of New York City to the icy plains off the arctic Barents Sea, the elite force will crisscross the globe to stop an anarchist from unleashing chaos on the world's stage... and to bring home the man who made them a family. (Read More)
Subgenre: | black comedymartial arts |
Themes: | panicsurveillanceseductiondeceptionescapefearbetrayalkidnappingfriendshipdeathrevengemurder |
Locations: | rooftoptaxiairplane |
Characters: | security guardwarriorhostagefather daughter relationship |
Story: | double crossthreatened with a knifefoot chasecockney accentwoman fights a manwoman kills a mancrashing through a windowoffscreen killingone linercomputer hackercomputer crackerenglishman abroadwisecrack humorpunched in the chestmercilessness …hatredexplosiveparking garagejumping from heightkicked in the stomachsecurity camerascene during opening creditsmanipulationkicked in the faceknocked outrace against timeproduct placementattempted murderstabbed in the backpilotfemme fatalemapstabbed in the chestmixed martial artsdisguisestrangulationambushshot in the backhandcuffshand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionbare chested maleflashbackfightviolenceblood (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | black comedymartial arts |
Themes: | home invasionparanoiadeceptionescapefearbetrayalkidnappingmurderdeathrevenge |
Mood: | nightmaregore |
Locations: | police station |
Characters: | security guardhostagefather daughter relationship |
Period: | 2000s |
Story: | double crossthreatened with a knifefoot chaseman fights a womanstupid victimwoman kills a manstabbed in the armnews reporterkilling spreefemale reporterbooby trappunched in the cheststabbed in the throatmercilessnessjumping from height …kicked in the stomachrevelationpremarital sexkicked in the faceknocked outrace against timestabbed in the backracial slurnews reportcoffinstabbed in the cheststabbed to deaththroat slittingstrangulationambushflashlightsurvivalshot in the backf wordhallucinationhandcuffsheld at gunpointshowdownfalling from heightbrawlpunched in the facerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyphotographbare chested malenumber in titlefightviolenceblood (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ …le'. (Read More)
Subgenre: | black comedymartial arts |
Themes: | panicsurveillanceparanoiaseductiondeceptionescapefearbetrayalkidnappingfriendshipdeathmurderrevenge |
Mood: | gore |
Locations: | taxilondon englandairplane |
Characters: | security guardwarriorhostagefather daughter relationship |
Story: | double crossgood versus eviltwo way mirrorthreatened with a knifefilmed killingcrashing through a windowcomputer hackercomputer crackerburned to deathenglishman abroadwisecrack humorpunched in the chestresurrectionmercilessnessreverse footage …explosiveback from the deadkicked in the stomachsecurity camerahypodermic needlestylized violencetraitorsevered armneck breakinginjectionmanipulationkicked in the faceknocked outrace against timeproduct placementattempted murdernews reportfemme fatalemapdeath of friendmixed martial artsimpalementstrangulationambushshot in the backf wordhallucinationhandcuffsinterrogationbedhand to hand combatheld at gunpointshowdownpaintingbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathpistolsurprise endingchaseknifeexplosionphotographbare chested malebloodflashbackfightviolencegun (See All) |
A war has been raging between the Vampires and Lycan for centuries, Selene (Beckinsale) is a death dealer, assigned to hunt down and eradicate the last of the Lycan. When she comes across Michael Corvin (Speedman) who holds the key to end the war she must decide where her allegiances will lie.
Subgenre: | cult film |
Themes: | supernatural powerdeceptionbetrayalkidnappingmurderdeath |
Mood: | gore |
Characters: | warriorvampire |
Story: | silver bulletevil manancient vampiresexy female vampirevampire slayerfemale vampirefoot chaseregenerationopen endedbitten in the neckstabbed in the armtombjumping through a windowimmortalityhypodermic needle …gothicburned alivetraitorwerewolfneck breakingkeytransformationimpalementambushdecapitationshot in the backheld at gunpointfalling from heightswordpunched in the faceslow motion sceneshotgunshot in the chestblood splattershot to deathcorpsepistolsurprise endingknifepartyexplosionbare chested malebloodflashback (See All) |
Marvel's "Iron Man 3" pits brash-but-brilliant industrialist Tony Stark/Iron Man against an enemy whose reach knows no bounds. When Stark finds his personal world destroyed at his enemy's hands, he embarks on a harrowing quest to find those responsible. This journey, at every turn, will test his met …tle. With his back against the wall, Stark is left to survive by his own devices, relying on his ingenuity and instincts to protect those closest to him. As he fights his way back, Stark discovers the answer to the question that has secretly haunted him: does the man make the suit or does the suit make the man? (Read More)
Subgenre: | black comedymartial arts |
Themes: | supernatural powerhome invasionsurveillancedeceptionescapefearbetrayalkidnappingsurrealismdeathfriendshiprevengemurder |
Mood: | nightmare |
Locations: | rooftop |
Characters: | security guardwarriorhostage |
Story: | double crossevil mangood versus evilfoot chaseman fights a womanregenerationfilmed killingwoman kills a manone linercomputer hackercomputer crackersuper strengthburned to deathwisecrack humorpunched in the chest …mercilessnessmind controlsecurity camerahypodermic needleburned alivestylized violencerevelationsevered armneck breakinginjectionmanipulationknocked outrace against timeproduct placementperson on fireattempted murderflash forwardtransformationnews reportfemme fatalepolice officer killedmixed martial artsdisguiseambushhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightpistolsurprise endingchaseknifepartyexplosioncharacter name in titlebare chested malenumber in titleviolencefightflashback (See All) |
Set within a year after the events of Batman Begins, Batman, Lieutenant James Gordon, and new district attorney Harvey Dent successfully begin to round up the criminals that plague Gotham City until a mysterious and sadistic criminal mastermind known only as the Joker appears in Gotham, creating a n …ew wave of chaos. Batman's struggle against the Joker becomes deeply personal, forcing him to "confront everything he believes" and improve his technology to stop him. A love triangle develops between Bruce Wayne, Dent and Rachel Dawes. (Read More)
Subgenre: | heistsuspensecult filmmartial arts |
Themes: | panichome invasionevilsurveillanceparanoiarobberydeceptionescapefearbetrayalkidnappingmurderfriendshipdeathrevenge |
Locations: | rooftopshippolice stationairplane |
Characters: | secretarysecurity guardwarriorthiefhostagedoctorfather daughter relationship |
Period: | 2000s |
Story: | double crossevil mangood versus eviltwo way mirrorthreatened with a knifecockney accentfingerprintopen endedfilmed killingcrashing through a windowbody bagoffscreen killingcomputer crackerburned to deathnews reporter …killing spreejumping through a windowbooby trappunched in the chestmercilessnesshatredexplosiveparking garagejumping from heightkicked in the stomachgothicburned alivestylized violenceropemanipulationkicked in the faceknocked outrace against timeperson on fireattempted murderkeynews reportpolice officer killeddeath of friendmixed martial artsimpalementdisguiseambushflashlightshot in the backhandcuffsinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyexplosionbare chested malebloodviolencefight (See All) |
Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab …ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)
Subgenre: | black comedycoming of agemartial arts |
Themes: | supernatural powerevilsurveillanceparanoiadeceptionfearbetrayalkidnappingdeathmurderfriendshiprevengesurrealism |
Mood: | nightmare |
Locations: | cemeterychurchschool |
Characters: | warriorvampirepriestfather daughter relationship |
Story: | double crossfemale vampiregood versus evilblood suckingblood transfusionstakeglowing eyesmind readingopen endedbitten in the neckstabbed in the armwisecrack humormentorstabbed in the throatmind control …security camerahypodermic needlestylized violencewolfneck breakingperson on firestabbed in the backlibrarytransformationfemme fatalestabbed in the cheststabbed to deathmixed martial artsstrangulationhandcuffsinterrogationhand to hand combatbrawlarrestslow motion scenerescueshot in the chestfistfightshot to deathdreampistolsurprise endingknifepartyphotographflashbackbloodviolencefight (See All) |
This version of Dracula is closely based on Bram Stoker's classic novel of the same name. A young lawyer (Jonathan Harker) is assigned to a gloomy village in the mists of eastern Europe. He is captured and imprisoned by the undead vampire Dracula, who travels to London, inspired by a photograph of H …arker's betrothed, Mina Murray. In Britain, Dracula begins a reign of seduction and terror, draining the life from Mina's closest friend, Lucy Westenra. Lucy's friends gather together to try to drive Dracula away. (Read More)
Subgenre: | cult film |
Themes: | supernatural powerevilseductionescapesuicidedeathrevengefriendship |
Mood: | gore |
Locations: | shiplondon englandcemeterychurch |
Characters: | warriorvampirepriestdoctor |
Story: | evil mansexy female vampirevampire slayerfemale vampiregood versus evilblood transfusionvan helsingdeath of title charactermistbitten in the neckdraculatombbattelepathymentor …reverse footagecrucifixgothicwolfdestinywerewolfundeadsensualitystabbed in the backcursesearchcoffinsevered headstabbed in the chestthroat slittingimpalementcandledecapitationreference to jesus christbedfalling from heightswordshotgunshot in the chestmirrorblood splatterpistolchaselesbian kissknifepartyphotographcharacter name in titleblood (See All) |
After the terrifying events in LA, John McClane (Willis) is about to go through it all again. A team of terrorists, led by Col. Stuart (Sadler) is holding the entire airport hostage. The terrorists are planning to rescue a drug lord from justice. In order to do so, they have seized control of all el …ectrical equipment affecting all planes. With no runway lights available, all aircraft have to remain in the air, with fuel running low, McClane will need to be fast. (Read More)
Subgenre: | suspenseblack comedycult filmmartial arts |
Themes: | panicparanoiadeceptionescapefearbetrayalmurderdeath |
Mood: | gore |
Locations: | airportairplanechurch |
Characters: | security guardwarriorhostagepriest |
Story: | double crossevil manairplane crashfingerprintcomputer crackerbullet timestabbed in the eyewisecrack humorpunched in the chestmercilessnessexplosivekicked in the stomachtraitorkicked in the facerace against time …pilotpolice officer killedmixed martial artsthroat slittingdisguisemassacrestrangulationambushflashlightsurvivalshot in the backf wordhand to hand combatheld at gunpointshowdownfalling from heightbrawlpunched in the faceslow motion scenerescueshot in the chestblood splatterfistfightshot to deathcorpsepistolchaseknifeexplosionnumber in titlefightbloodviolencegun (See All) |
A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s …tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)
Subgenre: | supernaturalsuspenseblack comedycult film |
Themes: | supernatural powerparanoiadeceptionescapefearsuicidesurrealismdeathmurder |
Mood: | nightmare |
Locations: | catholic churchchurch |
Characters: | catholic priestcatholicprofessorbiblepriestdoctor |
Story: | good versus evilinvulnerabilityregenerationcomputer crackerstabbed in the eyestabbed in the throatmind controlkicked in the stomachcrucifixpremarital sexundeadsevered armneck breakingcollege studentlightning …race against timestabbed in the backkeyracial slurtransformationnews reportsevered headstabbed in the cheststabbed to deaththroat slittingimpalementcandleflashlightsurvivaldecapitationfalling from heightbrawlpunched in the facerescuemirrorblood splatterfistfightcorpsedreamsurprise endingchaseknifebare chested malefightblood (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra …nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
Subgenre: | suspensemartial arts |
Themes: | supernatural powerpanichome invasionparanoiadeceptionescapefearbetrayalkidnappingrevengedeathmurder |
Mood: | nightmaregore |
Locations: | cemetery |
Characters: | professorwarriorhostagedoctor |
Story: | double crossevil manthreatened with a knifefoot chasedeath of title characterinvulnerabilityregenerationfilmed killingoffscreen killingstabbed in the armsuper strengthenglishman abroadkilling spreestabbed in the eyewisecrack humor …punched in the chestimmortalitystabbed in the throatmercilessnesshatredrampagemind controlkicked in the stomachscene during opening creditshypodermic needlestylized violencesevered armneck breakinginjectionkicked in the faceknocked outrace against timeproduct placementstabbed in the backattempted murderracial slurpolice officer killedsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationflashlightsurvivaldecapitationshot in the backf wordhandcuffsinterrogationhand to hand combatheld at gunpointshowdownbrawlswordpunched in the facerescueshotgunshot in the chestmirrorblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionphotographcharacter name in titlebare chested malebloodviolencegunfight (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
Subgenre: | suspenseblack comedycult film |
Themes: | supernatural powerhome invasionparanoiaseductionescapefeardeathsurrealismmurderrevenge |
Mood: | nightmare |
Characters: | security guard |
Period: | 2000s |
Story: | foot chasesilverglowing eyeswoman fights a manwoman kills a mansuper strengthpunched in the cheststabbed in the throatrampageparking garagecarnivalkicked in the stomachscene during opening creditswolfwerewolf …kicked in the faceknocked outproduct placementcursetransformationnews reportsevered headstabbed in the cheststabbed to deathmassacreambushdecapitationshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightshot to deathcorpsepistolsurprise endingchaseknifepartyphotographbare chested malefightviolenceblood (See All) |
High school outcasts stumble upon an old alien ship, where they acquire superpowers and are dubbed the Power Rangers. Learning that an old enemy of the previous generation has returned to exact vegenance, the group must harness their powers and use them to work together and save the world.
Subgenre: | black comedycoming of agemartial arts |
Themes: | supernatural powerpanichome invasionevilrobberydeceptionescapefearbetrayalkidnappingfriendshiprevengemurdersurrealismdeath |
Locations: | shipcemeteryschool |
Characters: | security guardwarriorhostagefather daughter relationship |
Story: | double crossgood versus evilfoot chaseinvulnerabilityglowing eyesregenerationopen endedoffscreen killingsuper strengthlevitationbullet timekilling spreepunched in the chestswampresurrection …mercilessnesshatredexplosiveback from the deadrampagejumping from heightkicked in the stomachdestinyropemanipulationknocked outlightningrace against timeproduct placementflash forwardtransformationnews reportfemme fatalepolice officer killedmapmixed martial artsambushflashlighthand to hand combatheld at gunpointshowdownfalling from heightbrawlswordpunched in the faceslow motion scenerescueshotgunshot in the chestfistfightcorpsepistolsurprise endingchaseexplosionphotographbare chested maleviolencefight (See All) |
Bill Pope (Ryan Reynolds) is a CIA agent on a mission in London tracking down a shadowy hacker nicknamed "The Dutchman." When he gets mysteriously ambushed and killed, an experimental procedure is used to transfer his memories into dangerous convict Jericho Stewart (Kevin Costner). When he wakes up …with the CIA agent's memories, his mission is to find The Dutchman and make the deal with him before the hacker launches ICBM's and starts World War III. But complications soon arise and the mission turns personal. (Read More)
Subgenre: | suspenseblack comedy |
Themes: | panichome invasionsurveillanceparanoiadeath of fatherrobberydeceptionescapefearbetrayalkidnappingrevengemurderdeath |
Locations: | airporttaxilondon englandairplanechurch |
Characters: | professorsecurity guardwarriorhostagedoctorfather daughter relationship |
Story: | double crosstwo way mirrorfoot chasecockney accentwoman kills a mancomputer hackercomputer crackerpunched in the cheststabbed in the throatmercilessnessburglarykicked in the stomachsecurity camerahypodermic needleburned alive …injectionknocked outrace against timeproduct placementattempted murderkeylibrarynews reportpolice officer killedstabbed in the cheststabbed to deathimpalementstrangulationshot in the backf wordhandcuffsinterrogationheld at gunpointshowdownbrawlarrestpunched in the facerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsepistolsurprise endingchaseknifeexplosionphotographbare chested malebloodviolencefightflashback (See All) |