Please wait - finding best movies...
Disney animators set pictures to Western classical music as Leopold Stokowski conducts the Philadelphia Orchestra. "The Sorcerer's Apprentice" features Mickey Mouse as an aspiring magician who oversteps his limits. "The Rite of Spring" tells the story of evolution, from single-celled animals to the …death of the dinosaurs. "Dance of the Hours" is a comic ballet performed by ostriches, hippos, elephants, and alligators. "Night on Bald Mountain" and "Ave Maria" set the forces of darkness and light against each other as a devilish revel is interrupted by the coming of a new day. (Read More)
| Subgenre: | disneycult film |
| Themes: | book of magicgreek mythologystarvationdevilfalling in lovelonelinessmagicdancedrunkennessghostsurrealism |
| Mood: | rain |
| Locations: | oceanlakevillagewaterforestchurch |
| Story: | dinosaur skeletonbathing in a lakeorchestra conductormagical hatflower petalanimate skeletontree barkice skatingfrozen lakejumping into waterfalling into waterchurch bellcatching food in one's mouthanimal licking someonecreation of the world …music conductorcombing someone's hairmagical dustdouble takeflooded roomanimal trackhigh conceptlily padenchanted objectglowing eyepedestalanimal fightsleeping in a chairsleepinessfalse alarmdraughtankylosaurusamoebasighpterosaurcherubfissuretrampledyawncongratulationsplumanimated nuditysparkslippersnowflakenightfalllinegobletvibrationfrostsatyrimagerystegosauruspearruntpillarseaweedtutuspellcastingpegasusspinningdizzinesswhirlpoolcauldronspiderwebpuddlecape the garmentfatigueanimal deathcentaurmanicurezeuscarrying someonechariotgrapevolcanic eruptionpineappledeitysolar eclipsedistractioncollapsetriceratopsgluttonyhippopotamusexhaustionblockadeleafcollisionabstract artgallowssandstormawakeningprehistoryostrichdamagehornbubblebucketextinctionretreatorangebroomcurtainunicorndovebow tiehillapprenticesilhouettebarrelcourtshipcolorpart live actionscarehymntyrannosaurus rexheatarcherrainbowmeteoralligatorpantomimemushroomrobesunrisevenice italycloudsorcererlavagoldfishwellmigrationflutedonkeysunsetreflectionbatcrowshamepalacesmokelightswingcliffshadowbananalipstickheartbathingbutterflysunlaughterthunderstormfairypart animationstarwindclassical musicfloodanthropomorphismearthquakedinosaurappleorchestraskullbuttockshammertemplemouseelephanthatropeicemoonflowerwaterfallgardenunderwaterskeletonscreamlightningtreetransformationanthologygraveyarddream sequenceno opening creditsfishbridgemountainaxeconcertcandlewineswimmingriverdemonfalling from heightrescuemirrorhorsefirepartytitle spoken by characterone word titlekiss (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his …pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
| Subgenre: | disneyfairy talebiblical |
| Themes: | book of magicmagicsurrealismjealousyfearartnatureangertheftunrequited lovehopeunemploymentfreedom |
| Mood: | rainarchive footagepoetic justice |
| Locations: | oceanlakewaterforestnew york citytrainswimming poolhotelcarsnowboatnightclubdesertbicycletaxi …elevatorwoodsapartmentshiptruckrooftopcavesewerforest fire (See All) |
| Characters: | father daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherpolice officerdancermusicianactorartistlittle girlbullywaitresscomedianfisherman |
| Period: | 1930swinter |
| Story: | magical hatflower petalice skatingfalling into waterflooded roomlily padglowing eyesleeping in a chairtrampledlinespellcastingdizzinesswhirlpoolcauldronpuddle …fatiguecarrying someonevolcanic eruptionhippopotamusabstract artcollisionostrichhornbubblebucketextinctionbroomunicorndoveapprenticecourtshippart live actionrainbowmeteoralligatorcloudsorcererlavabatlightcliffshadowbutterflylaughterfairypart animationclassical musicfloodanthropomorphismappleorchestramouseelephanticeunderwaterscreamlightningtreeanthologydream sequencefishmountainaxeriverfalling from heightrescuemirrorhorsefirekissnumber in titlesequeldogdancingknifechasecryingremakecatbooktearsrunningcafepianosubjective cameranewspapersubwaysnakedrawingfishingsearchcoffeepainportraitumbrelladragondollrabbitpianistsadnessratbearnewspaper headlinemonkeyjazzwolffireplacedestructionfaintingperformancemagiciantoyoverallsfrogtennisrailway stationviolinmilkgoatclockembarrassmentpresumed deadtrappedthunderhypocrisymisunderstandingpet doganthropomorphic animalrejectionhungerdespairdrummerballlionvolcanodaydreamspyingdeerturtleduckboxhorse and carriageflightweathercoinjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornseagullquitting a jobjackethostgreat depressionballerinadisappointmentimmaturityeagleasheshammockcrabpart computer animationhonestymistakeapedrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractdoormanlocketgiraffenoiseblanketrebirthrevolving doordance lessonregenerationstreet vendorice rinkbaldnesspaperdance classfaunacity parkconformityflorasheet musicsignnetsubway traincoatphonograph recordvaserhinoceroswheelbarrowmovementfloatingchestzebrajazz clubfigure skatinghard hatleashcartnoseorganisticebergskunksunlightimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonflamingopet storeelkiciclemarqueenoah's arkmilkmanhopscotchmusic lessonscubalife jacketrampstooltripping and fallingashjazz combotubearkcentral parksupernovabillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionhenpecked husbandpantaloonwalnutbranchteardropflipperstepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirddog bonetimingfruit cartseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
When a bottle containing a plea for help from a little girl named Penny makes its way to the Rescue Aid Society, a mouse organization in the basement of the United Nations building dedicated to the rescue and well-being of anyone in need, it is up to the brave mouse Miss Bianca and her chosen partne …r, the shy janitor Bernard, to rescue the girl. Searching for clues at Penny's home at Morningside Orphanage in New York City, the two mice discover that the girl has been kidnapped by the evil pawn shop owner Madame Medusa and her companion Mr. Snoops. On the back of Orville the albatross, Miss Bianca and Bernard travel to the terrifyingly gloomy Devil's Bayou where they learn the shocking truth: the innocent young girl is being forced down into a dangerous, dark underground pirate's cave where she must find the Devil's Eye, the world's largest diamond and Madame Medusa's greatest obsession. Before returning safely home, Miss Bianca, Bernard, and Penny will have to combat Madame Medusa's two ferocious pet alligators Brutus and Nero with the help of Ellie Mae and Evinrude the dragonfly, as well as survive the raging tides inside the horrible pirate's cave. (Read More)
| Subgenre: | disneytragedy2d animationpolitical satire |
| Themes: | falling in lovefriendshipfearangerfaithbullyinghopegreedadoptionprejudicejusticecourage |
| Mood: | rainaffection |
| Locations: | new york citycarairport |
| Characters: | female protagonistlittle girlself esteem |
| Story: | falling into waterwhirlpoolspiderwebcollapseexhaustionleafdamagebucketbroomcurtainrainbowalligatorbatshamelight …lipsticklaughterthunderstormstaranthropomorphismskullmousehatropeunderwaterskeletonscreamfalling from heightrescuekissinterviewflashbackdogexplosionchasetelephone callcryingbased on bookunderwearshotguncatswordliebedprayersubjective cameragood versus evilorphanmapchild abuseradiosearchnews reportumbrellamissionpassionsuitcaserabbitthreatsadnesstrapfirst partwhippingtrustpoemloyaltytalking animalspiderblockbusterteddy bearorphanageembarrassmentjanitortensiondiamondinnocencehatredanthropomorphic animalironynew orleans louisianabroken glassanxietydespairescape attempthit on the headsuperstitiondynamitefogdeerturtlecanechairlanternboxreckless drivingowljoycar troubletablerunning awayunited nationsbottlesarcasmdiggingearringraftbus stophugmessageshoewhistlingblizzardcookiekidnapperstatue of liberty new york citymailboxkindnesspotionmale protagonistfriends who live togetherperfumehammockpawnshopsorrowpitchforkrescue from drowningspoonmoleclumsinessegohandbagdeterminationhungariannoiseexploding boatnightgownchild laborcoatcuriosityfireworkhostilitybayoulazinessconfidenceimitationstar died before releasemockerycastle thunderaudio flashbackblameanimal protagonistenthusiasmpsychological abusechild driving a carair ventcuckoo clockhalf dressed cartoon animalriverboatballadeercombtextbookanthropomorphic mousedefiancedragonflytidefishing rodrailgratitudestringfriday the thirteenthcomforthumilitymisadventurebootfishing polepipe organwater pipepledgediversionalbatrossencouragementimpatienceanthemmessage in a bottlerolling pinbluebirdlost luggagesweepingsmokestackelectrical shockgoofy hollereleganceguide bookrescuermalevolenceelectrical wiresophisticationvalveabandoned boatassertivenessheadlampunderground caverncage elevatorinternational organizationmuskrat (See All) |
Back when the Earth was being overrun by glaciers, and animals were scurrying to save themselves from the upcoming Ice Age, a sloth named Sid, a woolly mammoth named Manny, and a saber-toothed tiger named Diego are forced to become unlikely heroes. The three reluctantly come together when they have …to return a human child to its father while braving the deadly elements of the impending Ice Age. (Read More)
| Subgenre: | cult filmcomputer animationcgi animation |
| Themes: | murderdeathredemptionhuntingevolution |
| Mood: | rain |
| Locations: | villagesnowcavecave in |
| Characters: | baby |
| Story: | ice skatinganimal trackextinctionpantomimelavamigrationcliffearthquakedinosauricewaterfalllightningno opening creditsfishfalling from height …rescuefiretitle spoken by characterflashbackdogfightchaseambushspaceshipcreaturenecklaceon the roadpursuitfirst partsleepingwolfspearslow motiontalking animalmale bondingloss of wifeblockbusterjumping from heightcgicompassionanimal attackloss of sonvolcanoskiingglobal warmingdefecationtaekwondopopcornsquirrelpalm treesnowboardingpunprehistoric timescavemanrescue from drowningavalancheflying saucerglacieranimal that acts humantropical islanddoomhumancoconutinfantrhinocerossnowballdiaperstruck by lightningicebergcgi filmmelonice agestonehengeice sculpturemammalsaladicicleshortcutcave paintinggeyserherdmammothtug of warsinkholeslothneanderthalacorndandelioncave drawingmud bathstepping in shitwoolly mammothhailstick figureice floeice cavetar pitsabertooth tigersurrogate uncleprimitive artcharacter shaped holedodo birdicemansarcasm taken literallypineconecharades the gamemelting iceslalomsliding on iceicecappawprintprehistoric paintingbaby's first steps (See All) |
The fantastic tale of an 18th century aristocrat, his talented henchmen and a little girl in their efforts to save a town from defeat by the Turks. Being swallowed by a giant sea-monster, a trip to the moon, a dance with Venus and an escape from the Grim Reaper are only some of the improbable advent …ures. (Read More)
| Subgenre: | cult filmblack comedyabsurdismsword and sorceryepic |
| Themes: | greek mythologydancesurrealismdeathloverevengesuicidejealousyprisontortureescapefuneralmonstermemoryanger …supernatural powergamblingexecutionjusticeamnesia (See All) |
| Mood: | rain |
| Locations: | waterbeachshipcampfirestormsea monsterstorm at sea |
| Characters: | husband wife relationshipfather son relationshipfather daughter relationshipdoctorsingerbrother sister relationshipteenage girlgirldanceractoractresswitchofficer |
| Period: | 18th century1700s |
| Story: | cherubwhirlpoolgallowscloudsunwindanthropomorphismorchestramouseelephantropeicemoonwaterfallskeleton …lightningcandlewinefalling from heighthorsekissfemale nuditycharacter name in titlebased on novelblooddogdancingexplosionsingingsurprise endingsongshot to deathunderwearbattleswordarrestlettershootingriflerunningislanddecapitationoperanonlinear timelinesevered headbirdassassinationfictional warbathunderwater scenekingmarriage proposaltheaterlegendvirginscreamingkeyangelstorytellingstatuetentreunionqueencoweuropepiratedestinybulletflyingcagequesttreasuregiantcompassionburialcannonhaircutdwarfdiamondimaginationtelescopeticklingbackstageegyptrowboattheatre audiencerosevolcanosiegeturkey the countryhorseback ridingbeheadingwhaleaccordiontween girltheatre productionhurricaneaustriavienna austriawagerchandeliergoddessmosquenuclear bombhot air balloonmusketturkishbritish renaissanceharemvictorygrim reaperorganlockballroomhooksailing shipstrong mansnufffalling off a clifflabor strikecyclopsturbantorture chamberbaroneuropeanstruck by lightningdollhousenosehourglasseunuchparadoxexecutionerstampedesneezesultananchormortarbattering ramtroubled productionseashelldebrisphallusrejuvenationtrippymarksmancannonballtemper tantrumaltruismquillsuperhuman speedvulcanbeauty and the beaststatue comes to lifeknickersliving statuefalling chandeliertickling feetstagehandturkish armyfake nosevenus the roman goddessball and chaincatherine the greatconstantinople turkeymaydayfloating headlunacysandbagcrash helmetsand clockbellowscomrade in armsvenus emerging from a sea shell (See All) |
In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w …ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)
| Subgenre: | disneyfairy tale2d animationfish out of waterbased on fairy tale |
| Themes: | falling in lovemagicdancesurrealismlovefriendshiprevengebetrayalfearweddingangerself sacrifice |
| Locations: | oceanbeachboatkitchenseashipcastlestormcaribbeanstorm at seasea foodsea stormship firesea witch |
| Characters: | family relationshipsfather daughter relationshipteenagerteenage girlfemale protagonistmusicianpriestsister sister relationshipbest friendmaidwitchmermaidevil witchmysterious girllittle mermaid |
| Period: | 19th century1830s |
| Story: | animal licking someonecombing someone's hairlily padwhirlpoolbarrelrainbowflutesunsetsmokestaranthropomorphismropeunderwaterlightningtransformation …fishconcertrescuemirrorfiretitle spoken by characterkissnuditydogfightexplosionsingingknifethree word titlebattlebirthdaybedgood versus evilcookingdisguisedinnerforeign language adaptationbathkingprincessdrowningdangerbased on short storymistaken identitystatueexploding bodysadnessfirst partfireworkssacrificeprincerockpirateteen angstdestructiondressheroinetalking animalscene during opening creditslifting someone into the airroyaltywitchcraftvillainessblockbustergiantcheffrogsharkbrideteenage protagonistanimal attacktelescopeanthropomorphic animalmuterowboathypnosismusical numberspyingyoung loveturtlesailorduckkingdomwishspellcontracthappy endingsidekicklaundrydockscene before opening creditslegsseagull16 year olddolphinnude girlunconsciousnessbubble bathfemale heroswimming underwatermeat cleaverpipepotionfriends who live togetherfinal battlecrabstar crossed loversalter egooctopusexploding shiprescue from drowningsnailconductornakedwavemagic spellshark attackx rayed skeletoncanceled weddingwedding cakefat womancarriagehumanbirdsdefeatvoicedealcuriosityseal the animalforkpuppet showfalse namedanishstruck by lightningjamaicanharpoonblowing out candledisobeying orderslifting a female into the airfireflycollectinganchorcastle thunderclotheslinecinderella storysuper villainesslagoonseashellblue eyesjack in the boxmalletevil laughtershrimpsunken shiphans christian andersenseasicknessred eyesflamingolairfake namemaster of disguisestarfishpelicantridenttalking birdbird attacksea turtletrue identity revealedsailwolf whistlegrottowhite hairmermanblowing smoke in someone's faceredheaded girltalking fishinterspecies romanceseafoodseahorseangry fathersinging animalbedtimeloss of voicedisney princessbluebirdpinching nosebitten on the buttflower in hairgiantessseashell bikinidisguised as humanmoray eelappearing from watercrow's nestobjectspiraling eyestalking crabwashing oneselfbroken teethfiery redheadwasher womanblowing a raspberryflattenedfrench chefold english sheepdogbecoming humandestroying a statuefish tailpolypundersea kingdom (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village … council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
| Subgenre: | cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory |
| Themes: | book of magicmagicsurrealismfriendshiprevengekidnappingbetrayaladulteryescapemonsterheroredemptionsadismcourageforgiveness |
| Mood: | rainpoetic justice |
| Locations: | lakevillageforestsnowboatfarmcastlecampfireroad movie |
| Characters: | family relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boyvillainwitch …self discoverycrying babybaby girl (See All) |
| Story: | magical dustcarrying someoneexhaustionostrichdoveapprenticesorcerercrowsmokefairyapplewaterfallskeletonlightningtransformation …mountainriverfalling from heighthorsetitle spoken by characterone word titlekisscharacter name in titleblooddogfightdancingknifechasecryingpunched in the facecatbattleswordmaskbookshowdownhand to hand combatislandcombatsubjective cameragood versus evilsword fightdisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualjourneyold womanprincesscursemissiondragontentkicked in the facefarmerbodyguardpigcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightlifting someone into the airloss of friendhidingvillainessanimal attackgoatfemale warrioradventurerdwarfshieldwizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamdaggerhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresstavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagergender disguisemagic spellvillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballtyrannymidwifehead scarfcatapultturned to stonemagic showconfidencebraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
Alice is a daydreaming young girl. She finds learning poems and listening to literature boring. She prefers stories with pictures and to live inside her imagination. One day, while enduring just such a poetry reading, she spots a large white rabbit...dressed in a jacket and carrying a large watch. H …e scurries off, saying he's late, for a very important date. She follows him through the forest. He then disappears down a rabbit hole. Alice follows, leading her to all manner of discoveries, characters and adventures. (Read More)
| Subgenre: | cult filmfairy tale2d animation |
| Themes: | magicsurrealismanger |
| Locations: | oceanforestbeachseaengland |
| Characters: | female protagonistgirlsister sister relationship |
| Period: | 19th century1860s |
| Story: | spiderwebmushroombutterflysunanthropomorphismhammermousehatmoonflowergardenunderwatertreetransformationfish …falling from heightfirepartytitle spoken by charactercharacter name in titlebased on noveldogsingingchasethree word titlecryingdreamcattearsbirthdayjudgetrialbirdanimalbirthday partyunderwater scenekingcreaturesmokingkeyumbrellarabbitflowerstwinfireworksqueensisterteaeggtalking animalcakeblockbusterladderrealityeaten aliveimaginationchild's point of viewsandanthropomorphic animalrosecaneirreverencevictorian erainvisibilitybottlelizardcrownharmonicajurypocket watchfantasy worldtoastgiving a toastcookiepipereading a bookaltered version of studio logomatchredcarpenterparallel universecarrotlobstercardsecret passagealternate dimensioncalendardooralice in wonderlandsugarlabyrinthcaterpillartitle appears in songminiaturizationdaydreaminghedgehogangryshrinkingoystertalking cattea partykeyholesneezeplaying cardit was all a dreamwhiteshoremalletwhite rabbitdimensionsentenced to deathcroquetflamingopaintbrushbad temperwalrusrocking horsestarfishmustardharehookahteapotfalling into a holejamwonderlanddoorknoblift skirtsudden change in sizebird's nestrose gardenchanging sizesmoke ringteacupangry womanhybrid animalmad hatteranthropomorphic rabbitbloomersdodogrowing in sizerabbit holeanimal wearing clothesanthropomorphic flowergiantesscharacter shaped holecheshire catdodo birdenlargementlewis carrollno narrationqueen of heartsanthropomorphic sunred paintpied pipermispronounciationtalking flower (See All) |
Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.
| Subgenre: | coming of agecomputer animationslapstick comedycgi animation |
| Themes: | magicghostrevengemarriageescapedeceptionredemption |
| Locations: | villageforestsnowboatwoodsshipcastle |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipteenage girlfemale protagonistgirltough guywarriormaid …witchhunting party (See All) |
| Story: | cauldronbroomarchercrowshadowapplebuttockswaterfalllightningtransformationno opening creditsfishaxeswimmingriver …rescuehorsetitle spoken by characterone word titlefemale nudityf ratedflashbackmale rear nuditydogdancingknifechasesurprise endingvoice over narrationtitle directed by femaleshot to deathshot in the chestslow motion scenepunched in the faceswordbare buttshowdownbirthdaygood versus evilfoot chasesword fightambushmontagekingprincessnecklaceon the runtrainingflash forwardlegendcursecharacter repeating someone else's dialogueprologuescreamingkeyrace against timetough girlprankcontestfeminismchickenshot in the armbearqueenprincestrong female characterchessdestinyfalling down stairsspiritfireplaceteen angstbow and arrowspearheavy rainlooking at oneself in a mirrorcakerebelsheepstrong female leadtorchfateanimal attackfemale warriorshieldtarget practicebraveryscotland3 dimensionalrowboatscene after end creditspunched in the chestmedieval timesprideaerial shotrainstormknife throwingkingdomwisharrowblack magicsign languagehorseback ridingtriple f ratedhit in the facebirthday presentstuffed animalstrongmanshot with an arrowyoung version of characterarcherycrowndomineering motherfemale heromooningmacguffinstablefight the systemheirbechdel test passedbowbagpipesanimal killingbanquetrock climbingmagic spellteenage herothronehide and seekmedievalsuitorscottish accentscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletsgirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spelllutefemale horse riderfemale archerbetrothalplaying bagpipesbullseyehaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All) |
The passage from this world to the fantasy kingdom of Stormhold is through a breach in a wall beside an English village. In the 1800s, a boy becomes a man when he ventures through the breach in pursuit of a fallen star, to prove his love for the village beauty. The star is no lump of rock, it's a ma …iden, Yvaine. Tristan, the youth, is not the only one looking for her: three witches, led by Lamia, want her heart to make them young; and, the sons of the dead king of Stormhold want her because she holds a ruby that will give one of them title to the throne. Assisting Tristan are his mother, the victim of a spell, and a cross-dressing pirate of the skies. Will Tristan win his true love? (Read More)
| Subgenre: | cult filmcoming of ageepicswashbucklersword and fantasy |
| Themes: | magicghostsurrealismmurderdeathlovekidnappingbetrayalescapeunrequited lovehopedyingcourage |
| Locations: | villageforestbeachsnowbathtubstorm |
| Characters: | friendteenage boybabywitchyounger version of characterevil witch |
| Period: | 1870s1850s |
| Story: | lightheartstarmouseelephantmoonflowerlightningtransformationno opening creditscandlefalling from heightrescuemirrorhorse …firetitle spoken by characterone word titlekissf ratedbased on novelviolenceflashbackdancingexplosionchasevoice over narrationfoodblondeswordletterrunningbirthdayscientistgood versus evilsword fightdeath of friendeatingbirdcoffinbathunderwater scenekingprincessconfessionattempted murderargumentprologuerace against timedeath of brotherdeath of sontied upsleepingcross dressingqueenprincepirateballoongothiccagewitchcrafthonorslavetelescopethundermisunderstandingensemble castinsultstick fightmannequinhappy endinginvisibilitydead animaltowerblonde womancrownbroken mirrorfencingmeat cleavercheeseimplied sexlong brown hairstaffcupwaltzstickcrossroadsliverblue blooddeath of kingtied togetherpushed off a cliffintestinemusic score features choirevil princesilver dress (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc …hanted. (Read More)
| Subgenre: | disneycoming of agetragedyfairy taleslapstick comedyfish out of waterdark fantasybased on fairy tale |
| Themes: | magicdancesurrealismloverevengekidnappingjealousyfearescapemonsterdeceptionobsessionsupernatural powerdeath of motherblackmail …redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
| Mood: | poetic justice |
| Locations: | lakevillageforestbarsnowparis francebathtubwoodsfrancecastlerooftop |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglelittle boymaidwitchgrandmother grandson relationship …single fatherex soldier (See All) |
| Story: | frozen lakehornstaranthropomorphismropeicegardenlightningtransformationno opening creditsbridgemountaincandlefalling from heightrescue …mirrorhorsefirepartytitle spoken by characterkisscharacter name in titleflashbackdogbare chested malefightdancingphotographexplosionsingingchasesurprise endingpistolvoice over narrationbeatingcorpseshot in the chestremakeslow motion scenepunched in the facebattleswordkissingbrawlpaintingshowdownrifleheld at gunpointbedpianoshot in the backbedroomsword fightdisguisewomanmontagefour word titlemapfalse accusationbirddrawingcontroversykingcreaturebartenderflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outmanipulationwigtied upcabinloss of motherlove interestreference to william shakespearequeenprincesingle parentchesswerewolffalling down stairswolffireplacedressheroineheavy raintalking animalhunterloss of wifeblockbustereccentriccomposerservantjumping from heightculture clashstrong female leadcgitorchcompassionanimal attackclockfull moonfight to the deathinventorfalling to deathescape attemptballensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagedinner tablefantasiesstudio logo segues into filmstrong femalecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
After a beautiful princess, Aurora, is born in to royalty everyone gathers to exchange gifts. Everything is perfectly fine until an unwanted guest appears, Maleficent. Magnificent casts a spell on the young princess and announces that she will die by pricking her finger on the spindle of a spinning …wheel on the evening of her 16th birthday. Fortunately, one of the good fairies, Merryweather, changes the spell so Aurora will fall asleep, and that the only way to wake her up were the tears from her true love. Finally the day comes. Will she be left to sleep forever? (Read More)
| Subgenre: | disneyfairy talesword and sorcery2d animationsword and fantasybased on fairy talehand drawn animationtraditional animation |
| Themes: | magicdancedrunkennesssurrealismfriendshipprisonheroevil |
| Locations: | forestfrancecastle |
| Characters: | father son relationshipteenage girlfemale protagonistwitchbaby girlevil witch |
| Story: | spinningawakeningbubblebucketbroomrainbowlightfairyflowerfishmountainwinedemonhorsefire …kissbloodsingingvoice over narrationcryingbattleswordbirthdaycombatgood versus evilbound and gaggedsword fightbirthday partyforeign language adaptationkingfemme fataleprincesscursemistaken identitydragonrabbitgifthorse ridingtrapqueenprincespeardresseggcakelifting someone into the airwitchcraftvillainessblockbusterknightcelebrationguardstupiditydamsel in distressshieldlove at first sightprophecyhypnosisoildungeonkingdomarrowowlspellhappy endingfinal showdownstonetrue lovecrownsquirrelsleepcottageyoung womanfriends who live togetherfinal battleravencleaningyoung manhappy birthday to yousurprise partylifting female in airbirdshuman becoming an animalcoatmagic wandfireworkfalling asleepturned to stonechimneytalking to an animalfire breathing dragonmockerycastle thundersuper villainesssurprise birthday partyplatefalling off horsemop14th centurydrawbridgeacornbootsleeping beautycradlepet bird16th birthdayspinning wheeldisney princesslutebluebirdhelpingstorybook in opening shotbetrothalthornbaking a caketransmutationpricked finger (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir …ing genuine courage. (Read More)
| Subgenre: | cult filmblack comedysupernaturalfairy taleslapstick comedydark fantasy |
| Themes: | magicdrunkennessghostsurrealismmurderdeathrevengekidnappingmoneybetrayalprisondrinkingfeartortureescape …monsterdeceptionmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All) |
| Mood: | rainnightmare |
| Locations: | villageforestchurchsnowcemeterysmall townwoodscastlecavegermany |
| Characters: | mother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior …witchmayorfrench soldier (See All) |
| Period: | 19th century1810s |
| Story: | wellcrowpalaceshadowapplehatropetreetransformationaxecandlewinefalling from heightrescuemirror …horsefiretitle spoken by characterkisscharacter name in titlebloodviolenceflashbackdoggunfightdancingexplosionknifethree word titlepistolcorpseunderwearfoodshot in the chestshot in the headcatdrinkbattleswordarrestbookriflerunningbedinterrogationhallucinationshot in the backdecapitationbound and gaggedold manstabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingcreaturefemme fatalegunshotflash forwardattempted murdergravecursestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianwolfbow and arrowmedicineflyingwoundgothiccagelifting someone into the airbarnfraudtorchgoatstreet lifeback from the deadcannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrowntheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
Philipe Gastone, a thief, escapes from the dungeon at Aquila, sparking a manhunt. He is nearly captured when Captain Navarre befriends him. Navarre has been hunted by the Bishop's men for two years, ever since he escaped with the Lady Isabeau who the Bishop has lusted after. Navarre and Isabeau have … a curse that the Bishop has placed on them that causes Navarre to be a wolf during the night and Isabeau to be a hawk during the day. Navarre insists that Philipe help him re-enter the city to help him kill the heavily guarded Bishop. (Read More)
| Subgenre: | sword and sorcerysword and fantasy |
| Themes: | magicmurderdeathloveprisondrinkingescapetheftevilprison escapereligious tolerance |
| Mood: | rain |
| Locations: | waterforestchurchsnowcastlecampfiretunnelsewer |
| Characters: | dancerpriestthiefhorse actor |
| Story: | church bellsunrisewellsunsetmouseicegardenunderwatertransformationmountainaxeswimmingriverfalling from heightrescue …horsetitle spoken by characterkissbloodviolencefightdancingchasecryingdreamfoodbattleswordtearsrunningjailprayercombatsword fightimpalementstabbed to deathprisonerstabbed in the chestchildbirdfictional warcursefugitivemissionpassionrabbithangingpursuitcrossreunionbattlefieldwolfbow and arrowspearelectronic music scoreslow motionquestjail cellhuntersheepknightmonkcrossbowdark heromedieval timesdungeonrainstormarmorkingdomhorseback ridingspellpickpockettowershot with an arrowdiggingbishopsword fightingcathedralstar crossed loverstragic loveinnhorse and wagonhawkeclipsetalking to selfbear traphuman becoming an animaldawnladyfalconfalling through iceanimal traplovers reunitedpicking a lockkilled with a swordlock pickrider horse relationshiparrow in chesttalking to goddrawbridgecorrupt priestgirl horse relationshipbell ringingbareback ridingdrainenchantmenttrapperduskriding barebackblack horsesword throwingevil spellluteplanetary alignmentwoman horse relationshipboy horse relationshiptransformfemale horse riderleg hold trapandalusianbird of preyman horse relationshipspeaking in rhymegirl riding a horsestabbed with an arrowstabbed with swordtalking to a horsehooded cloakfalconerfalling from a towerblack knightcastle ruinscow skulltrained horseturned into a birdtwo riding a horse (See All) |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi …c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
| Subgenre: | live action and animation |
| Themes: | magicdancedeathfearmilitaryangerpanic |
| Locations: | villagebeachmotorcyclesmall townlondon englandbicycleenglandcastlejunglemuseumtrain stationsubmarine |
| Characters: | childrensingerbrother brother relationshipboysoldierdancermusicianpriestlittle girllittle boywitchgermanhuman animal relationship |
| Period: | world war two1940syear 1940 |
| Story: | ostrichretreatbroomapprenticealligatorclifflaughterpart animationanthropomorphismmouseelephantropeunderwaterscreamtransformation …dream sequencefishcandlemirrorfirefightdancingexplosionsingingknifepistolcryingbased on booksongmachine gunpunched in the facebattleswordletterbookriflebombrunningbedbritishislandcompetitioncombatorphansoccerflashlightold manchildfishingkingcigar smokingnecklacegunshotlibrarybinocularsuniformfantasy sequencetentrabbitpianistpursuitcountrysidebearmonkeyapplausewaitercaptainentertainmentgrenadebow and arrowathleteflyingspearperformancelifting someone into the airragemagiciancaptivetoyenemywitchcraftfraudaudienceparadecolonelfull moonshieldexplosiveinvasionanthropomorphic animalevacuationdrummerballcon artistlionarmorraidsailortrophypigeoncrowdmusic bandposterrefereeplaying cardsimprisonmentspellauntmagic tricknotebookchoreographystreet marketbicyclingperformergorillatween girlwhistlecrowndrummedalcottageold ladyfortressshow businessnewspaper articlebellstretchermegaphonelistening to radiometamorphosisunsubtitled foreign languagepotionpalm treetrumpetdocumentexperiment gone wrongentertaineroctopuscellsorceresspigtailscockney accentkangarooliquidpet catanimal that acts humangiraffelockballroomvulturehookmarchstreet vendorscottishcupmacejugglingnetcommunicationhuman becoming an animalgoalbattle axeeast indianspectatorrascalturbanmatchmakerleopardlongingvicarkiltoil lampfootball matchhead scarfsaxophonistnurseryfurrypart animatedlagoonflea marketbraidsmodel traincheeringhalf dressed cartoon animalgroceriesshorelinehyenaincantationmiddle age romanceflying broomcharlatancharmrhinobarefoot cartoon animalinterdimensional travelpeddlerchartwarthogcartoon reality crossoverseahorsehippoclamsinging triopartingroarcalypsochorinegoofy hollerwire cuttersanimal metamorphosisshort wave radiofinchreference to botticellideserted houseflying bedsteel drumpartially lost filmunnatural experiment (See All) |
A prehistoric epic that follows a young mammoth hunter named D'Leh's journey through uncharted territory to secure the future of his tribe. When a band of mysterious horse-riding warlords raid the Yaghal camp and kidnaps his heart's desire - the beautiful Evolet along with many others, D'Leh is forc …ed to lead a small group of hunters south to pursue the warlords to the end of the world to save her. Driven by destiny, the unlikely band of warriors must battle saber-toothed cats and terror birds in the Levant. (Read More)
| Subgenre: | epic |
| Themes: | magicdancemurderdeathlovefriendshipkidnappingbetrayalprisonmonsterdeath of motherabusedyingblindnessself sacrifice …huntingdeath in childbirthmurder of motherfight for freedom (See All) |
| Mood: | rain |
| Locations: | lakevillagesnowboatdesertjunglecampfire |
| Characters: | father son relationshipmother son relationshipfriendboygirldancerpriestwarriorreference to godwitch |
| Story: | trampledcollapseexhaustionhornsunsetsmokeflooddinosaurtemplemoonskeletonlightningtreemountainriver …falling from heightrescuehorsefirekissnumber in titlebloodfightdancingknifechasevoice over narrationcryingbeatingcorpsefoodpunched in the facebattlemasklietearshand to hand combatdead bodyjailhallucinationcombatorphanmassacrestabbingdeath of friendeatingarmyprisonerbirdacronym in titlefictional warritualsearchjourneyflash forwardlegendstabbed in the backprologuespiritualityliartentscarpursuitstalkinggifttrapwhippingsubtitled scenegolddestinybow and arrowspearwoundinjuryquestslaveryjail cellcaptivehuntertorchburialanimal attackslavepromiseshieldface painttarget practicetelescopeconstruction sitewhiprejectionresurrectionfalling to deathbutcherprophecyfather figureabsent fathersuperstitionaerial shotfallrainstormtriberaidheroismspittingmysticismagriculturemeathuman sacrificesailboatshot with an arrowarcherywhistledrumhuntstretcherpyramidpremonitionblizzardprehistoric timesdeath of familyrevoltstealthritescoldingcavalryuprisingbonedreadlocksnegotiationpitrebirthvulturesailing shiploinclothchantingspiritualismcustomfloodingsnowstormnetmessiahanimal rescuefuneral pyrepharaohnorth africaethnographytalking to an animaltrekcaught in a netseedstar gazingstone agestampedechantseparation from familythrown from heighttrackingpriestessblessingwar paintherdmammothancient cultureconstruction craneseerallycave womanstabbed with a spearcave drawinggiant birdwoolly mammothdying in someone's armsfalling objectmanaclesancient citydragged along the groundslave revoltlong fingernailssabertooth tigertransferencetribal warfarearmbandcauterizing a woundcheerprimitive artbuilding a firefalse godclub the weaponmedicine womansabre toothed catwhipping a slave10000 b.c.arrow in one's backrising from the gravethatched roofthe onewalking in circleshearthimpaled on a spearmurder of a kingslave uprising (See All) |
Inventor Gepetto creates a wooden marionette called Pinocchio. His wish that Pinocchio be a real boy is unexpectedly granted by a fairy. The fairy assigns Jiminy Cricket to act as Pinocchio's "conscience" and keep him out of trouble. Jiminy is not too successful in this endeavor and most of the film … is spent with Pinocchio deep in trouble. (Read More)
| Subgenre: | disneyfairy tale2d animationbased on fairy tale |
| Themes: | magic |
| Mood: | rainnight |
| Locations: | boatseaitaly |
| Characters: | father son relationshipboy |
| Period: | 19th century1880s |
| Story: | goldfishdonkeysmokefairystaranthropomorphismappletransformationfishcandlemirrorfiretitle spoken by characterone word titlecharacter name in title …based on noveldancingsingingcryingcatbookliebeerislandchildunderwater scenespankingcigar smokingpuppetumbrellalifting someone into the airblockbusterpoolfaked deathcarnivalunderage drinkingtitle appears in writingbilliardswishcoinlyingforename as titlewhalefoxmetamorphosisconsciencealtered version of studio logounderage smokingfamous scorestarssnoringcarriagehuman becoming an animalyoung boyreading a letterwish fulfillmentmagic wandstudio logo segues into filmmarionettesneezingpadlocknosepuppeteerrotoscopingpinocchiocuckoo clockcricket the insectjackassschool kidsmona lisafishbowlswallowed wholepuppet theaterafipet fishanthropomorphic toycagedevil smilestorybook in opening shotwishing on a starhitting oneselfanthropomorphic insectsplashing water on one's faceblowing one's nosecharacter turns greenwirelessjiminy cricketanthropomorphic foxtalking foxunable to sleep (See All) |
The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by … 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)
| Subgenre: | independent filmcoming of ageepic |
| Themes: | deathmarriagereligionjealousypregnancyfearmemorytheftdysfunctional familyguiltgriefbullyingeducationphotographyhope …crueltychildhoodinheritanceafterliferegret (See All) |
| Mood: | rainavant gardemoving |
| Locations: | oceanforestchurchbeachrestaurantschoolswimming poolcemeterysmall townairplanebathtubdesertbicycleelevatorwoods …urban settingpolice carseacourtroombaseballouter spacechinatexasstormrunning into water (See All) |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipafrican americanchildrenbrother brother relationshipboypolicemanmusicianbabypriestthiefchristian …reference to godbullywaitresschristianitylittle boycatholicchinesegrandmother grandson relationshipengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All) |
| Period: | 1950s |
| Story: | silhouettemeteorlavashameswingshadowbutterflysunwinddinosaurflowerwaterfallgardentreegraveyard …fishbridgecandleswimmingrivermirrorfirekissflashbackdogbare chested malefightdancingexplosiontelephone callvoice over narrationcryingcell phonefoodface slapslow motion scenecatarrestpaintingbooklietearsrunninglingeriedead bodycafepianoclassroomprayerguitarhalloweensurvivalnewspaperflashlighteatinghousesnakenonlinear timelinechild abuseapologyman with glassescoffinbathunderwater scenesearchjourneydrowningpaingunshotflash forwardclownsuburbfired from the jobliarstorytellingreadingbaseball batflowerscourtdeath of brotherchildbirthdeath of sonclasssleepingtrustkillingredheadhateblack americanrecord playermachismoeyeglassesdestinybreaking and enteringlooking at oneself in a mirrorlistening to musicfaintingrecordingvandalismguitariststealingplanetswimsuitsharkladderbirthfollowing someoneend of the worldambitionpromisesufferingthundermourningloss of sonchild protagonistkickinginsectcigarette lighterbible quotecard playingsibling rivalryvolcanoatticchoirbarbecueexistentialismgrowing upmarital problemloss of brotherchildhood memoryfast motion scenebeing followedpiano playersermonspittinggiving birthhandshake12 year oldgardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned houselizardvery little dialogueskyscrapernaivetyseagullwhisperingenvybubble bathstrokebare chested boyelectric shocktrain tracksuniverseswimming underwaterbreaking a windowguitar playernewborn babyclimbing a treefailureprehistoric timestelegramreading a newspaperstarscar radiotreehousegrassdistrustdeath by drowningtoy gunfetuswaveplant in titleexpectant motherdomineering fatheroverhead shotsaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklerlawn sprinklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb guncrossing oneselfwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinpraying handswaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All) |
After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h …is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)
| Subgenre: | martial artscoming of agesword and sorcerydark fantasysword and fantasy |
| Themes: | magicdrunkennessmurderdeathrevengeescapemonsterdeceptionredemptionunrequited lovehome invasiongreed |
| Mood: | rainnightmare |
| Locations: | villageforestsnowsmall townboatwoodscastlecave |
| Characters: | father son relationshipfather daughter relationshipbrother sister relationshipsoldierhostagethieftough guylove trianglewarrioraction heromayorsingle father |
| Story: | barrelmushroomwellfloodskullicewaterfallskeletontransformationno opening creditsfishbridgemountainaxeriver …falling from heightrescuefirepartytitle spoken by charactercharacter name in titlebased on novelbloodviolencesequelflashbackfightphotographexplosionknifechasedreamshot to deathblood splatterfistfightshot in the chestshot in the headwritten by directorbattleswordarrestbrawlhand to hand combatsecond parthallucinationcombatshot in the backsubjective cameradecapitationgood versus evilfoot chaseassassinsword fightambushstrangulationthroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapsevered headchild in perilfictional warunderwater scenekingcreatureshot in the legshot in the foreheadcharacter repeating someone else's dialoguestabbed in the backkeyperson on firefantasy sequencepoisoncharacter's point of view camera shotdragonrace against timeknocked outtough girlringshot in the shoulderscarneck breakingtrapshot in the armpubsubtitled scenestylized violencesingle parentgoldfalling down stairsbow and arrowkilling an animalspearassassination attemptquestbarnjail celltreasureblockbustergiantaction heroineanimal attackgoatfemale warriorguarddwarfshieldburglardual wieldstabbed in the throat3 dimensionalstabbed in the neckshot in the facewizardprophecystabbed in the headstabbed in the legfogcapturedisfigurementknife throwingstabbed in the eyeeye patchlens flarekingdomprequelteleportationpipe smokingtorso cut in halfelftombfemale soldierinvisibilitydirector cameoshot in the neckfemale fightergiant monsterbeeshot with an arrowamputeestabbed in the armshot in the eyecrystaldamfriends who live togetherstabbed in the shoulderclimbing a treeshot in the throatdisfigured faceopen endedcorrupt officialshapeshiftingsubterraneanjewelfreedom fighterclose up of eyeanimal killingforce fieldarmoryleg woundburning buildinghumangiant spiderchopping woodstabbed in the mouthgold coinwheelbarrowhidden doorwine cellargiant creaturelost in the woodsorbdog sledfire breathing dragoncliffhangerspider webhealing powerballadeerstaringcocoonsignalhobbitmoonlightprequel and sequelnecromancersinger offscreenflying dragonminstrellive action remaketapestryflatterywinged dragonwhite mouseapprehensiongold ringstone bridgetalking dragongold statuepoisoned arrowsilver coinbare foot manpile of goldsleepyglowing crystalthrush (See All) |
Balthazar Blake (Nicolas Cage) is a master sorcerer in modern-day Manhattan trying to defend the city from his arch-nemesis, Maxim Horvath (Alfred Molina). Balthazar can't do it alone, so he recruits Dave Stutler (Jay Baruchel), a seemingly average guy who demonstrates hidden potential, as his reluc …tant protege. The sorcerer gives his unwilling accomplice a crash course in the art and science of magic, and together, these unlikely partners work to stop the forces of darkness. It'll take all the courage Dave can muster to survive his training, save the city and get the girl as he becomes The Sorcerer's Apprentice. (Read More)
| Subgenre: | cult filmmartial artscoming of age |
| Themes: | book of magicmagicsurrealismmurderdeathlovekidnappingbetrayalherodeceptionrobberysupernatural powerhome invasionself sacrificenear death experience …unlikely herobook of evil (See All) |
| Mood: | car chase |
| Locations: | waternew york citytraincemeterytaxielevatorapartmentpolice carcastlerooftopindialaboratorytunnelschool bus |
| Characters: | teenagerteacherpolice officerstudenthostagetough guywarrioraction herowitchchinesegirlfriend |
| Period: | 2000s2010s21st centuryyear 2010year 2000 |
| Story: | enchanted objectglowing eyebroomapprenticesorcererfloodskullhatlightningtransformationaxedemonfalling from heightrescuemirror …horsefirekissviolenceflashbackdogfightexplosionknifechasethree word titleshowercell phonecar accidentbattleswordletterpaintingbookshowdownhand to hand combatapostrophe in titlecar crashbathroommanhattan new york cityfightingcombatgood versus evilfoot chasesword fightstrangulationmassacredisguisedeath of friendmontagemixed martial artsstabbed in the chestsubwaysnakechild in perilritualroommatenecklacetrainingduelflash forwardparkprologueelectrocutionumbrellamissionpossessionproduct placementdragondollstatuetough girlcollege studentringdatethreatened with a knifesacrificehenchmanpizzawolffireplacekilling an animalwhat happened to epiloguegothicheavy rainquestfaintingrome italymagicianloss of loved oneeccentricimpersonationchefjumping from heightrailway stationmind controlparking garagecarnivaltorchanimal attackinterracial friendshipcrushed to deathback from the deadfemale warrioryogareverse footageimpostoregyptresurrectionwizardimmortalityscene after end creditsbased on storyrainstormcanenoteclassmatedemonic possessionpuppysword duelbenchalarm clockburned to deathteleportationsurprise after end creditsimprisonmentspellcoffee shopimpersonating a police officerlevitationrobberfountainteenage lovespiral staircasecockroachfireballlockerworld dominationbrooklyn bridgemegalomaniacmicrosoft windowsbroken mirrorradio stationpyramidreluctant herocrashing through a windowbulleaglemuggingbritaindisembodied headtimes square manhattan new york cityflamecollege campusorchestral music scorepark benchshape shiftermiddle agesshapeshiftingsorcerysymbolsorceresscockney accenturnstatue of libertychosen oneteenage herochrysler building manhattan new york cityradio djchildhood sweetheartbased on poemmistvaseantique shoppendantbritish accentel trainempire state building manhattan new york citypepsigargoyleteenager fighting adultmuggerfire breathing dragonnight cityscapefear of heightssecret laboratorycar stuntevil sorcererlovers reunitedconfettisatellite dishbegins with narrationvintage cargreat wall of chinamagical mirrormopsplit headchinatown manhattan new york cityincantationnew york universitymagical ringmaster apprentice relationshipcircleevil wizardfight in the restroomhole in wallantennahole in chestsabredemonesslecture hallbook of the deadbrushing one's teethfire axeinanimate object comes to lifeabsorbing powerfalling objectsuccessorevil spellawakened by an alarm clockwashington square manhattan new york citywizardrydeath of mentortribeca manhattan new york citytesla coilmountain dewfifth avenue manhattan new york city8th centurypassing notetrapped in a mirrorasian dragonbattery park manhattan new york citychild witchsecret hiding placepompadourtrapped soulabandoned subway stationantique dollbryant park manhattan new york city (See All) |
John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to …survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)
| Subgenre: | martial artscoming of ageblack comedysword and sorcerydark fantasysword and fantasy |
| Themes: | magicghostsurrealismmurderdeathloverevengekidnappingbetrayalfearescapemonsterdeceptionrobberysupernatural power …death of motherredemptionunrequited lovehopecourageself sacrifice (See All) |
| Mood: | nightdarkness |
| Locations: | villageforestchurchsnowwoodsfarmcastlecampfirewalled city |
| Characters: | mother son relationshipmother daughter relationshipsoldiersister sister relationshiptough guywarrioraction heroalcoholicteacher student relationshipwitchevil witchdeath of student |
| Story: | jumping into watercauldronapprenticeskullwaterfallskeletonlightningtransformationno opening creditsbridgemountainaxedemonfalling from heightrescue …horsefiretitle spoken by characterbased on novelviolencedogfightexplosionknifechasesurprise endingfistfighturinationslow motion scenebattleswordbrawlshowdownhand to hand combathallucinationcombatgood versus evilassassinsword fightambushstrangulationmontagethroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestanti herochild in perilfictional warunderwater scenecreaturefemme fataletrainingskinny dippingstabbed in the backprologueattackpossessiondragonrace against timefarmerexploding bodypigthreatened with a knifebearqueenbattlefieldstylized violencestrong female characterhenchmandestinybow and arrowburned alivespearassassination attemptheavy raincagecatfightvillainesseccentricgiantjumping from heightirishknightstrong female leadtorchaction heroinefemale killerbar fighteaten alivefull moonretirementvisiontarget practicebraverycrossbowdual wieldson3 dimensionalstabbed in the headoiltime lapse photographystabbed in the legdark heroaerial shotknife fightwisecrack humorrainstormdeerdisfigurementknife throwingdemonic possessiontragic heroblack magicburned to deathexorcismteleportationswordsmanfemale fightergiant monstertwo man armyworld dominationfemale spyhired killertavernassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladestabbed in the faceclawgravestonepitchforkchosen onearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonebased on young adult novelcaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airwoman murders a manmaster apprentice relationshipshape shiftingsororicideaxe throwingman murders a womanbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningopening creditswoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All) |
In Victorian London, England, a little mouse girl's toymaker father is abducted by a peglegged bat. She enlists the aid of Basil of Baker Street, the rodent world's answer to Sherlock Holmes. The case expands as Basil uncovers the crime's link to a plot against the Crown itself.
| Subgenre: | disney2d animation |
| Themes: | drunkennesssurrealismkidnappinginvestigationanger |
| Mood: | rainnight |
| Locations: | london englandcastlebar brawl |
| Characters: | father daughter relationshipdetectivethiefvillaingirl crying |
| Period: | 19th century1880s |
| Story: | robebatshadowthunderstormanthropomorphismmousehatwinehorsetitle spoken by characterbased on noveldogsingingcryingsong …catbattletearsanimal in titlerobotcriminalgood versus evilnewspaperbound and gaggeddisguisekingratqueenmaniacprivate detectiveflyingballoontalking animalroyaltyvictimfemale tied upclockeaten aliveanthropomorphic animalfalling to deathfallmustachekingdomanimal name in titlemudbanditvictorian erasidekickfinal showdownfountaintelling someone to shut uptreasonlizardmachinemegalomaniaccrownbellassistantfallingkickfriends who live togetherfinal battlecaperedpart computer animationoutlaw gangsherlock holmesfootprintbitehumankidnapbig ben londoncriminal mastermindcigarette holderangrywine bottleharpdirected by several directorsmale tied upchorusmousetrapcompanionreference to sherlock holmesreference to napoleoncastle thundercrying childbad tempermammalanthropomorphic mouserodentcockneytoy makercitizenreference to queen victoriacat versus mousebasset houndarch villainclaw fightegomaniacright hand mansinging animalgang that lives togetherlosing temperanger issuescat versus dogbig bentalking mouseimpersonating a soldieranimal villainanger anonymousdr watsonyear 1887talking ratbad temperedbroken wing (See All) |
Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi …kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)
| Subgenre: | independent filmb moviesword and sorcerysword and fantasychrist allegorygothic horror |
| Themes: | devilmagicdrunkennessmurderdeathrevengekidnappingreligionbetrayaltorturefuneralmonsterdeceptionredemptionfaith …abductioncannibalismmurder of familycooking over a campfire (See All) |
| Locations: | villageforestchurchsnowcemeterywoodsenglandshipcastlecavecampfire |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierpriesthostagewarriorbiblewitchself mutilation …ex soldiership captain (See All) |
| Period: | winter16th century1600s |
| Story: | frozen lakesorcerercrowcliffhattransformationno opening creditsaxeriverdemonfalling from heightrescuemirrorhorsefire …title spoken by charactercharacter name in titlebloodviolenceflashbacktwo word titlebare chested malegunexplosionknifechasesurprise endingcorpseblood splattershot in the chestshot in the headslow motion scenebattleswordmaskbased on comicshowdowninterrogationbritishprayershot in the backdecapitationgood versus evilsword fightambushmassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestsevered headanti herochild in perildouble crosskingjourneyshot in the foreheadcursestabbed in the backprologueperson on firestatuetentknocked outdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armundeadprincerevelationheavy rainslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controltorchmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydark herodead childjumping through a windowdungeonmurder of a childsoulhealingrainstormdisfigurementdark pastaxe murderdemonic possessionsevered legblack magicburned to deathwilhelm screamdaggerteleportationmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortressshot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired malehorse chaseknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganhealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All) |
The beautiful and kindhearted princess Snow White charms every creature in the kingdom except one - her jealous stepmother, the Queen. When the Magic Mirror proclaims Snow White the fairest one of all, she must flee into the forest, where she befriends the lovable seven dwarfs - Doc, Sneezy, Grumpy, … Happy, Bashful, Sleepy, and Dopey. But when the Queen tricks Snow White with an enchanted apple, only the magic of true love's kiss can save her. (Read More)
| Subgenre: | fairy tale2d animationbased on fairy tale |
| Themes: | book of magicmagicmurderdeathlovefriendshipjealousyescapedeception |
| Locations: | forestcastlegermany |
| Characters: | brother brother relationshipfemale protagonistvillainwitchstepmother stepdaughter relationship |
| Period: | 19th century1810s |
| Story: | cape the garmentcrowthunderstormanthropomorphismapplelightningtransformationfalling from heightmirrorhorsekissf ratedcharacter name in titlenumber in titlesinging …chasegood versus evilassassindisguisecoffinprincessattempted murderdangerpoisonrabbitsleepingqueenprinceroyaltyhunterwitchcraftvillainesscrushed to deathdwarfdiamondsoapanthropomorphic animaldungeondeerturtleminekingdomblack magicowlspellminingschemecrownsquirrelflyheiressfriends who live togetherminersorceressraccoonthronevulturebanishmentpick axesneezingmagical potionsneezesnow whiteevil queenyounger brothermagical mirrormirror does not reflect realityolder brothercobwebevil stepmotherbrothers grimmcandlesticktalking to mirrorcandlelight vigildark powerdisney princessbluebirdpoison applewoodsmanthrone roomstorybook in opening shotglass coffinseven dwarvesdiamond minemouseholemythical kingdomspitewashing oneselfanimal senses evilsleeping potionsleeping princess (See All) |
Oscar Diggs ('James Franco'), a small-time circus magician with dubious ethics, is hurled away from dusty Kansas to the vibrant Land of Oz. At first he thinks he's hit the jackpot-fame and fortune are his for the taking. That all changes, however, when he meets three witches, Theodora ('Mila Kunis' …(qv)), Evanora ('Rachel Weisz' (qv)), and Glinda ('Michelle Williams (I)' (qv)), who are not convinced he is the great wizard everyone's been expecting. Reluctantly drawn into the epic problems facing the Land of Oz and its inhabitants, Oscar must find out who is good and who is evil before it is too late. Putting his magical arts to use through illusion, ingenuity-and even a bit of wizardry-Oscar transforms himself not only into the great and powerful Wizard of Oz but into a better man as well. (Read More)
| Subgenre: | slapstick comedyfish out of watersteampunkchrist allegory |
| Themes: | magicsurrealismlovefriendshiprevengekidnappingbetrayaljealousyfeartortureescapedeceptionsupernatural powerredemptionfaith …hopefreedomcouragenear death experienceunlikely herocheating death (See All) |
| Locations: | forestcemeterywoodswheelchaircastlestormwalled city |
| Characters: | family relationshipsgirlsoldierhostagesister sister relationshiplove trianglewitchengineerevil witch |
| Period: | 1900s |
| Story: | chariotbubblemeteorcrowpalacesmokefairyanthropomorphismappleflowerwaterfalllightningtransformationgraveyardaxe …riverfalling from heightrescuehorsefirekissdancingexplosionsingingknifechasebattleshowdowngood versus evilfoot chaseorphanambushdisguisemontagearmymapfalse accusationanti herofictional wardouble crosscreaturejourneyfemme fataleprincessnecklaceon the runattempted murderscreamingclownelectrocutionattackstorytellingstatueknocked outmanipulationscargiftloss of fatherfireworksmonkeybattlefieldhatecircusgoldfalling down stairsrevelationflyingspearlooking at oneself in a mirrortalking animalquestcatfightagingmagiciantreasurehidingwitchcraftvillainesseccentricservantjumping from heightfaked deathcarnivalanimal attackbroken legcannonpresumed deadfull moonbraveryimpostorpower outageevacuationwizardprophecyimmortalityexilecon artistlionthrown through a windowfogcapturekingdomrocketcon manillusionmagic tricklevitationhit in the facestrongmanfireballfilm projectorcrowntornadocornfieldcrash landingreluctant herofall from heightscarecrowtrumpetbroken heartcapesewing machinechainedhot air balloonmusic boxkansasgrudgefake moustacheforce fieldthronetop hatbanishmentgold coincrystal ballmagic wandzero gravitystowawayguerilla warfarevisionarygunpowderleather pantsgluespear throwingalternate worldcoin tossprojectionwizard of ozmagician's assistantfighting in the airtwo sistersreference to thomas edisonmagical ringflying broomorigin storywandcharlatanreference to houdinigreen skinoptical illusionozsleight of handdark forestpoison appleshowmanblack hatbroomstickporcelainyear 1905heir to throneflying monkeyred hatgood witchmunchkintalking monkeyconcealing the truthblack cloaklife debtpoppy fieldgoing over a waterfallhole in floorwitch hat (See All) |
"The Croods" are an eccentric family of cavemen, who survive the harsh terrain by living accordingly to a strict set of rules. But when their home is destroyed in the wake of an impending disaster known as "The End", they are forced to leave their home of shelter and security, and into the wildernes …s of the unknown to find a new home. (Read More)
| Subgenre: | computer animationslapstick comedycgi animation3d animationteen romance |
| Themes: | homelessnesshunting |
| Mood: | night |
| Locations: | cave |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipteenage girlteenage boyfemale protagonistgrandmother grandson relationshipgrandmother granddaughter relationshiphuman animal relationship |
| Story: | volcanic eruptionprehistoryhornsunriselavasmokesunearthquakedinosaurflowerskeletonmountainswimmingfalling from heightfire …character name in titletwo word titlebare chested malechasevoice over narrationpunched in the facesurvivaldisguisebirdjourneyold womanpuppetperson on fireumbrellatrapfireworksgrandmothermonkeystrong female characterdestructioneggcaptiveblockbusterstrong female leadteenage protagonisttorchshoesscene after end creditstigernarrated by characterpetsidekickwhalepopcornshoehand over mouthmother in lawbeltprehistoric timescavemanrock climbingcornlogstory tellinglabyrinthfurboy girl relationshipcuriositycloudsfireworkrunning for your lifejumping off a cliffwalking stickfamily in dangerbouldershellboy meets girldisobeying ordersoverprotective fathertradition versus modernityteenage rebellionhuman preycountingstarfishcave paintinganimal costumesloththe endstarting a firestrict fathertarteen rebelcave womanhandprintwreckagecomplainingflock of birdsburnedprehistoric manbig catflintcarnivorous plantanimal skeletondimwitcarnivoredeath of neighboranimal skincavegirlnyctophobiacrevice (See All) |
A Christlike figure wanders through bizarre, grotesque scenarios filled with religious and sacrilegious imagery. He meets a mystical guide who introduces him to seven wealthy and powerful people, each representing a planet in the Solar system. These seven, along with the protagonist, the guide and t …he guide's assistant, divest themselves of their worldly goods and form a group of nine who will seek the Holy Mountain, in order to displace the gods who live there and become immortal. (Read More)
| Subgenre: | cult filmexperimental filmabsurdismabsurd comedycult classic |
| Themes: | dancedrunkennesssurrealismdeathdrugsreligionmoneylesbianismdrinkingfeartheftbrutalitydrug usepoetryexecution …greedblindnessrevolution (See All) |
| Mood: | goresatireavant gardebreaking the fourth wall |
| Locations: | barhelicoptersnowcemeteryboatbathtubbuswheelchairshipmexicotunnelsex in car |
| Characters: | husband wife relationshiphomosexualfather son relationshippolicemother son relationshipchildrentattooprostitutesoldieraliendancerbabypriestthiefreference to god …christianityhomosexualityjewsecretarycatholicwriter directordeafnessactor director writerreligious iconreligious statueself delusionsex robot (See All) |
| Story: | imagerycarrying someonehippopotamusdoverainbowmushroomgoldfishbathingskullmouseelephantflowertreetransformationgraveyard …mountainaxedemonmirrorhorsefirepartykisssexfemale nuditynuditybloodmale nudityviolencebare breaststhreesomefemale frontal nuditymale frontal nuditymasturbationmale rear nuditydogbare chested malegunfightfemale full frontal nuditydancingmale full frontal nudityexplosionknifethree word titlevoice over narrationlickingbeatingcorpsetesticlesfoodurinationshotguncomputercameradrinkswordundressingbare buttmaskshootingvomitingriflebombbedmarijuanabathroompianoislandreference to jesus christmale pubic hairguitaralcoholstripperold manmassacrecocainetoiletfemale pubic hairweaponsnakenunbirdcoffinfictional wargarter beltritualjourneycigar smokingdrowningpublic nuditylimousineclownspiritualitystripteasefactorywritten and directed by cast membermassagestatuedirected by starbodyguardpresidentcrossgovernmentrock 'n' rollhorse ridingpigchickensevered armpoetwhippingdismembermentfull frontal nuditytransvestitecircusoccultgoldgrenadenipples visible through clothingwarehouseballoonlooking at oneself in a mirrorcakequesttouristarchitecturecomic bookhelmetmagiciancrucifixdemonstrationtoyspiderplanetbarefoot malefrogproduced by directorgoatfemale warriorgas maskguarddwarfabsurd humorpillshippiedrummerimmortalityrowboatscissorssculpturedead childmeditationfascismtigercanecastrationbarefoot femaleexistentialismsevered legchaintripwritten by starsymbolismmannequinteleportationchauffeurcamelceremonymale objectificationearphonescandycrucifixionjudaismapparitionmysticismmummyfountaindead animalmusclemantowercrutchesvery little dialoguefemale genitaliaamputeebroken mirrordrumseagulllsdtaking a bathnihilismfactory workercellobayonetfinger cut offmanuscriptperuchimpanzeefeathersitting on a toiletpolygamydance sceneritedead birdknittingfiring squadsurrendertoy gundogfightenlightenmentmattresspsychotronic filmaltardicephobiagurumountain climbingbanquetbreaking a mirrorcasketmars the planetthronevulturepilgrimageblasphemybody paintbuddhaloinclothmodern arttoadinitiationexcrementgold cointarantulatarotlambtumorsolar systemsanta claus suitcrossing selfzenhermaphroditehand kissingcadaverprocessionray gunanimal sexmarchingalchemybiblical referencegreen hairmohawk haircuteunuchfalconleg bracegas chamberstrong sexual contentburning moneymidnight moviejaguarman dancing with manglass eyepsychedeliapythongeeseproduced by actorlaxativehair dyeice sculptureroman soldierstarfishmale bare butthead shavingpelicanseven deadly sinschameleoninvented languagemarketplacestoningalchemistmayanoverweight manchrist figurechief of policeslideshowmagic actwashing someonejupiter the planetspiritual journeywashing feetlima perusex in limousinemenorahsaturn the planetprosthetic body partbook of the deadhall of mirrorsoxboa constrictorlederhosencracked mirrorpeg legtoy factoryperuviantoy horsechamber potvenus the planetgold nuggetmale star appears nudepluto the planetexplicit nuditymale secretarynothingnessfan dancerpantheonfrontal nudityexotic animalneptune the planetwashing someone's feetmultiple amputeeuranus the planetman in a bathtubmating animalsmouse costumebreathing tubeglyphlever action rifle (See All) |
At the end of each Antarctic summer, the emperor penguins of the South Pole journey to their traditional breeding grounds in a fascinating mating ritual that is captured in this documentary by intrepid filmmaker Luc Jacquet. The journey across frozen tundra proves to be the simplest part of the ritu …al, as after the egg is hatched, the female must delicately transfer it to the male and make her way back to the distant sea to nourish herself and bring back food to her newborn chick. (Read More)
| Subgenre: | nature documentary |
| Themes: | starvationdeathlovenaturerivalryphotographydying |
| Mood: | nightdarknessaffection |
| Locations: | oceanwatersnowstormearth |
| Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipparent child relationship |
| Period: | winter |
| Story: | jumping into wateranimal deathexhaustionmigrationcliffsunwindicemoonunderwaterfishmountainswimmingsexvoice over narration …foodanimal in titlesurvivalbirdnarrationritualunderwater scenesearchjourneydisappearancereunionwildlifesleepingeggblockbusterlossbirthanimal attackdivinghungertribeweatherseparationpenguinpredatorwhistlingblizzardroadblockswimming underwaterfeetriteglacierdeterminationcompassantarcticathirstwingsaerial photographyseal the animalfreezingmarchingtrekcold the temperaturecyclemonogamybreedingiciclesea lionchickseasonsinstinctsouth polefreezing to deathtemperatureautonomyanimal birthmatinganimal matinghatching eggholding one's breathelectronic scorelife cyclesex drivestealing a babywarmthslidingvisible breathoffspringleopard sealtrue lifeaurora australisbroodlearning to walk (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
| Subgenre: | sword and sorceryepicdark fantasysword and fantasy |
| Themes: | magicdrunkennessghostsurrealismmurderdeathfriendshiprevengebetrayalpregnancyfearescapefuneralmonsterinvestigation …deceptionangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All) |
| Locations: | villageforestchurchsnowwoodscastle |
| Characters: | husband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipsoldierbabyhostagetough guywarrioraction herosingle fatherpregnantengineer |
| Story: | retreatapprenticesorcererpalaceshadowskullhammerskeletonlightningtreetransformationno opening creditsmountainaxeriver …demonfalling from heightrescuehorsefireone word titlebased on novelbloodviolencebare chested malefightexplosionknifechasesurprise endingvoice over narrationbeatingcorpseshot to deathblood splatterfistfightshot in the chestshot in the headslow motion scenepunched in the facebattleswordarrestbrawlbookshowdowninterrogationcombatsubjective cameradecapitationgood versus evilsurvivalsword fightambushstrangulationmassacredeath of friendthroat slittingarmyimpalementstabbed to deathprisonerstabbed in the chestmapsevered headanti herobirdchild in perilfictional wardouble crossritualunderwater scenekingcreatureduelone against manylibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facetough girlmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenebattlefieldprincestylized violencesingle parenthenchmaneavesdroppingtraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardexploding buildingkicked in the stomachplanetblockbustergiantpoolrebelsevered handcovered in bloodsheepknightmind controlhonortorchburialaction heroineanimal attackcrushed to deathslavefemale warriorfull moonguardbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationsword duelblack magicwilhelm screamtelekinesisdaggerexorcismteleportationtelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagehead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackdreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower strugglehorse chasemacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All) |
Pooh, a bear of very little brain, and all his friends in the Hundred Acre Wood sing their way through adventures that encompass honey, bees, bouncing, balloons, Eeyore's birthday, floods, and Pooh sticks.
| Subgenre: | disney |
| Themes: | surrealismfriendship |
| Mood: | rainbreaking the fourth wall |
| Locations: | forestsnowenglandstorm |
| Characters: | mother son relationshipboy |
| Story: | ice skatinggluttonydonkeybutterflywindfloodelephanttreeanthologydream sequencerescuepartycharacter name in titlevoice over narrationdream …creaturefirst of seriesumbrellarabbitpigbearballoonheavy rainrainstormtigernoteowlweatherbeetreehousekangaroobased on children's bookfootprintyoung boyhoneytoy comes to lifebeehivehalf dressed cartoon animalwinnie the poohpigletweaselvegetable gardengopherhybrid animalstorybook in opening shotspiraling eyes (See All) |
In this charming film based on the popular L. Frank Baum stories, Dorothy and her dog Toto are caught in a tornado's path and somehow end up in the land of Oz. Here she meets some memorable friends and foes in her journey to meet the Wizard of Oz who everyone says can help her return home and possib …ly grant her new friends their goals of a brain, heart and courage. (Read More)
| Subgenre: | allegory |
| Themes: | magicdancefriendshipescapedysfunctional familyguiltabductioncourage |
| Locations: | villageforestsnowbicyclefarmroad tripcastlewalled city |
| Characters: | husband wife relationshipsingerhostagewitchuncle niece relationshipaunt niece relationshipcoronerevil witchgirl and her dog |
| Story: | slipperbubblebroomcurtaincrowheartflowertreeaxefalling from heightrescuehorsefiretitle spoken by characterdog …singingcryingsongdreamcatsecretgood versus evildisguisechild in perilperson on firethreatmonkeyrunawaytalking animalquestfaintinglifting someone into the airwitchcraftvillainesshomecompassionanimal attackcrushed to deathclockguarddwarfinnocenceimpostorpet dogwizardawardlionjumping through a windowdeath of sisterdungeonsnowingsecret identityfortune tellerbrainadolescentauntlevitationgatefireballfarmhousetween girlmedalhot dogtornadoshoecornfieldunconsciousnessfantasy worldchandelierscarecrowhot air balloonbeauty salonbechdel test passedreference to abraham lincolnkansaspigtailsrecluselocked in a roomintellectualdoormanvoyagemagic spellcowardicecrystal ballfalling asleepniecehomesicknesshourglassbasketrich snobalternate universetalking to a dogdeus ex machinait was all a dreampleadingwizard of ozcrossroadslittle personpet owner relationshipcharlatandrawbridgereference to julius caesarfarm handapple treegreen skinreference to cleopatracycloneanimate treedeath certificatediplomaowner dog relationshipwavinghaunted forestreference to isistin mansmall dogtalking treefacadewoodsmanreference to the egyptian god osirisaccidental herobroomstickomaha nebraskahome sweet homepigstybucket of waterflying monkeyimaginary landmagical shoegood witchskywritingfloating headloyal doganthropomorphic treemelting womanoil canpoppy fieldflying witchhonorary degreeruby slippers (See All) |
Having lived a life in selfishness, a young prince is cursed by a mysterious enchantress to having the appearance of a monstrous beast. His only hope is to learn to love a young woman and earn her love in return in order to redeem himself. Years later, his chance shows itself when a young maiden nam …ed Belle offers to take her ill father's place as his prisoner. With help from the castle's enchanted staff, Belle learns to appreciate her captor and immediately falls in love with him. Back in the village however, an unscrupulous hunter has his own plans for Belle. (Read More)
| Subgenre: | disneycult filmfairy tale2d animationsteampunkbased on fairy tale |
| Themes: | magicdancesurrealismdeathmarriageheroobsessionunrequited loveinheritanceregret |
| Mood: | rainaffection |
| Locations: | villageforestbarsnowfrancecastle |
| Characters: | mother son relationshipfather daughter relationshipfemale protagonisthostagelove trianglevillainhuman animal relationshipfrench maid |
| Period: | 18th century |
| Story: | enchanted objectbatthunderstormanthropomorphismtransformationno opening creditscandlefalling from heightrescuemirrorhorsefirecharacter name in titledogfight …cryingbattlebookbeertearssubjective cameragood versus evilfour word titledinneranimalnarrationprincessduellibrarycurseattackcharacter's point of view camera shotrace against timereadinghairy chesthorse ridingpigprinceteawolffireplaceheroineeggroyaltyhunterenemyblockbusterservantsheepclockinventorpet dog3 dimensionalbutlerrosedisfigurementgadgetarrowblack magicwilhelm screamspellsidekicknarratortowermachineselfishnessshot with an arrowbeastyoung womantavernalternative lifestyleinfatuationfemale herofriends who live togetherrainingpart computer animationfatal attractionopposites attractmale in bathtubmagic spelllogballroom dancingsittingstockholm syndromeangry mobtitle appears in songhuman becoming an animalcuriosityfireworkcandelabramaster servant relationshipwardrobelifting a female into the airlifting an adult into the airstoveremadeanimal lovertempersneezebattering ramblonde stereotypebelgiancount downegotismplatechauvinismanimate objectrider horse relationshiplifting a male into the airmagical mirrorspeciesismteapotgirl horse relationshiphumilityhospitalitybeauty and the beastlove for animalsanimal lovecandlestickinterspecies romancepants falling downfeather dusterwolf attackdisney princessunconventional romanceteacupimax versionshallownesswolves1740smuscular manmud puddlependulum clockinterspecies relationshipwhite magicbeast in titlebibliophiliagirl riding a horsethumbs upreference to beauty and the beastunconventional relationshipinterspeciesismman turned into an animalwork horseanthropomorphic clockbeing differenthuman turned into an animalmantle clocktalking objectanthropomorphic candleanthropomorphic objectbeast's heart (See All) |
| Subgenre: | martial artsblack comedysuspensesupernaturalfairy talesword and sorcerydark fantasysword and fantasybased on fairy tale |
| Themes: | magicsurrealismmurderdeathloverevengekidnappingmarriagebetrayalfearescapemonsterherodeceptionanger …obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
| Locations: | villageforestchurchsnowwoodscastlecampfire |
| Characters: | soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy |
| Story: | archerpalacefairyiceflowerwaterfalltransformationno opening creditsbridgemountainaxecandleriverrescuemirror …horsekisscharacter name in titlebloodviolencesequelflashbackbare chested malefightexplosionknifechasesurprise endingvoice over narrationbeatingcorpsefistfightshot in the chestface slapshot in the headslow motion scenepunched in the facebattleswordbrawlshowdownhand to hand combatsecond parthallucinationcombatsubjective cameragood versus evilorphansword fightambushmassacremontagearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationanti herobirddisarming someoneone man armychild in perilfictional wardouble crosskingcreaturefemme fatalenecklaceon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechesseavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathdual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequeltelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womantragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
The world is divided into four kingdoms, each represented by the element they harness, and peace has lasted throughout the realms of Water, Air, Earth, and Fire under the supervision of the Avatar, a link to the spirit world and the only being capable of mastering the use of all four elements. When …young Avatar Aang disappears, the Fire Nation launches an attack to eradicate all members of the Air Nomads to prevent interference in their future plans for world domination. 100 years pass and current Fire Lord Ozai continues to conquer and imprison anyone with elemental "bending" abilities in the Earth and Water Kingdoms, while siblings Katara and Sokka from a Southern Water Tribe find a mysterious boy trapped beneath the ice outside their village. Upon rescuing him, he reveals himself to be Aang, Avatar and last of the Air Nomads. Swearing to protect the Avatar, Katara and Sokka journey with him to the Northern Water Kingdom in his quest to master "Waterbending" and eventually fulfill his destiny of once again restoring peace to the world. But as they inch nearer to their goal, the group must evade Prince Zuko, the exiled son of Lord Ozai, Commander Zhao, the Fire Nation's military leader, and the tyrannical onslaught of the evil Fire Lord himself. (Read More)
| Subgenre: | martial artscoming of agesword and sorcerydark fantasychrist allegory |
| Themes: | magicsurrealismdeathlovefriendshiprevengekidnappingbetrayalescapedeceptiontravelphilosophyself sacrifice |
| Mood: | live performance |
| Locations: | oceanvillagewaterforestsnowdesertshipcastlecavecampfireprison campmother earth |
| Characters: | family relationshipsfather son relationshipteenagerchildrentattoobrother brother relationshipbrother sister relationshipsoldierhostagewarriorlittle boyuncle nephew relationshipgrandmother grandson relationshipgrandmother granddaughter relationship |
| Story: | palacesmokeskulltempleicemoonskeletonno opening creditsfishbridgemountaincandleriverrescuefire …title spoken by characterflashbackfightexplosionknifechasesurprise endingvoice over narrationcorpseremakeslow motion scenebattlearrestinterrogationgood versus evilsword fightmontagearmymapchild in perilfictional wardouble crossunderwater scenecreaturejourneyprincesson the runtraininglibrarybased on tv seriesspiritualityattackdragonstatuelong taketrapthreatened with a knifegeneralprincerockspiritbow and arrowkilling an animalspearassassination attemptquesthelmetrebelliongenocidehonortorchmonkback from the deadcannonfemale warriorguardvisionreincarnationchild's point of viewresistance3 dimensionalresurrectionrowboatenvironmental issuecapturetribekingdomnarrated by characterface masklevitationmysticismfemale fighterfireballworld dominationarcticsuper powerscommanderbased on cartoonbellfilm starts with textoffscreen killinghandcuffedaltered version of studio logoopen endedwarlordglaciernew agecolonydreadlocksglowing eyesgas explosionstarts with narrationcryogenicsscrollbanishmentmessiahhands tiedwarshipfrozen bodyboomerangchild heroicebergstudent teacher relationshiptidal wavesticksphereavatarcheeringpyrokinesisicicleyin and yangmaster apprentice relationshipindustrializationhanged bodynaturalistashgiant waveigloobetrayedtechnocracysuspended by armsremake of tv showbeam of lightchild warriorfrozen in icewriter cameobased on animationchiicebreakerwhitewashhidden civilizationash fallmeditatehand gliderhidden cityflotillahydrokinesislive action adaptationspiritual power (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f …riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
| Subgenre: | cult filmmartial artstragedysword and sorceryepicsword and fantasy |
| Themes: | magicmurderdeathlovefriendshiprevengekidnappingpregnancytortureescapeweddingmonsterherodeceptionmemory …death of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeancecourage (See All) |
| Mood: | rain |
| Locations: | lakevillageforestwoodsfarmcastle |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guywarrioraction herovillainuncle nephew relationshipgrandfather grandson relationship …grandmother grandson relationship (See All) |
| Story: | retreatarchersorcerercrowsmokelightningbridgemountainaxecandlewinefalling from heightrescuehorsefire …kissbloodviolenceflashbackfightexplosionknifechasecryingblood splatterfoodslow motion scenebattleswordbookshowdowntearshand to hand combatrunningneighborcombatsubjective cameragood versus evilsurvivalsword fightmassacrestabbingthroat slittingeatingarmymixed martial artsprisonermapdisarming someonefictional warkingprincessnecklaceduelgravelibraryattackpoisonninjapassionreadingfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralbattlefieldchild murderdestinybow and arrowspearmachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardmedieval timespridedungeoncapturearmorraidsiegelieutenantkingdomsword duelblack magictelekinesisdaggerimprisonmentheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downfantasy worldsword and sandalheirclimbing a treetitle in titleflamedeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekshot with a bow and arrowbrother in lawstrawberrychopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear …ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)
| Subgenre: | cult filmcoming of agesword and sorcerysteampunk |
| Themes: | magicsurrealismfriendshipkidnappingbetrayalfearmonsterangerforgivenessmythology |
| Mood: | rain |
| Locations: | forestwoodscastlecavecampfirestorm |
| Characters: | father daughter relationshipfriendteenage girlgirlbabycrying baby |
| Period: | 1980s |
| Story: | sorcererlipsticklaughterfairywindropegardenlightningtransformationcandleriverrescuemirrorfiretitle spoken by character …one word titledogdancingphotographsingingcryingsongdreamurinationslow motion scenecatbattleswordmaskbooktearsrunningsubjective cameragood versus evilsnakechild abusechildkingcreaturesearchjourneylegendcostumepuppetrace against timetentbraceletringactor shares first name with charactertrapbrothertied upchickensisterrockundergroundelectronic music scorequestbabysitterhelmetlifting someone into the aircaptivetoygiantladderknighttorchclockcannoncelebrationfull moonguardthunderbraverypet dogstairslionarmorgrowing upwishfortune tellerowlweathermemory lossspelljewelrystrugglegatejunkyardmazeselfishnesswallstepmotherbeast16 year oldbellfantasy worldwormmetamorphosisfemale heromissingeyeballtrollgoblincowardsiblingriddletrapdoorcockney accentthe muppetsalice in wonderlandpitsnoringlabyrinthsittingcrotch shotbattle axecrystal ballwish fulfillmentmasqueradeperilmorphingbad smellclock towervirtual setlancelifting a male into the airpeachfantasy lifesentrymasked ballactor voicing multiple charactersgownmasquerade partycitadelbogtrumpeterdoor knockerfoot bridgebulgerevulsionescher stairwayactress voicing multiple charactersoubliettebaby cribpea shootertalking worm (See All) |
Aladdin is a poor street urchin who spends his time stealing food from the marketplace in the city of Agrabah. His adventures begin when he meets a young girl who happens to be Princess Jasmine, who is forced to be married by her wacky yet estranged father. Aladdin's luck suddenly changes when he re …trieves a magical lamp from the Cave of Wonders. What he unwittingly gets is a fun-loving genie who only wishes to have his freedom. Little do they know is that the Sultan's sinister advisor Jafar has his own plans for both Aladdin and the lamp. (Read More)
| Subgenre: | disney2d animationbased on fairy tale |
| Themes: | magicprisonescapeherorobberypovertyevilfirst love |
| Mood: | breaking the fourth wallpoetic justice |
| Locations: | snowdesertcitycavesubmarine |
| Characters: | father daughter relationshipthiefvillainthief hero |
| Period: | 18th century |
| Story: | sorcererlavapalacebananaanthropomorphismappleelephantgardentransformationfishmountainrescuehorsefiretitle spoken by character …one word titlekisscharacter name in titlebased on noveldogdancingsingingchaseswordjailgood versus evilbound and gaggedsword fightdisguisechildbirdunderwater scenecontroversyprincessdrowningsmokingmicrophonemissionactor playing multiple rolescheerleaderratfirst partfireworksmonkeyprincechessrunawaytalking animallifting someone into the airtreasureblockbusterimpersonationjumping from heightsheepparadeguardmiddle easttrappedanthropomorphic animalbalconytigerwishparrotwilhelm screamcamelhappy endingsidekickmarketbreadbeeyoung womanblackboardblizzardhypnotismfriends who live togetherrags to richesfinal battlecrabpart computer animationgenieyoung manracial stereotypetailoranachronismstafftitle appears in songcobrascotsmanwish fulfillmentfire breathingfalse namefortunesaudi arabiahourglasslifting a female into the aircarpetgiant snakesultanbare midriffdiamond ringsphinxsecret laboratoryevil sorcererlampreference to arnold schwarzeneggerflamingorubystealing foodhookahtalking birdrubber duckbased on folk talevoice imitationreference to jack nicholsonreference to jerry lewisblue skinreference to groucho marxreference to pinocchioaladdincrackermagical lampstiltspants falling downmagical carpetthree wishesarabian nightsdisney princessreference to peter lorrestreet urchinanthropomorphic birdflying carpetball and chainreference to casanovareference to robert de niroreference to ed sullivanforbidden cityreference to ethel mermantoy monkey1710sreference to cab callowayspiraling eyesreference to dumboreference to a thousand and one nightsreference to rodney dangerfieldreflection in an eyegenie in a bottlereference to walter brennan (See All) |
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. …When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
| Subgenre: | cult filmstop motionstop motion animationdark fantasypuppet animation |
| Themes: | lonelinessghostsurrealismkidnappingfearmonsterangerdeath of mothertheatre |
| Mood: | rainnightmaremoving |
| Locations: | forestsnowmotorcycleboatbicyclewoodstexastunnel |
| Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipsingerboyfemale protagonistactresslittle girllittle boygrandmother grandson relationshipmermaiddisappearance of one's father |
| Story: | spiderwebrainbowreflectionbatshadowthunderstormmousegardenlightningcandlerescuemirrortitle spoken by characterone word titlecharacter name in title …based on novelblooddogphotographsingingvoice over narrationcryingcell phonesongdreamfoodcomputercatcameralettertearsneighborpianoprayerorphanbedroomflashlighteatingdinnersearchold womankeybuxomangelsuitcasedolltentflowerspianistdisappearanceratstagesleepingreference to william shakespearepizzacircuseyeglassesteafireplacetalking animalcakelifting someone into the aireccentriccannoncorsetthunderticklingimpostorpet dogchild protagonist3 dimensionalinsecttheatre audiencescissorsscene after end creditsparachutefogbalconycanepajamaslaptop computercandyforename as titleneedlestuffed animalrunning awayglovesold dark housespiral staircaseeyebicyclingbugsleeptheatre productionfantasy worldmetamorphosischeesemichiganacrobatclueoregonbechdel test passedgame playingsewingriddlesecret passagepet catclothing storehide and seekspotlightcat and mousehorror for childrenbeetleblue hairsecret doorsnowglobeshakespearean quotationghost childlemonadetalking catfortune tellingwalkeralternate worldmoving vannew homecotton candystuffed animal toymilkshaketrapezetoy trainwallpaperslugvoidparallel worldshummingbirdpraying mantisold mansionsearch for parentthreadplayer pianoknitting needlemirror as portalgarment buttonpeeling skincataloguehigh diveseashell bikinimechanical handbig topdowsing rodskipping stonemoving crewtea leavesblowing a raspberrybreaking mirrorlorgnettestuffed toy dogdowsingeye cut outpoison oaktoy chestwell shaft (See All) |
Epic adventure Exodus: Gods and Kings is the story of one man's daring courage to take on the might of an empire. Using state of the art visual effects and 3D immersion, Scott brings new life to the story of the defiant leader Moses as he rises up against the Egyptian Pharaoh Ramses, setting 600,000 … slaves on a monumental journey of escape from Egypt and its terrifying cycle of deadly plagues. (Read More)
| Subgenre: | black comedyepicchrist allegorybiblical |
| Themes: | starvationsurrealismmurderdeathrevengereligionpoliticsfearescapeweddingfuneraldeath of fatherbrutalityparanoiagrief …illnessfaithhopecrueltypanicdyingfreedomcouragehuntingcooking over a campfire (See All) |
| Mood: | raindarkness |
| Locations: | villagebeachboatdesertfarmshipcavecampfirestormship explosion |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbrother brother relationshipboybrother sister relationshipsoldiersister sister relationshipthiefjewishreference to godinterracial relationshipchristianity …little boybibleuncle nephew relationshipfishermanbaby boyfacial tattoo (See All) |
| Story: | chariotgrapegallowssandstormarcherwellsunsetpalaceclifflightningno opening creditsfishmountainaxecandle …falling from heightrescuehorsefirekissbloodviolencebondagedogbare chested malefightexplosionknifechasesurprise endingcryingcorpseshot to deathfoodshot in the chestbattleswordarrestshowdownliehand to hand combatrunninginterrogationhallucinationcombatshot in the backsubjective cameraspysurvivalassassinsword fightold manmontageeatingarmyimpalementstabbed to deathstabbed in the chestsnakeapologyunderwater scenekingsearchshot in the legdrowningpainflash forwardperson on fireattackliarrace against timestatuetentknocked outdeath of childhangingpursuitdeath of sonthreatthreatened with a knifechickengeneralwhippingcowtrustarsonbattlefieldprincerioteavesdroppingdestinysabotagedestructionbow and arrowkilling an animalspearassassination attemptmass murderheavy rainhelmetslaverydiseaseragebeardhidingfrogsheepparadetorchanimal attackmilkgoatcrushed to deathbroken legslaveeaten aliveguardpromiseshieldsufferingthunderconstruction siteloss of sonstabbed in the throategyptironyshot in the faceprophecydelusionexilehit on the headsibling rivalrybelief in godarmortribedead boydaggerhorseback ridingcameltombsaving a lifebarking dogjudaismmummydead animaldoubttreasoncrocodileplagueshoutingstabbed in the armtornadoseagullhearing voicesflyfilm starts with textpyramidadopted sonsense of smellsword and sandalstabbed in the shoulderempireshot in the throathonestymaggotcaravanstabbed in the facefather son reunionwaking upmilitary trainingmonumentman on firehorse and wagonshepherdfloggingancient egyptvillain not really dead clichethronehebrewoverhead shotchantinglootingcatastrophemercylambfalling off a cliffcobraquarryflaming arrowrunning for your lifemessengerhusband wife reunionegyptiandead babyguerilla warfarepharaohembroiderydead fishtidal wavebased on the bibleexodusomenkiss on the foreheadwalking in the rainmarriage ceremonysphinxanimal sacrificeclappingvenomemancipationlanceswarmencampmentbedouinpriestesscarrying a dead bodydivine interventionold testamentreference to abrahampassovertalking to godweavingeldermosesbuilding explosioncatfishinhumanityadvisorbolt upright after nightmarecavalry chargecovered wagonwading in watergiant wavereunited familylocustnile riverpublic hangingburning a dead bodyadopted brothercradleface paintinghaillandslideloomoxenmudslidered seaspinning wheelhorse drawn wagonshiveringmountain roadten commandmentstrampled to deathviceroycrocodile attackact of godboildeath of a horseescape from slaveryseditionvolley of arrowsbiblical plaguesburning bushcamp sitesword held to throatdead duckgrand vizierox cartcanaanwedding vowsbody soreswarm of insects (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | magicsurrealismmurderdeathfriendshiprevengekidnappingmoneybetrayaljealousyprisonfearescapefuneralmonster …deceptionrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | lakevillagewaterforestboatlondon englandwoodsenglandshipcastlecavebrothelsewer |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | archersorcererbatpalaceelephantwaterfalltransformationbridgeaxecandleriverdemonfalling from heightrescuehorse …firetitle spoken by charactercharacter name in titlebloodviolenceflashbackdogbare chested malefightexplosionknifechasesurprise endingbased on bookbeatingcorpseshot to deathblood splatterfistfightshot in the chestshot in the headslow motion scenepunched in the facewritten by directorbattleswordbrawlshowdownhand to hand combatinterrogationprostitutionbritishislandfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphangangambushstrangulationmassacredisguisemontagethroat slittingarmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifesevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenebullet timedoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downtavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
An orphaned brontosaurus named Littlefoot sets off in search of the legendary Great Valley. A land of lush vegetation where the dinosaurs can thrive and live in peace. Along the way he meets four other young dinosaurs, each one a different species, and they encounter several obstacles as they learn …to work together in order to survive. (Read More)
| Themes: | starvationsurrealismfriendshipdeath of motherdepressionnear death experienceunlikely friendship |
| Locations: | storm |
| Characters: | family relationshipsmother son relationship |
| Story: | stegosaurustriceratopstyrannosaurus rexcloudlavashadowclassical musicanthropomorphismearthquakedinosaurskeletonfalling from heightflashbackfightvoice over narration …tearsfour word titleunderwater scenefirst of seriesfirst partloss of mothereggtalking animalanthropomorphic animalvolcanofamily reunionfriends who live togetherprehistoric timesfrightstubbornnesscastle thundergrandparentsballadeerdinosaur eggcooperationtardisagreementpteranodonsinger offscreenanthropomorphic dinosaurapatosaurusbrontosauruscartoon dinosaurhatching eggcartoon lizarddinosaur featurepachycephalosauruspartially lost film (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | surrealismmurderdeathloverevengekidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutalitysupernatural power …redemptionfaithhopeapocalypseblindnesscourageself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | darknesspoetic justiceaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guywarrioraction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | chariotsandstormpalaceheartsuntempleelephantwaterfallskeletonlightningtransformationno opening creditsbridgemountainaxe …demonfalling from heightrescuehorsefirekissbloodviolenceflashbackbare chested malefightexplosionknifechasesurprise endingvoice over narrationbeatingcorpsefistfightshot in the chestslow motion scenepunched in the facebattleswordbrawlshowdownhand to hand combatbedorgycombatdecapitationgood versus evilsurvivalbedroomassassinsword fightambushold manmassacrearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklaceone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manopening action scenebraceletdeath of husbandtraploss of fatherthreatened with a knifesevered armlove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowburned aliveflyingspearassassination attemptbreaking and enteringquesthelmetslaveryloss of loved onetreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herobooby trapaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniustelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
| Subgenre: | tragedychrist allegory |
| Themes: | surrealismmurderdeathloverevengesuicidekidnappingbetrayalfeardeceptionbrutalitysupernatural powerdeath of motherhopedeath of wife …self sacrificemythologynear death experience (See All) |
| Locations: | forestchurchlondon englandwoodscastlecave |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampirewarrioraction heroself mutilationex soldierself healingblood lust |
| Period: | 15th century |
| Story: | batthunderstormskullskeletonlightningtransformationno opening creditsmountainaxecandleriverdemonfalling from heightrescuehorse …firecharacter name in titlebloodviolenceflashbackbare chested maleexplosionknifechasesurprise endingvoice over narrationbeatingcorpseblood splatterslow motion scenepunched in the facebattleswordshowdownhand to hand combatrunningcombatsubjective cameragood versus evilsword fightambushmassacrethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapanti heroone man armychild in perilon the runflash forwardattempted murderone against manylegendcursestabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manshot in the shoulderscarcrossthreatened with a knifedirectorial debutsevered armgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze frameprincestylized violencemaniacdestinywolfbow and arrowburned alivehead buttspeargothicheavy rainhelmetcrucifixloss of wifespidertorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitystabbed in the legdark heromedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelyellingdraculamonasteryromaniasuper strengthtowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
The 17-year-old Sean Anderson receives a coded signal and his stepfather Hank helps him to decipher the message. They find that Sean's grandfather Alexander Anderson has found the mysterious island in the Pacific described by Jules Verne and two other writers in their novels. The stubborn Sean wants … to travel to the coordinates and Hank decides to buy the tickets and travel with the teenager to a small island nearby the location. They rent an old helicopter owned by the locals Gabato and his teenage daughter Kailani and the group heads to the unknown spot. Along their journey, they cross a hurricane and crash on the island. They find a beautiful and dangerous place, surrounded by forests, volcanoes with lava of gold and menacing life forms. They also meet the old Alexander and Hank discovers that the island is sinking. Now their only chance to survive is to find the legendary Nautilus. (Read More)
| Subgenre: | slapstick comedy |
| Themes: | surrealismmonsternear death experience |
| Locations: | oceanbeachswimming poolhelicoptermotorcycleseacavejunglecampfiresubmarinecar motorcycle chasestorm at seacave inhelicopter accident |
| Characters: | husband wife relationshipmother son relationshipfather daughter relationshipteenagerteenage girlteenage boygrandfather grandson relationshippolice chasestepfather stepson relationship |
| Story: | volcanic eruptionlavabutterflyfloodearthquakeskullelephantmoonwaterfallskeletonlightningno opening creditsmountainfalling from heightrescue …kissbased on novelnumber in titlesequelexplosionchasesurprise endingvoice over narrationcell phonedigit in titleremakeslow motion sceneletterbooksunglassessecond partbirthdaynumbered sequelislandmapbrunettepart of seriesunderwater scenecreatureelectrocutionrace against timestatueopening action scenescene during end creditslove intereststrong female charactergoldheavy raineggeccentricgiantsharkanimal attackmexicanseries3 dimensional3dbooby trapvolcanowisecrack humorlocation in titlebirthday presentsecond in serieslizardbeecomic reliefflarehurricanetour guidewet t shirtpart of a seriestreehousecamera phonegiant animalcompassteenage herotorpedostarts with narrationgiant spiderhelicopter pilotjellyfishsurprise during end creditsnumber 2 in titleatlantisgiant creaturelong black hairham radioreefbroken anklesea creaturecode breakinggiant wavelost cityamateur radiounderwater explosiongiant birdglow sticklost worldukelelewet pantsgiant lizardreference to yodaex navyjules vernecaptain nemoelectric eelgiant antmusic score features choirmysterious island (See All) |
It was no ordinary life for a young girl: living among scholars in the hallowed halls of Jordan College and tearing unsupervised through Oxford's motley streets on mad quests for adventure. But Lyra's greatest adventure would begin closer to home, the day she heard hushed talk of an extraordinary pa …rticle. Microscopic in size, the magical dust--discovered in the vast Arctic expanse of the North--was rumored to possess profound properties that could unite whole universes. But there were those who feared the particle and would stop at nothing to destroy it. Catapulted into the heart of a terrible struggle, Lyra was forced to seek aid from clans, 'gyptians, and formidable armored bears. And as she journeyed into unbelievable danger, she had not the faintest clue that she alone was destined to win, or to lose, this more-than-mortal battle... (Read More)
| Subgenre: | epic |
| Themes: | drunkennesssurrealismfriendshipkidnappingdrinkingescapeabductioncourageenvironmentmissing child |
| Locations: | forestboatlondon englandseashiprooftoplaboratoryairship |
| Characters: | mother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrentattooboyfemale protagonistgirlwitchuncle niece relationship |
| Story: | magical dustgobletbarrelheartskullmouseicetransformationno opening creditsbridgemountaincandlewinedemonrescue …horsefirebased on novelviolencedogexplosionknifechasepistolvoice over narrationcatdrinkbattleswordlettershootingriflerunningcollegerobotcolor in titleorphanstrangulationmapsnakebirdanimalchild in perilfictional warcontroversykingsearchnecklacecursebinocularspoisonmissionstorytellingrabbitringpursuitneck breakingfirst partcabinbearsubtitled scenemonkeystrong female charactersurgeryexperimenteavesdroppingwolffireplacebow and arrowflyingspeartalking animalcagequestblockbusterstrong female leadstreet lifeclockfull moonwhiskeyadventurerchild's point of viewcrossbowfight to the deathintriguechild protagonistprophecysoulalternate realityarmorglobal warmingowlclosethiding in a closetgateschemealarmarcticshot with an arrowarcheryclimbing through a windowfantasy worldmetamorphosisfemale herohot air balloondeskshape shifterparallel universepolar bearmagnifying glassglacierchosen oneimmolationlifting person in airhawkvoyagecompassthronesurgical operationnorth poledustsledlordleopardoverheard conversationegyptianmother son reunionhourglassicebergvillainess played by lead actressfalconcaught in a netdog sledtalking catwatchtowerzeppelinheresyoxford universityaviatorfly the insectfalling over a cliffdisobediencebrushing hairchasmpraying mantishiding under a tablesteamshipsea voyagechain mailraptoranimal skullfjordchild thiefcollapsing bridgesighttalking bearpaddlewheel boatfate of the universefalling down a mountainice axesnow leopardbased on cult bookshoulder bagflying witchice bearspirit animal (See All) |
A love story between an 18-year-old girl named Sophie, cursed by a witch into an old woman's body, and a magician named Howl. Under the curse, Sophie sets out to seek her fortune, which takes her to Howl's strange moving castle. In the castle, Sophie meets Howl's fire demon, named Karishifa. Seeing …that she is under a curse, the demon makes a deal with Sophie--if she breaks the contract he is under with Howl, then Karushifa will lift the curse that Sophie is under, and she will return to her 18-year-old shape. (Read More)
| Subgenre: | cult filmsteampunk |
| Themes: | magicsurrealismmonster |
| Mood: | rainanime |
| Locations: | watertrainairplanebathtubcitycastle |
| Characters: | boylittle boywitchself discoverystepmother stepdaughter relationshiplow self esteem |
| Story: | apprenticepalacehearthattransformationdemonmirrorfirekisscharacter name in titlebased on novelmale rear nuditydogthree word titlecrying …tearsforeign language adaptationold womancurseringprincehenchmanflyingwitchcraftblockbusterparadebreakfastwizardhousekeeperkingdomflightspelllaundryrunning awayportalcomic relief18 year oldyoung womanbakerymetamorphosisscarecrowvanitycowardcleaningsorceressinvitationpsychotronic filmpre teenbattleshiptantrumfloatingcleaning womanbased on young adult novelhidden identitygrandmablobcharmmisadventurehouse cleaningtransferhouse cleanerself sufficiencyturnipfront doorpremature agingbomber aircrafthair colortest of charactercrone90 year oldinner beauty (See All) |
When a green ogre named Shrek discovers his swamp has been 'swamped' with all sorts of fairytale creatures by the scheming Lord Farquaad, Shrek sets out with a very loud donkey by his side to 'persuade' Farquaad to give Shrek his swamp back. Instead, a deal is made. Farquaad, who wants to become the … King, sends Shrek to rescue Princess Fiona, who is awaiting her true love in a tower guarded by a fire-breathing dragon. But once they head back with Fiona, it starts to become apparent that not only does Shrek, an ugly ogre, begin to fall in love with the lovely princess, but Fiona is also hiding a huge secret. (Read More)
| Subgenre: | cult filmfairy talesword and sorceryepiccomputer animationcgi animationgross out comedyfairy tale parody |
| Themes: | magicdeathfriendshiptortureweddingherocorruptionwrestlingredemptioncannibalismvengeancecourageunlikely hero |
| Mood: | satire |
| Locations: | forestcastle |
| Characters: | friendsoldierwarrior |
| Story: | sunrisedonkeysunsetfairymouseskeletontransformationrescuemirrorfiretitle spoken by characterkisscharacter name in titlemale nuditychase …surprise endingbased on booktitle directed by femalefistfightbattleswordbrawlbeercombatsubjective cameraanti herocoffinprincessduelcursebeaten to deathdragonisolationpigfirst partbeardismembermentdestinywolfloyaltyspearslow motiontalking animalquestlifting someone into the airmutilationhunterblockbustergiantflatulenceknighthonoranimal attackeaten alivedwarfshieldcrossbowfight to the deathhit in the crotchswamparmordisfigurementkingdomsevered legalienationcrude humordaggerchallengesurprise after end creditsblindbullet timespellsidekicktoweraccordionshot with an arrowreluctant herocartoon violencebishopaltered version of studio logowindmillpitchforkanachronismbased on children's booklifting female in airarm ripped offleadershiplordogregnomestained glass windowinterrupted weddingfire breathing dragonouthousecgi filmrope bridgejudgmentbelchmagical mirroronionethnic cleansinggingerbread mandark agesactor voicing multiple charactersawkward silencecandlestickinterspecies romanceflying dragonshreksword throwingbluebirdwinged dragondrawing in sandhybrid animaltrampled to deathexploding animalstorybook in opening shotrotisseriesarcasm taken literallydecree (See All) |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the … Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
| Subgenre: | cult film |
| Themes: | dancedrunkennessfriendshipmoneypregnancydrinkingweddingmemory |
| Mood: | breaking the fourth wall |
| Locations: | oceanchurchnew york citybarbeachhotelmotorcycleairplanenightclubtaxirooftopyacht |
| Characters: | homosexualfather daughter relationshipmother daughter relationshipfriendsingerfemale protagonistdancermusicianwriterpriestsingle motherolder woman younger man relationship |
| Story: | jumping into waterdonkeyearthquakebuttocksno opening creditsfishbridgeswimmingfalling from heightmirrorpartykissf ratednuditymale nudity …flashbackmale rear nuditydogsex scenedancingejaculationphotographsingingpunctuation in titlecryingsongtitle directed by femaleslow motion scenedrinkthongbare buttletterbooktearspianoislandguitarbandwomantoiletinternetdrawingbartenderlimousinebinocularsfantasy sequencesuitcaseflowersscene during end creditsdiaryexclamation point in titlepianistsplit screencloseted homosexualtouristfaintinglifting someone into the airtitle based on songbarnoverallsarchitectblockbusterbrideladdergoatpassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptionpeasantharbortriple f ratedlaundrydocksailboatold flameraftmailmailboxillegitimate childmusic boxbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airbased on stage musicaltoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropesummer romancewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All) |
The animated story of Bambi, a young deer hailed as the 'Prince of the Forest' at his birth. As Bambi grows, he makes friends with the other animals of the forest, learns the skills needed to survive, and even finds love. One day, however, the hunters come, and Bambi must learn to be as brave as his … father if he is to lead the other deer to safety. (Read More)
| Subgenre: | disney2d animation |
| Themes: | deathfriendshipbetrayalnaturedeath of motherself sacrificehunting |
| Mood: | rain |
| Locations: | forestsnowcanadaforest fire |
| Characters: | father son relationshipmother son relationship |
| Period: | 1940swinter |
| Story: | ice skatingfrozen lakebutterflythunderstormflowerlightningrescuefiretitle spoken by characterone word titlecharacter name in titlebased on noveldogfightlie …birdanimalfantasy sequencefirst of seriesrabbitloss of mothertwinprincetalking animalhunterblockbusterfroganthropomorphic animalgunshot woundrainstormdeerduckgrowing upowlanimal name in titleshynesssquirrelaltered version of studio logodog attackspringlogstudio logo segues into filmskunkcastle thunderaudio flashbackunseen charactermaturationfawnriverbankno narrationbambiopossumtalking rabbit (See All) |
The young, sickly King Einon was wounded in a battle. In order for him to survive, he is healed by Draco, a dragon. Some years later, Bowen, a dragon slayer, encounters Draco. The two team up to form a traveling duo that perform an act, but the act is only known by themselves. Bowen supposedly "slay …s" Draco and then collects a reward from the town or village that he protects by killing the dragon who had been "terrorizing" them. From there, Bowen and Draco must save the entire kingdom from the rule of the now evil King Einon, who is part of Draco and Draco a part of him. (Read More)
| Subgenre: | cult filmmartial artssword and sorcerysword and fantasy |
| Themes: | murderfriendshiprevengebetrayalfearescapeherodeceptionangerdeath of fathersupernatural powerpovertyhopeblindnesscourage …self sacrificenear death experienceunlikely friendship (See All) |
| Mood: | rain |
| Locations: | lakevillageforestenglandcastlecavecampfire |
| Characters: | mother son relationshipsoldierpriestwarriorchristianitymythical creatureblood lust |
| Story: | extinctionarchershameheartstarwaterfalltreebridgeswimmingfalling from heightrescuehorsefireone word titledog …bare chested maleexplosionsingingknifechaseshot in the chestbattleshowdownliehand to hand combatcombatgood versus evilassassinsword fightdeath of friendarmyimpalementstabbed to deathstabbed in the chestanti herodisarming someonekingpaintrainingattempted murderstabbed in the backperson on fireattackdragonfarmerscarpigloss of fathermercenarypoetqueenarsonprincechesscivil warspiritbow and arrowflyingspearheavy raintalking animalquesthelmetslaveryloss of friendcaptiveexploding buildingfraudsheeprebellionknighthonortorchmonkmoralityfemale warriorreverse footageshieldtarget practicecrossbowpartnerresurrectionimmortalitymentormedieval timesdungeonsoulhealingarmorblind maneye patchaxe murdertragic heroarrowtombswordsmanschemevikingbreadstandoffcomic reliefselfishnessidealismfortresshired killerfencingnarcissismreluctant heroone linertyrantjudofamous scorepart computer animationwatermelonbowmatricideuprisingoff screen murdersecret passagedeterminationproposalshot with a bow and arrowlong haired maleaxe fightbattle axeoathjudo throwheart transplantfalconstudent teacher relationshipfire breathing dragonking arthurblamefear of flyingvowfake deathimplied rapestomach ripped openchained to a wallcynicrotting corpselegendary heroevil kingconstellationpushed from heightaxe throwingtrucewooden swordbroken promisedeath of kingflying dragonvalorheld at knifepointpower lustlife forcecode of honorkilling a friendwinged dragondragonslayeringenueprison laborchest woundpeasant armydragon featureheld at sword pointhuman versus dragonmortal woundtalking dragonhorned helmetfencing lessonavalonhuman dragon relationshipreflection in an eyestalemate900sarrow in the shoulderpeasant revolution (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com