Please wait - finding best movies...
Classic tale of teenage rebellion and repression features a delightful combination of dance choreography and realistic and touching performances. When teenager Ren McCormack and his family move from big-city Chicago to a small Midwestern town, he's in for a real case of culture shock. Though he trie β¦s hard to fit in, the streetwise Ren can't quite believe he's living in a place where rock music and dancing are illegal. However, there is one small pleasure: Ariel Moore, a troubled but lovely blonde with a jealous boyfriend. And a Bible-thumping minister, who is responsible for keeping the town dance-free. Ren and his classmates want to do away with this ordinance, especially since the senior prom is around the corner, but only Ren has the courage to initiate a battle to abolish the outmoded ban and revitalize the spirit of the repressed townspeople. Fast-paced drama is filled with such now-famous hit songs as the title track and "Let's Hear It for the Boy". (Read More)
Subgenre: | teen moviecult film |
Themes: | religious fundamentalismreligious intolerancenear death experiencedance |
Mood: | high school |
Locations: | cityrural settingsmall townmotorcyclechurch |
Characters: | cousin cousin relationshipreligious leaderreligious fundamentalistreligious zealotreligious fanaticbiblepriestdancerteenage boyteenage girlfather daughter relationshipteenager |
Story: | slapping a womansexual repressionburning a bookbook burningdance partyhigh school dancedance lessonchurch state enmeshmentgroup showershower roommale in showermen dancing togetherman dancing with a mandancing in the streetman dancing with man β¦brick thrown through a windowspontaneous choreographyreal life sisters playing sistersthrowing a stonefather slaps daughterpublic moralitychange of mindmuscle shirtoverprotective parentevangelical christianityfather daughter conflictteenage rebellionoverprotective fatherorthodoxfamous songhitting a womanwoman hits a manman hits womancousindomineering fatherundershirtpunchingman hits a womanabusive boyfriendslappingutahpromcowboy bootssweatrepressioncartoon on tvtractorpastorblood on faceconfrontationministercensorshipcompassionculture clashblockbustertitle based on songteen angstobscene finger gesturetrusthairy chestpassionlocker roomgay slurbookbare buttundressingface slapfistfightbeatingshowerdancingbare chested malemale rear nuditymale nuditykiss (See All) |
Being a teenager is tough, and no one knows this better than Ren McCormack, a city kid with a strong feeling for music. Ren's life changes when he moves to a small town where rock-n-roll and dancing are criminal activities. When Ren falls in love with the reverend's daughter, Ariel Moore, the music β¦pauses and Ren needs to shape up or make dancing a legal activity once again. (Read More)
Themes: | religious fundamentalismreligious intolerancedance |
Mood: | high school |
Locations: | citysmall townbusschool bus |
Characters: | religious leaderbiblefather daughter relationshipteenagerpolice officeruncle nephew relationship |
Story: | slapping a womandance partyhigh school dancedance lessonchurch state enmeshmentspontaneous choreographyoverprotective parentteenage rebellionoverprotective fatherhitting a womandomineering fatherabusive boyfriendslappingrepressionconfrontation β¦ministerculture clashteen angstgay slurface slapfistfightbeatingdancingone word titlefireremakelibraryracingcowboy hatcountry musicpreacherblack eyelibrariansouthern u.s.school principalcurfewdrag racingline dancingcity councilprincipal's officebreaking up with boyfriendwoman hitting manflushing drugs down a toiletcotton mill (See All) |
Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?
Subgenre: | teen moviecult filmindependent filmcoming of ageteen romanceteen comedy |
Themes: | dancefriendshipdrinkingdrunkennessangerpovertydysfunctional familydatingunrequited lovefashionwealthfirst love |
Mood: | high school |
Locations: | trainschoolnightclubschool teacherschool dance |
Characters: | teenage boyteenage girlfather daughter relationshipteenagerboyfriend girlfriend relationshipsingerstudentmusicianlustteacher student relationshipchinesesingle father |
Period: | 1980s |
Story: | high school dancepromcartoon on tvtitle based on songteen angstfistfightdancingkissphotographsingingthree word titlepantiescryingunderwearblonde β¦watching tvcomputertearsmarijuanacolor in titlecleavagebrarock bandwhite pantieslibraryargumentmicrophoneconvertiblegymhigh school studentclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machinedresscrushforbidden lovepet dogshoppingposterplaying cardsteenage lovelockeralarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughteraudio cassettehouse partysewing machinedesignerhigh school girlopposites attracthomeworkreference to madonnasuitorrecord storemusic storedance contestsnobphonograph recorddevotionreference to karl marxslumber partyyearbookhigh school boynylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packwrong side of the tracksrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All) |
In North Carolina especially in Beaufort a prank on a guy goes wrong and puts the student in the clinic. Carter, a famous student with no plans for the future, is held responsible and forced to join in after-school community service activities as consequence, which include starring as the lead in th β¦e play. And participating in these activities is Jamie Sullivan, the reverend's daughter who has great ambitions and nothing in common with Landon. When Landon decides he wants to take his activities seriously, he asks Jamie for help and begins to spend most of his time with her. But he starts to like her, that he did not expect to do. They relationship, much to the chagrin of Landon's old popular friends and Jamie's strict reverend father. But when a heart-breaking secret becomes known that puts their relationship to the test, it is then that Landon and Jamie realize the true meaning of love and fate. (Read More)
Subgenre: | teen moviecult filmcoming of agetragedymelodramateen romancehigh school dramateen drama |
Themes: | near death experiencefriendshiprevengemarriagejealousyescapeweddingdeceptioncancerredemptiondatingfaithfirst love |
Mood: | high schoolcar chasetearjerkerbittersweet |
Locations: | small townchurchhospitalrestaurantschoolcemeterywheelchairpolice carschool bus |
Characters: | biblepriestteenage boyteenage girlfather daughter relationshipteenagerfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctortattoopolice officernursestudentchristian β¦best friendbullysingle motherchristianitysecurity guarddirectorex husband ex wife relationshipex boyfriend ex girlfriend relationshippolice chasesingle fatherself confidence (See All) |
Period: | 2000s |
Story: | dance lessonevangelical christianityteenage rebellionministerteen angstbookdancingkissbased on novelsingingvoice over narrationcar accidenturinationrescueslow motion scene β¦punched in the facecar crashpianoflashlightambulancebasketballmontagefour word titledrivingmarriage proposallibrarycharacter repeating someone else's dialoguewidowerprankhigh school studentdatecharacter says i love yousingle parentterminal illnessrevelationwhat happened to epiloguefaintingscene during opening creditsmale bondingrebeljumping from heightforbidden loveinterracial friendshippreacherambitiontelescopeunderage drinkingmiraclelove at first sightfirst kissbutterflychoirbalconyswinglonerpassionate kissjuvenile delinquentdead mothersports carpractical jokewedding ceremonyoutcastparalysishigh school teachercafeteriateenage lovecrutchesbully comeuppanceoutsiderpeer pressurestage playteenage daughterleukemiatutorreverendjocknorth carolinastar crossed loverswet t shirtchick flickchapelhigh school girlfather son estrangementcar radioopposites attractfather son reunionscriptschool playcometchurch servicegospelsweatercliquedockscrutchhigh school principalreference to aristotlestar gazingyearbookhigh school boyacting musiciancommunity serviceinitiation riteaccident victimprank gone wronglife changingintimateteen rebelgospel choirmobbinghigh school sweetheartsbad boyends with weddingsweetheartwet pantsdrama clubamerican muscle (See All) |
The outcast teenager Carrie White is bullied by her classmates at high school. Her mother, Margaret White, is a pious and paranoid woman that sees sin everywhere and the need of self-inflicting punishment. When Carrie has her first period, she does not understand what is happening to her and her cla β¦ssmates humiliate her in the changing room. The spiteful Chris Hargensen videotapes Carrie with her cell phone and posts it on the Internet. Their teacher Ms. Desjardin punishes the students, but when Chris challenges her, she is suspended and consequently is banned from the prom. Meanwhile, Carrie discovers that she has telekinesis and learns how to control her ability. Sue Snell, one of the girls that tormented Carrie, feels bad and asks her boyfriend Tommy Ross to invite Carrie to go with him to the prom to make up for what she did to Carrie. But Chris and her boyfriend Billy Nolan plot an evil prank with her friends to seek vengeance for Carrie. (Read More)
Subgenre: | teen moviecoming of agesuspenseteen horror |
Themes: | near death experiencedancemurderdeathfriendshiprevengesurrealismsuiciderapereligionpregnancyfearangersupernatural powerdeath of mother β¦depressionredemptionguilthumiliationpoetrybullyingcrueltypanicvengeanceself sacrificeregretpsychological trauma (See All) |
Mood: | high schoolgorerainnightmarenighthorror movie remake |
Locations: | small townhospitalschoolswimming poolcarcemeterybathtubbicyclewaterpolice cargas stationschool bussex in a carfire truckschool dance β¦school fire (See All) |
Characters: | religious zealotreligious fanaticbibleteenage girlteenagermother daughter relationshipboyfriend girlfriend relationshipdoctorfemale protagonistteachernursestudentbullysingle motherteacher student relationship β¦terrorself mutilationpregnant teenagerself injurymother versus daughterreligious mothervomiting girl (See All) |
Period: | 2010s |
Story: | high school danceoverprotective parentpromteen angstlocker roomface slapshowerdancingbare chested malekissf ratedcharacter name in titlebased on novelbloodviolence β¦one word titlesex scenetitle spoken by characterexplosionknifesurprise endingfirecell phoneblood splattercar accidentremakeslow motion scenesex in bedvomitingclassroomprayerf wordbedroomflashlightstrangulationmassacreambulancestabbingmontageimpalementstabbed to deathstabbed in the chestchild abuseexploding cargraveyardlatex glovesattempted murderlimousinegravelibrarystabbed in the backprologuescreamingsuburbperson on fireelectrocutionlightninggymamerican flagtragic eventhigh school studentcrosschildbirththreatpigsadnessschoolgirlstagecharacter says i love youthreatened with a knifeclassteenage sexsingle parentpoemnerdfalling down stairssabotagedestructionburned alivekilling an animallooking at oneself in a mirrorscene during opening creditslifting someone into the aircrucifixyoutubecovered in bloodfemale killercrushed to deathhomicideearthquakereverse footagepower outagescissorsstabbed in the leglaughterroseaccidental killinglonerclassmatebody countpublic humiliationjuvenile delinquentalienationcharacters killed one by onesurgeonsports cartelekinesistext messaginginterrupted sexteenage pregnancyshynesslevitationstabbed in the handclosetmenstruationoutcastmedical masksurgical maskhigh school teachercafeterialong hairabuse of powerfemale teacherfireballbully comeuppancefemale psychopath17 year oldwhistlecrownstabbed in the armcameramandental maskbroken mirrordomineering motherknocked unconsciousteasingteenage daughterteenage sexualitylocked doornewborn babydeath of boyfriendsewing machinepsychic powerfrightmatricidedeath of title charactercamera phonepool of blooddetentionsledgehammerdisturbed individualwoman wearing black lingerietauntingdeeply disturbed personbucketdutch angletamponstabbed multiple timeswashingfemale in a showerfemale studentcliquemissionary positionsurgical gownhostilityburning houselord's prayerperiodhigh school principalseamstresstwin sistersdead teenagergym classgym teachervillainess played by lead actressthrown through a windshieldcuttingwoman in a bathtubbloody handteenage romancewoman in a towelmenstrual bloodpsionic powerhigh school promlacrosseteen lovefemale bullylesbian slurstretch limousineexploding gasoline stationrepeated scene from a different perspectiveparty dressmultiple stabbingalternate endingbanging head against wallparanormal phenomenonwhite rosefalling off a bicycleshy girlcruel jokecyberbullyinginferiority complexprom nightteen sexwoman murders a womanprom queenfirst menstruationprom dresscracked mirrorhome birthtroubled teenage girldaughter murders motherhit by a falling objectimax versionstabbing a womanwoman on fireteenage prankstertrampledwomen wearing a one piece swimsuitcollapsing housedeath by falling objectprom kingreference to samsonwomen's locker roommother murders daughtersanitary napkinpig bloodteen pregnancybucket of bloodtragic villainessclothes shoppiggeryreference to tim tebow (See All) |
Samantha's life is going downhill fast. The sixteen-year-old has a crush on the most popular boy in school, and the geekiest boy in school has a crush on her. Her sister's getting married, and with all the excitement the rest of her family forgets her birthday! Add all this to a pair of horrendously β¦ embarrassing grandparents, a foreign exchange student named Long Duk Dong, and we have the makings of a hilarious journey into young womanhood. (Read More)
Subgenre: | teen moviecult filmcoming of ageteen romanceteen comedy |
Themes: | marriagedrunkennessweddingdysfunctional familyunrequited lovefirst love |
Mood: | high schoolbreaking the fourth wall |
Locations: | churchrestaurantschool bus |
Characters: | teenage boyteenage girlfather daughter relationshipteenagerfamily relationshipsmother daughter relationshipbrother sister relationshipsister sister relationshipjapaneseself discoverydream girl |
Period: | 1980s |
Story: | high school danceshower roomtitle based on songteen angstgay slurshowerfemale nuditynumber in titlefemale frontal nuditytwo word titlephotographpartypantiesunderwear β¦car accidentbeerbirthdaylingeriewhite pantieslooking at the camerasuburbconvertiblefemale removes her clotheshigh school studentdirectorial debutgrandmotherclass differencesrecord playerpizzabirthday cakenerdloss of virginityfarcelifting someone into the aircrushunderage drinkinggrandfatherwedding dressethnic slurgeekfirst daterestroom16 year oldjockunderage sexporscheillinoisnight vision gogglesveildental bracesperson in a car trunkexchange studenthouseguestcoors beerasian stereotypeyellow pantiesdorkbrat packdental headgearwild partyshy girlwedding veildrive in restaurant16th birthdayfuture in lawswedding ceremony gone awrybridal veilforgotten birthday16 year old girl (See All) |
After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.
Subgenre: | teen movieteen comedyteen sex comedy |
Themes: | religious intolerancefriendshipmarriageinfidelityreligionadulterydrinkingextramarital affairdivorceguiltunfaithfulnessdatinghomophobiaadoptiondevil |
Mood: | high schoolsatire |
Locations: | churchrestaurantschoolswimming poolkitchensinging in the shower |
Characters: | religious fanaticbiblepriestteenage boyteenage girlfather daughter relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother daughter relationshipfriendboyfriend girlfriend relationship β¦singerboybrother sister relationshipprostitutefemale protagonistteachergirlstudentchristianbest friendreference to godchristianityteacher student relationshipcatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious teen (See All) |
Period: | 2010s |
Story: | pastorministerlocker roomgay slurface slapshowerbare chested malekissfemale nuditydogtwo word titlesex scenephotographsinging β¦partypantiestelephone callcryingcell phonesongmirrorslow motion scenewatching tvdrinkcondomliebeertearssunglassesvibratorbirthdaycafemarijuanareference to jesus christclassroomprayerguitarstrippercleavagebedroomcaliforniabasketballdinnerfalse accusationscantily clad femalespankingtalking to the cameraconfessionmicrophonevirginprotestliarmini skirtmoaninggymamerican flaghigh school studentcheerleadercrossgardenclassgraffitifreeze framemachismoscandalcloseted homosexualwaiterhuggingpot smokingloss of virginityfaintinghappinessdemonstrationgossipfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisypunched in the stomachaquariumtime lapse photographyhit on the headpanties pulled downbookstorebelief in godcliffred pantiesclassmatelooking at self in mirrorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebooksneakerswoman cryingcafeterianame callingconfessionallegsrumorpeer pressureschool principalfascistprincipalfriendship between girlsacceptanceadopted sonpopularitycdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayice cream coneenglish teachermascotcliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastbelief in the afterlifespellingwater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyprincipal's officeschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumepep rallybelief in the deviladoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All) |
After his death sometime in his forty-third year, suburbanite Lester Burnham tells of the last few weeks of his life, during which he had no idea of his imminent passing. He is a husband to real estate agent Carolyn Burnham and father to high school student Janie Burnham. Although Lester and Carolyn ⦠once loved each other, they now merely tolerate each other. Typical wallflower Janie too hates both her parents, the three who suffer individually in silence in their home life. Janie tries to steer clear of both her parents. Carolyn, relatively new to the real estate business, wants to create the persona of success to further her career, she aspiring to the professional life of Buddy Kane, the king of the real estate business in their neighborhood. Lester merely walks mindlessly through life, including at his job in advertising. His company is downsizing, and he, like all the other employees, has to justify his position to the newly hired efficiency expert to keep his job. Things change for Lester when he falls in love at first sight with Janie's more experienced classmate, Angela Hays. Both Janie and Angela can see Lester's sexual infatuation with Angela, who courts such attention from any man as a sign that she is model material, she having once appeared in Seventeen and it a career to which she aspires. Lester's infatuation with Angela gives him a reenergized view on life, where he openly doesn't care anymore what anyone thinks about what he does, anyone except Angela. This in⦠(Read More)
Subgenre: | cult filmcoming of ageblack comedydark comedyteen romancedeadpan comedytragicomedy |
Themes: | dancemurderdeathfriendshipinfidelitydrugsadulteryseductionextramarital affairangerobsessionparanoiadepressionblackmaildrug use β¦dysfunctional familyunfaithfulnesshomophobiafalling in lovecheating (See All) |
Mood: | high schoolgoresatirerainsocial satiremoving |
Locations: | small townswimming poolcarbathtubmotelsinging in a carsex in a motel |
Characters: | teenage boyteenage girlfather daughter relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipmother daughter relationshipboyfriend girlfriend relationshipwriterbest friendreference to godgay kiss β¦lusthomosexualityolder man younger woman relationshipself discoverymilitary officerself destructivenessamerican dreamself hatredgirl nudityfather and daughteronly daughter (See All) |
Period: | 1990s |
Story: | sexual repressionchange of minddomineering fatherrepressionblockbusterteen angstobscene finger gesturegay slurbare buttface slapbeatingshowerbare chested malemale rear nuditymale nudity β¦kissfemale nudityf ratednuditybloodviolencebare breastsfemale frontal nudityflashbackmasturbationtwo word titlegunsex scenecigarette smokingfingeringnipplessurprise endingpantiestopless female nudityvoice over narrationfondlingshot to deathblood splatterblondeshot in the headslow motion scenecomputercamerasex in bedbeerbedmarijuanabathroomneighborvoyeurtelevisionf wordcleavagebedroombratoplessvideo camerabasketballdrug dealerwomandinnermodelno opening creditsdream sequenceanti heroscantily clad femalelatex glovesgunshotargumentstrippingvirginbusinessmanscreamingsuburbfantasy sequencemini skirtmoaningdomestic violencefemale removes her clothestragic eventcheerleaderpremarital sexschoolgirlsemiautomatic pistoldirectorial debuthandgungay couplecheating wifegaragehatesexual fantasyflirtingcloseted homosexualeavesdroppingpot smokingcountry name in titleheavy rainjoggingtold in flashbackexercisemagazinebuttocksvideotapedysfunctional marriagecrushvirginitycoloneldrug dealingwatching televisionsexual desirebuddhistbarefoottensionmale masturbationcouchcynicismmisunderstandingunfaithful wifejob interviewnipplereference to satanadvertisingroseperversiondeceitrainstormabusive fatherfamily dinnerexistentialismloss of husbandalienationmarital problemmidlife crisissports carneighborhoodlingerie slipexhibitionismlyingirreverencemain character diesage differencewoman in bathtubadulterous wifereal estate agentworkoutunhappy marriagetablegardeningtruthcannabisinsecuritypedophiliaparenthoodblue pantiessarcasmmotel roomloserweightliftingloud sexschoolboydenialquitting a jobexhibitionistinfatuationtyranttopless girlmale protagonistunderage smokingsofacamcordervideo footagemurder by gunshotnatural breastsrealtorreference to james bondin medias resdrug humorpool of bloodshooting rangemovie camerawet clothesunwanted kissfast food restaurantabsent motherlolitaolder man younger womanmaterialismcheerleader uniformcrime of passionloveless marriageex marinesoul matewoman moaning from pleasurewoman moaningmoaning womanolder man young girl relationshipu.s. marinerainy nightcheerleadingplastic bagsecret lifehomophobeneurosisbasketball gamegirl toplessnarration from the gravecocktail partybeer bottlevhs tapespit takeillegal drugcubicleestranged couplemuscle cartalking during sexmale in a showerfiring rangemistrustrepressed homosexualinnuendomasturbating in a showerdirty old manbalaclavacovered female frontal nudityemotional breakdownlava lampteen smokingyounger woman older man relationshipfemales talking about sexblood on walldrive thrurepeated scene from a different perspectiveasparagusmemorabilianight drivingolder man younger girlmistaken for gayspying on someonevisual hallucinationbarely legalwoman undressing for a manplaying musicyounger girl older manreference to pink floydremote controlled toy carthe color redbroken dishdrug testingfamily problemsmother slaps daughterunexpected kissurine samplehouse cleaningvideotapingweight trainingman undressing a womanolder man teenage girl relationshipjoblessnessflower petallocking a doorvirgin girlcamera zooming indissatisfactionfacadehomophobic violencehomosexual couplewoman taking off pantsrandomnessbench presslow paid jobrose petalwhirlwindman on topseverance payapplying for a jobdv cameraefficiency expertspying on neighbortalking dirty during sexnazi paraphernalianew automobileurine testvideo collectionman hugging a manvaporcushionnon communicationnymphetthreat of employment dismissalviolence against a teen (See All) |
Steven Russell is happily married to Debbie, and a member of the local police force when a car accident provokes a dramatic reassessment of his life. Steven becomes open about his homosexuality and decides to live life to the fullest - even if it means breaking the law. Steven's new, extravagant lif β¦estyle involves cons and fraud and, eventually, a stay in the State Penitentiary where he meets sensitive, soft-spoken Phillip Morris. His devotion to freeing Phillip from jail and building the perfect life together prompts Steven to attempt and often succeed at one impossible con after another. (Read More)
Themes: | deathfriendshipchristmasreligionmoneyprisondeceptionmemorytheftadoptiondyingaidsprison escapegay loveescape from prison β¦homosexual love (See All) |
Locations: | churchhospitalrestaurantboattaxielevatorwheelchaircourtroomtaxi drivertexasgay barsex on boatprison sexprison shower |
Characters: | dancerfather daughter relationshipfamily relationshipshusband wife relationshiphomosexualpolicemother daughter relationshipafrican americanfriendboygirlpolice officergay sexpoliceman β¦lawyerthiefchristianreference to godgay kisshomosexualityex husband ex wife relationshipgay relationshipgay fatherboyfriend boyfriend relationshipbrother in law sister in law relationshiphomosexual kisshomosexual sexex policemanhomosexual fatherhomosexual seduction (See All) |
Period: | year 2006year 1998 |
Story: | group showershower roommale in showerman dancing with mantrustgay slurbookbare buttface slapbeatingshowerdancingbare chested malemale rear nuditymale nudity β¦kisssexcharacter name in titlenuditybloodflashbackmasturbationdogtitle spoken by charactersingingbased on true storytelephone callvoice over narrationcryingunderwearfoodcar accidentmirrorurinationpunched in the facecomputerarrestsecretlettervomitinglietearsrunningbirthdaycar crashcafejailhandcuffsreference to jesus christprayersubjective cameraambulanceeatingsuicide attemptprisonerjudgechildbirthday partyracial sluron the runflash forwardlibrarybusinessmancoming outliarsuitcasedebtreadingflowerscharacter says i love youdirectorial debutgay coupleeyeglassescloseted homosexualidentityhuggingclaim in titledestinygolfshavingsupermarketwhat happened to epiloguelooking at oneself in a mirrorstealingwatching a moviefraudwristwatchfloridagay parentjumping from heightfaked deathcrying manmilkscammale underweardrug overdoserole playingpromiserear entry sexgrocery storeprison guardpillsjob interviewmiami floridabible quotecon artistsurprisedeceitcapturevoice over lettertuxedobarbecuebriefcasegay stereotypebriefssports carchildhood memorycon manchocolatechristmas presentmen's bathroomcloudgay romancecookiebunk bedgay clubman in swimsuiturinaln wordchewing gumkarmagurneyprison breakembezzlementfirst person titlehymnneck bracehappy birthday to youdiabetesreference to george w. bushdeath of loverinsurance frauddevotiondiabeticstarting overaccomplicecell matereference to ernest hemingwaytelling a jokeadopted childgay husbandfake idinsulinprison sentenceincarcerationbirth mothergay jokeon the lamchurch choirrepressed homosexualbiological motherfoaming at the mouthlife sentencechange in lifestylejumping off a roofcar rentalepiphanyreference to coca colaslow dancingblowing bubblesmopping a floorcredit card fraudgay copfaking illnessgold watchracist jokeresumecloseted gay manjurorlockdownsearch for birth mothergay parenthoodpathological liarconfession of lovesocial engineeringcoming out of a comamanaclesbackyard barbecuereference to people magazinereference to ricky martinback injurykey west floridacloud gazingphallic imageinsulin overdoseprison libraryrolex watchrecidivismfalsified documenthomosexual self discoveryvirginia beachabandoned sonbreach of contractbuying a childracist humorchief financial officerlaw libraryminiature pinscherwelcome mat (See All) |
John Singleton's portrayal of social problems in inner-city Los Angeles takes the form of a tale of three friends growing up together 'in the 'hood.' Half-brothers Doughboy and Ricky Baker are foils for each other's personality, presenting very different approaches to the tough lives they face. Rick β¦y is the 'All-American' athlete, looking to win a football scholarship to USC and seeks salvation through sports, while 'Dough' succumbs to the violence, alcohol, and crime surrounding him in his environment, but maintains a strong sense of pride and code of honor. Between these two is their friend Tre, who is lucky to have a father, 'Furious' Styles, to teach him to have the strength of character to do what is right and to always take responsibility for his actions. (Read More)
Subgenre: | teen moviecult filmindependent filmcoming of ageblack comedytragedy |
Themes: | murderdeathfriendshiprevengedrugsmoneyescapegangsterangerracismdeath of fatherpovertydysfunctional familyrivalryhome invasion β¦crueltyvengeancepolice brutalitymurder of brother (See All) |
Mood: | high school |
Locations: | citychurchrestaurantschoolcarhelicopterlos angeles californiawheelchairurban settingpolice carsinging in a carschool teacher |
Characters: | teenage boyteenage girlfather daughter relationshipteenagerfamily relationshipsfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattoobrother brother relationshipteacher β¦police officerbabytough guysingle motherlittle boyex husband ex wife relationship (See All) |
Period: | 1980s1990syear 1991year 1984 |
Story: | confrontationtitle based on songteen angstlocker roomgay slurbare buttfistfightbeatingdancingbare chested malemale rear nuditysexfemale nuditybloodviolence β¦gunfemale rear nudityfightcigarette smokingnipplespartyknifechasepistolcorpseshot to deathblood splattermachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facewritten by directorarrestbrawlshootingrifleheld at gunpointbeerrunninginterrogationhandcuffsrevolvertelephoneshot in the backf wordgangdeath of frienddrug dealermontagefootballmapman with glassesno opening creditsfishingchild in perilshot in the legracial slurflash forwardattempted murderdrug addictvirgindangerprologuestorytellinglong takedeath of brothertragic eventstalkingdeath of sonsadnesspremarital sexdirectorial debutex convicthatesingle parentak 47machismouziwhat happened to epiloguedesireelectronic music scoreloss of virginitysurvivorloss of friendloss of loved oneamerican footballkicked in the stomachvideotapecovered in bloodskateboardmilkhomicidedrug dealingtensionrap musicunderage drinkingloss of sonhatredconvenience storedeath threatjunkiepunched in the chestghettoblood on shirtracisttitle at the endbarbecueattractionjuvenile delinquentethnic slurdeath of loved oneloss of brotherneighborhoodmelancholyshot multiple timesthanksgivingvietnam veteranstreet gangcar drivingadvertisementbitternessyoung version of characterreal estateweightliftinggang violencesexual promiscuitybillboarddouble barreled shotgunurban decayfilm starts with textsawed off shotgunmeat cleaverpalm treen worddeath of boyfrienddrive by shootingparaplegicintentionally misspelled titlehip hop musicblack copfast food restaurantclimbing out a windowsocial decayattempted robberyvolkswagen beetlegangstachild swearingcapgentrificationrescue attemptconspiracy theoristpagerloss of boyfriendgangsta gripafrolowriderroman catholicdominoessouth central los angelesmagnum handgunblack familypacifierfat childfavoritismlow ridercollege boundtrain trackafrican american musicressentimentblack directorblack slanglive in girlfriendchevrolet impala convertiblemortgage broker (See All) |
Walt Kowalski is a widower who holds onto his prejudices despite the changes in his Michigan neighborhood and the world around him. Kowalski is a grumpy, tough-minded, unhappy old man who can't get along with either his kids or his neighbors. He is a Korean War veteran whose prize possession is a 19 β¦72 Gran Torino he keeps in mint condition. When his neighbor Thao, a young Hmong teenager under pressure from his gang member cousin, tries to steal his Gran Torino, Kowalski sets out to reform the youth. Drawn against his will into the life of Thao's family, Kowalski is soon taking steps to protect them from the gangs that infest their neighborhood. (Read More)
Subgenre: | cult filmcoming of ageblack comedytragedy |
Themes: | near death experiencemurderdeathrevengekidnappingrapefearfuneralgangsterincestracismdeath of motherdysfunctional familyredemptionhome invasion β¦greeddeath of wifeprejudiceforgivenessself sacrifice (See All) |
Mood: | murder suicideself parody |
Locations: | churchhospitalbarcarbathtubbustaxikitchenpolice carusacatholic church |
Characters: | cousin cousin relationshippriestfather daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipafrican americandoctortattoobrother brother relationshipboy β¦brother sister relationshippolice officerbabyhostagelawyertough guybullycatholicasian americancatholic priestgrandfather granddaughter relationshipengineersexist (See All) |
Period: | 2000s |
Story: | cousinconfrontationcompassionculture clashblockbusterteen angsthairy chestgay slurbeatingbare chested maleblooddogtwo word titleguncigarette smoking β¦title spoken by characterpartyknifesurprise endingpistolcell phoneshot to deathmachine gunshot in the chestshotgunrescuepunched in the facewatching tvcatarrestshowdownrifleheld at gunpointbeerbirthdaybathroomneighborhandcuffsrevolvertelephonef wordsubjective cameraflashlightgangold manambulancedeath of friendmontageimmigrantno opening creditsanti herocoffinbirthday partybathbartenderracial slurtrainingconfessionattempted murderdangerkeysuburbwidowercharacter's point of view camera shotproduct placementkicked in the faceflowersscardirected by staramerican flagtragic eventgiftthreatwitnessbasementgardenchickenhandgunsubtitled scenegaragestrong female characterpickup truckmachismobirthday caketraditionuziheavy rainlooking at oneself in a mirrorrace relationsmale bondingworking classnosebleedrape victimhonorhaircutretirementthughaunted by the pastanti semitismrap musicveteranconstruction siteburglaryitalian americansexismtitle appears in writingpost traumatic stress disordermentorfather figurecigarette lighterdeath of protagonistghettogang rapeblack eyewisecrack humorracistsalesmanraised middle fingerbarbecuefemale doctorlonerinsultbigotryduct tapetragic herobruiseethnic slurmisogynyneighborhoodshot multiple timesmale virginheroismspittingpetgardeningirish americanstreet gangconstruction workermisogynistlast will and testamentdetroit michiganbarberconfessionalbully comeuppanceconstructionmedalpeer pressureurban decayworkshopgeneration gapshamanunsubtitled foreign languageracial prejudicepearl necklacen wordaltered version of studio logodrive by shootingtragic pastwashing machineracial tensiontragic endingracial discriminationhandymancoughing bloodtailorhip hop musicbarbershopfinger gunvillain arrestedbilingualismattempted robberyzippo lighterbarber shophardware storetitle appears in songracial issuesbigotlawnmowerman boy relationshipincest overtonesgolden retrievergranddaughtertelling a jokeclassic cardoor bellmisanthropelung cancertradition versus modernityceiling fanporchhoodlumoff screen rapecommunity servicehoroscopevintage carethnic humorwhite male pretending to be blackinitiation ritekorean war veteranconfession boothmisanthropyincest rapeshallowchoredisrespectteen smokingfilm with ambiguous titlebiasnose ringgarden gnomeprovocationtoolsracist insultheavy smokerchrist figurecoolerpolish americanburned with a cigaretteelderly protagonistshot repeatedlyracist jokereference to the three stoogesgrumpy old manmoral transformationracial intolerancebarbecue grillwashing carcurmudgeonlapsed catholicnavel piercingsilver staralpha maleasian mobwoman doctordisinheritancedriveby shootinggutterwill readingpabst blue ribbon beerbattle fatiguehmongracist as protagonistreference to charlie chanwasted lifenasty neighborhouse repairschild translates for adultcough foreshadows deathmalcontentwar medalfood freezerford torinomedal of valorracial barrierracial diversity (See All) |
Amal is a small insignificant town where nothing ever happens, where the latest trends are out of date when they get there. Young Elin has a bit of a bad reputation when it comes to guys, but the fact is that she is inexperienced in that matter. Another girl in her school, Agnes, is in love with her β¦ but is too shy to do anything about it. For a number of reasons, Elin ends up at Agnes' birthday party as the only guest. They have a girl's night out together but after that Elin desperately avoids Agnes, refusing to even consider her own feelings toward Agnes. (Read More)
Subgenre: | teen moviecult film |
Themes: | lovedrinkingdrunkennessseductiondrug usesexualitypoetrybullyinghomophobiabreak upcrueltyfirst love |
Mood: | night |
Locations: | small townschoolelevatorwheelchairapartmentsex in cartownnew girl in town |
Characters: | teenage boyteenage girlfather daughter relationshipfamily relationshipshomosexualmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipfemale protagonistgirlsister sister relationshipbullyhomosexualitylesbian relationship β¦self destructivenesshomosexual teenagerself injuryin love (See All) |
Story: | title based on songteen angstobscene finger gesturelocker roomgay slurbare buttface slapshowermale nuditykisssexf ratedmasturbationtwo word title β¦sex scenefightphotographtitle spoken by characterpartylesbian kisspantiestelephone callcryingdreamunderwearfoodmirrorwatching tvcomputerdrinkvomitingtearsbirthdaylingeriebathroombisexualbrawinebridgeeatingsuicide attempttoiletwhite pantiesmodelapologybirthday partyvirgincoming outproduct placementdiarybirthday cakeitalianlgbtloss of virginitypsychologistforbidden loveteenage protagonisthitchhikermilkhitchhikingwatching televisionwindpillsguestmobile phonesexismfirst kisssibling rivalryfrustrationswedenice hockeyvegetarianswingbetclassmatelocation in titleprofanity in titleboredomparalysisbirthday presentcafeteriateenage lovelotterywalletrumorteasingwrist slittingcdscandinaviarazor bladeperfumeteenage crushseductive behaviorteenage girl in underwearinvitationscandinavian girlstockholm swedenmopedsecret loveschool lifemotor scooterdarereputationteen drinkingcontemplating suicidelesbian teenfeature film directorial debutweavingteen sexualityyoung female sexualitypotato chipshy girlchocolate milkbosnianbad reputationnight outteen issuesseduction between girlstossing rocks at a windowrave the partygymnasium schoolsun lamp (See All) |
Mike Waters lives on the street and befriends the somewhat older and streetwise Scott Favor who shows him what is necessary to survive. Waters suffers from narcolepsy and can fall asleep at any moment and in almost any circumstance. Favor comes from a rich family and is rebelling against his own bac β¦kground. They travel together extensively - Waters is driven by the need to find his biological mother - and spend time in Italy. Later in life however, Favor has joined mainstream society and has little time for his old friend. (Read More)
Subgenre: | cult filmindependent filmcoming of age |
Themes: | murderdeathfriendshipsurrealismmoneypoliticsdrinkingdrunkennessfuneralincestmemoryrobberytheftdeath of fatherdeath of mother β¦povertydrug usedysfunctional familyguiltgriefsexualitygamblingsadismabuseunrequited lovecrueltyhomelessnesstraumawealthcheatinginheritanceregretpsychological traumanarcolepsy (See All) |
Mood: | nightmare |
Locations: | cityrural settingsmall townmotorcyclechurchbarrestauranthotelcarcemeteryairplanebathtubtaxiairportwheelchair β¦urban settingfarmitalyfrancetruckrooftopcampfiregay bar (See All) |
Characters: | priestdancerteenage boyteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshippolicemother son relationshipfriendsingerbrother brother relationshipboyprostitute β¦girlgay sexpolicemanthiefartistbest friendreference to godhomosexualitymaidgermangay teenagerboyfriend boyfriend relationshipgay friendself identityhomosexual kissex teacher (See All) |
Period: | 1990swinter |
Story: | cartoon on tvcompassiontitle based on songteen angsthairy chestgay slurundressingdancingbare chested malemale nuditykisssexfemale nudityviolence β¦threesomeflashbackmasturbationdoggunfemale rear nudityfightcigarette smokingphotographsingingknifechasebased on playcryingsongdreamunderwearhorseurinationwatching tvdrinkcondomlettershootingpaintingliebeertearssunglassesbombbedcafeprostitutionhallucinationmale pubic hairbisexualbedroomwinebandconcertfour word titlecocainepoliticianhousefishnonlinear timelinemodelpaintercoffinbathsearchjourneygraveyardold womandrowningconfessionlimousinesmokingliaron the roadstorytellingstatuetentrabbitbraceletflowerspursuitcountrysiderock 'n' rollsadnesssleepingfireworksgraffitieuropetwenty somethingitalianpoemropepornographyrevelationfaintingrome italybarnstealingsanta claussheephome moviehomeburialhitchhikerstreet lifehitchhikingmental institutionwhiskeybarefootmale prostitutehaunted by the pastsufferingshoesintriguerejectionjunkielosttime lapse photographymale male kissattractiondark pastalienationbonfirehustlerseattle washingtonpervertbisexualityhandshakeporn magazineheartbreaksandwichnecrophiliagun in mouthmen's bathroomleatheraccordionblackoutjukeboxmotel roomtrailer homepopcorncoca colaunconsciousnesspocket watchinfatuationfallingbathrobegigolotravelingteethbroken heartluckhandmale prostitutioncowardoregoncleaningsorrowtraumatic experiencereference to john waynespaghettiportland oregonlocksheltersnoringsquatterdepravityfacesurrogate fatherpreachingsoul matestate name in titleboy girl relationshippassing outsleeping bagmetropolisstreetcarmistreatmentrepressed memorytv show in filmwashington statewine bottlesearchingfrench friesidahobreakdownheartbeattwinkloss of innocencemodern day adaptationeffeminacypastamoral corruptionpsychedeliablack leatherseashellrelativecolosseumshavevagrantemotional breakdownpoker the card gameairplane ticketspeeding ticketpatrolmanrich poorporno shopshakespeare in modern dressconfronting the pastgay magazinedrive in movierandom sexsearch for parentcountry roadgreat plainsfarmlandsound of sexfamily disputemale hustlerold buildingrich fathergay prostitutionscrubbingfalling off a chairrighteousnessboise idahowater basinhome sweet homesafe boxdirty clothesspeed the drugteaching englishfake sexreference to sinead o'connorauto partssex for salegunnysackfaltering friendshiphome on the rangehouse occupationprofession of lovesleeping on a sidewalk (See All) |
One misty morning, Liz Dunn stumbles down the road to her school and screams for help. A police psychologist gets her to reveal her story: A month earlier: three rebellious teenagers - Mike, Frankie and Geoff are trying to ditch the school field trip to Wales. The school nerd Martin helps them out b β¦y allowing them to stay in an old war bunker for the three days on the condition that his friend Liz joins them. The teens go down, party and have great fun but Martin doesn't return to let them out and they hope and pray that someone will find them... (Read More)
Subgenre: | independent filmconspiracypsycho thriller |
Themes: | psychopathobsessioninsanitystarvation |
Locations: | hospitalschoolpolice station |
Characters: | teenage girlpolicepolice officerdetectivegirl nudity |
Story: | group showershower roommale in showerblood on faceteen angsthairy chestlocker roomshowerbare chested malemale rear nuditymale nuditysexfemale nuditybased on novelflashback β¦male frontal nudityfightmale full frontal nuditychasepunched in the facecameravomitinghallucinationmale pubic hairtoiletfalse accusationmissing personscreamprankteenage sexathletetold in flashbackpsychologistladdermale underwearcrime sceneboxer shortsrejectionboarding schoolman cryingcannabiswoman cryingfemale psychopathmaking outinfatuationlocked doortopless girlwalesjockrugbyeating disorderprivate schoolteenage crushholesole survivorbulimiastupid victimman wearing towelplotmob of reportershigh school athletegirl toplesswashing hairheavy breathingunderground bunkerpopular girlrugby playermale in towelmen's locker roombare breasted girlpolice tapeunreliable flashbackromantic rejectionhomicidaljammed door (See All) |
After Iggy's long-time girlfriend is murdered and the whole town agrees he is the killer, he awakens one morning with horns and the townspeople soon confess their sins. Once knowing the sins of the people, he is facing the true killer of his beloved girlfriend.
Subgenre: | supernaturalmurder mysteryurban fantasy |
Themes: | near death experiencemurderdeathlovefriendshiprevengeinfidelityrapereligionjealousydrunkennessinvestigationangersupernatural powerdeath of mother β¦cancerillnessevilalcoholismcrueltytraumadevilpolice investigationmurder of a police officerdeath of daughterrape and murder (See All) |
Locations: | small townchurchhospitalbarforestcemeterywoodspolice carsex outsidesex in a carsex in chaircar on firesex outdoorssex in woods |
Characters: | religious fanaticpriestteenage boyteenage girlfather daughter relationshipteenagerfamily relationshipsfather son relationshippolicemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdoctor β¦brother brother relationshipgirlpolice officernursepolicemanmusicianlawyerlove trianglechristianbest friendreference to godlittle girlgay kisswaitressinterracial relationshipchristianityalcoholicchildhood friendyounger version of charactercheating girlfrienddeath of girlfriendbetrayal by friend (See All) |
Story: | man hits womancartoon on tvblood on faceconfrontationhairy chestgay slurundressingface slapbare chested malemale nudityfemale nuditybased on novelbloodviolenceone word title β¦bare breastsfemale frontal nudityflashbackmale frontal nuditysex scenefemale rear nudityfightcigarette smokinginterracial sexphotographtitle spoken by charactermale full frontal nudityexplosionfiretopless female nudityvoice over narrationcryingshot to deathshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewatching tvbrawlsecretletterliedead bodyhallucinationhandcuffsreference to jesus christprayerreporternewspaperjournalistcandlestabbingimpalementcocainedinerstabbed in the chestsnakenonlinear timelineno opening creditsscantily clad femaleunderwater sceneshot in the legnecklacetransformationbartendergunshotconfessionattempted murderpublic nuditydrug addictcursevirginbeaten to deathprotestperson on firedollstatueringscarcrosswitnesscharacter says i love youloss of motherredheadcheating wifearsonterminal illnesstopless womancloseted homosexualrockanswering machineburned aliveaddictionheavy raingay characterdrugfriendship between menlistening to musicgroup of friendstold in flashbackcaught having sexdemonstrationmagazinecrying womanvisitteddy bearfollowing someonecrying manpresumed deaddrug overdosepump action shotgunsevered fingerbreakupunfaithful wiferejectionbroken glassjunkietaking a picturepolice officer shotfirst kissdeath of protagonistaccidental killingfriendship between boyswedding ringsuspectgasolinemale male kissbarefoot femaleinjusticechainriding a bicycleplaying pianoframed for murderseattle washingtonengagement ringsinbeing followedmale objectificationblood on camera lensbarking dogtaking a photographporn magazineoutcastmolotov cocktailstuffed animalplaying poolrepeated scenehead blown offdoubtdrunken manpiano playingloss of daughtertemptationmale in underwearoutsiderdouble barreled shotgunhospital roommasturbation reference13 year oldexhibitionistgramophonereceptionistbare chested boywormstreet fightbitten in the neckman punching a womantaking off shirthandcuffedtopless girlconscienceurinatingtrumpetmurder suspectsleeping in a carevil womancar set on firewatermelonmurder attemptmurder by gunshottreehousedance scenehiding placeriding a bikepitchforkseductive behaviormemorialrescue from drowningtaking off clothesundressing someonetraumatic experienceangstturkeydeath by gunshotburn victimsnake bitehouse on firepunch in faceimmolationdonutfinding a dead bodysex from behindcloseted gaymale male hugpointing a gun at someoneblasphemycrime of passionseductive womanwingsdrug triptitle spoken by narratorvinylman slaps womandaredrunken womanspoiled bratcrying malemoving outhysterical womandiscovering a dead bodyselfish womanhornlearning the truthburnreference to the rolling stoneshand injurycharacter says i'm sorryvicarloss of girlfriendtalismanhysterical outburstdeath by shootingantiherotv crewbitten on the armbiblical referencesocial outcastblood on handscherrybreaking upspoiled childhomophobic slurmelonunfaithful girlfriendreference to david bowietrumpet playerpassed out drunkmorse codeoutburstsex at workfalse accusation of murderchildhood flashbackscreaming girlmurder disguised as suicideprivate investigationhit on the head with a rockmurder by shootingbitten in the facesleeping on the floorbrother brother conflictestranged motherupside down camera shotheavy smokerreference to nirvanahornstree houseasthma inhalerbanging head against wallsetting a fireterminally illgay coptalking about masturbationplush toymale female fightreference to jim morrisonangel wingssearch for truthgrieving fatherplaying trumpetspoiled girlbitten by a snakeadvocatepunch in stomachreference to the doorswingcrying for helpbrother brother fightgoodbye letterstabbed with a pitchforkdeath during sexfight between friendschristian fanaticgolf instructorattention seekerdelirium tremensoutdoors sexselfish motheramc gremlinchainletcherry bomb (See All) |
Daniel and his mother move from New Jersey to California. She has a wonderful new job, but Daniel quickly discovers that a dark haired Italian boy with a Jersey accent doesn't fit into the blond surfer crowd. Daniel manages to talk his way out of some fights, but he is finally cornered by several wh β¦o belong to the same karate school. As Daniel is passing out from the beating he sees Miyagi, the elderly gardener leaps into the fray and save him by outfighting half a dozen teenagers. Miyagi and Daniel soon find out the real motivator behind the boys' violent attitude in the form of their karate teacher. Miyagi promises to teach Daniel karate and arranges a fight at the all-valley tournament some months off. When his training begins, Daniel doesn't understand what he is being shown. Miyagi seems more interested in having Daniel paint fences and wax cars than teaching him Karate. (Read More)
Subgenre: | teen moviecult filmmartial artscoming of age |
Themes: | dancedrunkennessphilosophy |
Mood: | high schoolmoving |
Locations: | motorcyclebeachrestaurantlos angeles californiabicycleapartmentschool dancebeach partynew schoolused car |
Characters: | teenage boyteenage girlteenagermother son relationshipboyfriend girlfriend relationshipteacherwarriorbullysingle motherteacher student relationshipjapanese american |
Period: | 1980s |
Story: | blockbusterteen angstlocker roomface slapfistfightbeatingdancingkissviolencefighttitle spoken by characterchasethree word titlebrawlshowdown β¦marijuananeighborcombatfoot chaseapologyfishingbirthday partyracial slurtrainingkaratewidowerfirst of seriesmini skirthalloween costumeprankconvertiblemartial artistcheerleadergiftdateschoolgirlfirst partlove interestclass differencesstylized violencemartial arts mastereggfriendship between menassaultchop sockybroken legitalian americanrowboatmentorblack eyeyoung lovekarate chophalloween partyroundhouse kickkarate kickunderdogcar troublevietnam veteranwar heropaintbottlefencerestroombully comeuppanceold flamecostume partyflymastershort skirtintergenerational friendshiptai chihandymanblack beltworld war two veteranmartial arts tournamentsoccer footballsnobvideo arcademiniskirtphoto boothcountry clubstudent athletegimedal of honorteenage sonshower curtainchopsticks the eating utensilschoolyard fightfighting movieresiliencedojangbonsaibonsai treesifuunusual method of trainingcar as a giftavantimartial arts bowschwinn bicyclereference to jcpenney (See All) |
In small-town Texas, high school football is a religion. The head coach is deified, as long as the team is winning and 17-year-old schoolboys carry the hopes of an entire community onto the gridiron every Friday night. In his 35th year as head coach, Bud Kilmer (Jon Voight) is trying to lead his Wes β¦t Canaan Coyotes to their 23rd division title. When star quarterback Lance Harbor (Paul Walker) suffers an injury, the Coyotes are forced to regroup under the questionable leadership of John Moxon (James Van Der Beek), a second-string quarterback with a slightly irreverent approach to the game. "Varsity Blues" explores our obsession with sports and how teenage athletes respond to the extraordinary pressures places on them. (Read More)
Subgenre: | teen moviecoming of agefootball movie |
Themes: | friendshipreligionjealousydrinkingdrunkennessrobberytheftobsessionprejudice |
Mood: | high school |
Locations: | small townhospitalbarrestaurantcarbuspolice cartruckstrip clubtexasschool buscar theft |
Characters: | teenage boyteenage girlfather daughter relationshipfamily relationshipsfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyteachergirl β¦police officernursestudentthiefchristiansheriff (See All) |
Story: | teenage rebellionhairy chestlocker roombare buttundressingbeatingbare chested malemale rear nuditymale nuditykisssexfemale nuditynuditybloodbare breasts β¦female frontal nudityfemale rear nuditycigarette smokingnipplespartyerectionpantiestopless female nuditycryingdreamunderweardrinkthongvomitingriflebeertearscafevoyeurclassroomprayerstrippersubjective cameracleavagebratoplesswhite pantiesman with glassespainpublic nudityargumentblack pantiesstrippingspiritualitystripteasemini skirtbaseball batinjectionhigh school studentcheerleadercrosspigchickenprofanityclasspickup trucktopless womansurgerycircuscoachwoman with glassesfamecowboy hatcrucifixamerican footballdrug abusebuttocksrebelrebellionpicnicbroken legwhiskeyhit in the crotchconvenience storenipplefootball playerblack bradiscriminationheartsexual humorbarbecuetrophycar drivingsports teamfemale teacherpink pantiesmini dressfencerear nudityvulgarityboy with glassessex educationpopularityhead injuryscholarshipbroken nosehigh school girlwashing machinerevoltbreastwhipped creamfootball coachhigh school seniormascotfemale studentmutinyfake breastscoyotemusclehigh school footballnaked buttadolescent boydrinking gamehigh school athletefootball stadiumwinningadolescent girlpeanut butterhigh school boyquarterbackgirl in brabelchingknee injurypain killermale bare buttfootball practicesteroidnarrow mindednessbare butt maleblurry visionhail marypep rallyathletic scholarshipsyrupmini martice cream sundaehit with a ballobese boysports trainerscar tissuebrown universitychugging beerdriving in the nudefootball refereetouch downcherriesfemale stripteasemale buttocksfootball injurysports broadcasterwhipped cream bikini (See All) |
Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr β¦overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)
Subgenre: | teen moviecoming of ageperiod film |
Themes: | dancefriendshipsuicidedrugschristmasjealousydrinkingfearincestmemoryseductionlonelinessdepressiondrug usecancer β¦guiltdatingmental illnesspoetryabusebullyingunrequited lovehomophobiabreak updyingwritingcheatingfirst lovedying from cancerdeath of best friendsuicide of friend (See All) |
Mood: | high school |
Locations: | churchhospitalrestaurantsnowtrucktunnelcatholic churchpennsylvaniaschool dancekitchen knife |
Characters: | priestdancerteenage boyteenage girlteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfriendboyfriend girlfriend relationshipdoctorsinger β¦brother brother relationshipboybrother sister relationshipteachergirlpolicemanphotographerwriterbest friendreference to godgay kissbullylittle boyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All) |
Period: | 1990syear 1991 |
Story: | high school danceabusive boyfriendpromtrustgay slurbookface slapbeatingdancingkissbased on novelflashbackfightphotograph β¦singingpartyknifetelephone callvoice over narrationcryingfoodcar accidentmirrorslow motion scenepunched in the facewatching tvcamerawritten by directordrinkcondomsecretlettershootingtearsrunningbirthdaycafemarijuanabathroomcollegehallucinationreference to jesus christclassroomprayertelephonef wordsubjective camerabedroomwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abusedrivingapologyracial slurpainflash forwardlibraryvirginreadingchristmas treecollege studentprankhigh school studentcheerleaderglassesrock 'n' rollsadnesssix word titleclassreference to william shakespearetypewriterteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualhuggingfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessamerican footballmovie theaterimpersonationnew year's evecrushvirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingothgraduation12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytailschool principallsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasteraudio cassettehouse partylip synchingcar radioteenage crushdance scene11 year oldwriting a letterwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glasseslast day of schoolenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All) |
Happily married New York lawyer Dan Gallagher has an affair with his colleague Alex, and the two enjoy a love weekend while Dan's wife and kid are away. But Alex will not let go of him, and she will stop at nothing to have him for herself. Just how far will she go to get what she wants?
Subgenre: | cult filmmartial artssuspense |
Themes: | murderdeathrevengesuicidekidnappingmarriageinfidelityjealousyadulterypregnancyvoyeurismseductionextramarital affairobsessionparanoia β¦redemptionguiltunfaithfulnesssexualitymental illnessmadnessself harm (See All) |
Mood: | neo noir |
Locations: | cityhospitalnew york cityrestaurantbathtubpolice stationofficeusasex in a bathroomsex in kitchensex in a kitchensex in an elevator |
Characters: | husband wife relationshippolicelustsecretaryself mutilationpolice lieutenantself cutting |
Period: | 1980s |
Story: | sexual repressionmale in showerrepressionblockbusterpassiongay slurbare buttundressingbeatingmale rear nuditymale nuditykisssexfemale nudity β¦nuditybloodviolencebare breastsdogtwo word titlefemale rear nuditycigarette smokingnipplesknifeleg spreadingtelephone calltopless female nudityfondlingcorpsecar accidentblondewatching tvliedead bodysex standing upvoyeurmanhattan new york cityalcoholoperacookingnew yorkbreast sucklingstrangulationwomanstabbed to deathsuicide attemptchild in perilbathcontroversyfemme fataleconfessionlibrarystalkersuburbchampagneumbrellamoaningrabbitactor shares first name with characterdomestic violencesensualityfemale removes her clothesstalkingthreatcharacter says i love youthreatened with a knifemaniacflirtinghugginganswering machinedesirebreaking and enteringstreetdresslawvillainesscovered in bloodvictimcoituscheating husbandfemale killermale underwearapartment buildingsexual desirekickingbroken glassheadphonespanties pulled downperversionsuspectbowlingfamily dinnerpassionate kissmarital problemexhibitionismpipe smokingunfaithful husbandpetcar drivingcentral park manhattan new york citylong hairmental breakdownskirtsexual perversionsexual tensionroller coasterfemale psychopathblood stainexhibitionistautumnyuppieobsessive lovebased on short filmwalkingmurder witnesslighting a cigarettefatal attractionmurderessmysterious womanknife murdercaressbutcher knifeinvitationvillain not really dead clichesexual obsessionpanties hit the floor555 phone numbercrime of passionclothes rippingcigarsexual intercoursecrotch shotnew housewine drinkingborderline personality disorderpretending to be deadfondling breastfemale vomitingsex addictnail polishhome alonewoman smoking cigaretteawakeningintercoursevillainess played by lead actresscocktail partypublishingman and woman in a bedadultererrainy daytelephone operatorsneaking outadulteresskissing breastsfemale stalkerespressosucking breastdrowning in a bathtubdepressed womanfaking illnesstea kettlelighting a cigarette for a womansexual murderspurned womantollboothautumn leaveskilling a petantisocial personality disorderreal tv show shown in fictional situationearly morningclothed sexwoman in a bedspurned manwronged wifemadame butterflyrabbit stewrolodexvolvo 240volvo station wagon (See All) |
A suburban Chicago teenager's parents leave on vacation, and he cuts loose. An unauthorised trip in his father's Porsche means a sudden need for lots of money, which he raises in a creative way.
Subgenre: | teen moviecult filmerotic fantasy |
Themes: | friendshipdrugsmoneyjealousyvoyeurismrobberywrestling |
Mood: | high schoolcar chase |
Locations: | cartaxiairportchicago illinoiscar in waterschool nursesex in a chair |
Characters: | teenage boyteenagerfather son relationshipmother son relationshipfriendprostitutepimpdancing in underwear |
Period: | 1980s |
Story: | male in showerblockbusterteen angstundressingshowerdancingbare chested malemale nuditysexfemale nudityfemale frontal nuditymasturbationtwo word titlesex scene β¦partypantiestelephone callwoman on topunderwearblondeslow motion scenebedmarijuanabathroomprostitutionvoyeurtelephonecleavagebedroomhousesubwaywhite pantiesscantily clad femalestrippingfantasy sequenceprankpremarital sexdirectorial debutclass differencesteenage sexsexual fantasyshavingdesirenipples visible through clothingpokersexual attractiongroup of friendsice creamred dressblack humormale underwearsexual desireunderage drinkingburglarysex talkpanties pulled downsexual humorattractionextortionliving roombriefswrestlerclose up of eyespractical jokedockcar drivingfemale removes her dressstairwaymini dresscall girlbikeporschewhite briefsdrug humorsex on stairspoker gameoverhearing sexsubway trainshort shortsfemale in a showerhome alonesodaadolescent boysexual jokecounting moneylifting weightsburgermale in a showerkissing in publicauto repairdark glassesbutt grabelectric razorwearing sunglasses at nightweight trainingtransvestite prostitutelake michiganfifty dollar billcollege boundfaberge egghigh school wrestlingalone in houseadult actor playing minorbaby picturecollege interviewtrashed housepop quiz (See All) |
In rural Tennessee, Lazarus, a former blues musician who survives by truck farming, finds a young girl nearly beaten to death near his home. She's the white-trash town tramp, molded by a life of sexual abuse at the hands of her father and verbal abuse from her mother, who seems to delight in remindi β¦ng Rae of her mistake in not aborting her. Lazarus, who is also facing personal crisis at the dissolution of his marriage, nurses Rae back to health, providing her with gentle, fatherly advice as well as an education in blues music. Rae's boyfriend, Ronnie, goaded by the man who nearly beat Rae to death, misunderstands the relationship between Lazarus and Rae, and vows to kill him. Lazarus, exhibiting a street-smart understanding of violence and its motives, calls Ronnie's bluff, senses that he is as troubled as Rae, and becomes a guiding force in the young couple's resurrection. (Read More)
Themes: | lovefriendshipmarriagedrugspregnancydrinkingdrunkennessweddingdeceptionseductionangerdrug useredemptioninsanityillness β¦faithabuseexploitationabortiontraumafreedom (See All) |
Mood: | nightmarearchive footage |
Locations: | rural settingsmall townchurchbarrestaurantbathtubbuskitchenmotelstormsex outsidesex outdoors |
Characters: | cousin cousin relationshipbibledancerhusband wife relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattoosingerboyprostitutemusicianlustex husband ex wife relationship β¦pimpu.s. soldier (See All) |
Story: | cowboy bootstractorministerobscene finger gestureundressingbeatingdancingkissfemale nuditynuditybloodbare breastsfemale frontal nudityflashbackdog β¦gunsex scenefightcigarette smokinginterracial sexnipplestitle spoken by charactersingingpartyleg spreadingthree word titlepantiestelephone calltopless female nudityfondlingcryingsongunderwearfoodslow motion scenedrinkkissingvomitingriflebeertearsanimal in titlecafemarijuanahallucinationprayercolor in titleguitarcleavagebrabandconcertdrug dealermontageeatingprisonerwhite pantieschild abusescantily clad femalecoffeebartenderracial slurpublic nuditycursevirginprologuemini skirtattempted rapefarmergardenkissing while having sexgaragegirl in pantiespickup trucktopless womansupermarketnipples visible through clothingwoundloss of virginitydressrace relationssexual abusecaptiveguitaristcaucasianwristwatchnaked womanpreacherrear entry sexgrocery storebloody noseu.s. armykickingsex talknippleanxietyfather figurecigarette lighterthunderstormroseblack eyehealingcapturewedding dressnervous breakdownchainholding handssouthern accentpromiscuous womanfarmingshortschild molestationtemptationfarmhousetrailer homesexual promiscuitypharmacytennesseecoughingreverendtopless girlfeverauto mechanicwoman wearing only a man's shirtnymphomaniacbreastfilm starts with sexsalvationhymnblues musicunwanted kissfirst sexual experiencepool hallbride and groombroken bottleclothing storesex from behindzippo lighterguard dogpanic attackamerican southbarber shopsaying gracepharmacistdrugstoresex act reflected in mirrorsex addictmoonshinenymphomaniahot pantsleft for deadrecovering alcoholicgirl toplessunfaithful girlfriendchurch choirwoman in a bathtubsouthern gothicanxiety attackmultiple loversstomachnaked outdoorsblack man white woman relationshippoor white trashreformradiatorbare breastice bathcorn on the cobrose gardenblues singersexual innuendo in titlewickednessanxiety disorderflower gardenwatchdogvegetable farmheavy machinerysex act reflected in a mirrorchained to a radiatorsex reflected in mirrorsexual hysteria (See All) |
In 1767, the British Princess Caroline is betrothed to the mad King Christian VII of Denmark, but her life with the erratic monarch in the oppressive country becomes an isolating misery. However, Christian soon gains a fast companion with the German Dr. Johann Struensee, a quietly idealistic man of β¦the Enlightenment. As the only one who can influence the King, Struensee is able to begin sweeping enlightened reforms of Denmark through Christian even as Caroline falls for the doctor. However, their secret affair proves a tragic mistake that their conservative enemies use to their advantage in a conflict that threatens to claim more than just the lovers as their victims. (Read More)
Subgenre: | conspiracyperiod dramaperiod piececostume drama |
Themes: | dancelovemarriageinfidelityreligionbetrayalpoliticsadulteryprisonpregnancyfeartortureextramarital affairdepressiondrug use β¦insanityhumiliationillnessmental illnessexecutiondyingrevolution (See All) |
Mood: | rain |
Locations: | churchbeachsnowbathtubenglandgermanybrothelsex in public |
Characters: | priestteenage boyfamily relationshipshusband wife relationshipmother son relationshipdoctorprostitutelove trianglereference to godlittle boymaidfrenchcrying babystepmother stepson relationshipin love |
Period: | 18th century1700s |
Story: | sexual repressioncensorshiphairy chestgay slurbare buttundressingface slapbeatingdancingbare chested malekissfemale nudityf ratednudityblood β¦flashbackmasturbationdogsex scenefemale rear nuditybased on true storyvoice over narrationcryingcorpsehorsemirrorslow motion scenearrestlettervomitingtearsdead bodydecapitationspycandleeatingnarrationbathkingflash forwardconfessionprotestfired from the jobcrosschildbirthhorse ridingreference to william shakespearequeenlooking at oneself in a mirrorroyaltydemonstrationdenmarkdysfunctional marriageservantmobrebellioncrying mantorchfatestreet lifepromisearranged marriageintrigueunfaithful wifehistoricaltheatre audiencedead manvoice over letterprison celllanternpublic humiliationpassionate kisshorse and carriageholding handspalaceimprisonmenthorseback ridingdanish royal familybeheadingunhappy marriagepeasanthit in the facephysiciantreasonstepmotheridealismrumorstage play16 year oldfencingbare chested boycopenhagen denmarkillegitimate childenlightenmentcoup d'etataristocracyradicalsecret loveends with biographical notesstagecoachroyal familytortured to deathpuppet showcoupmasqueradecouncildanish historytalking to a doggreat danespitting on someonepublic executionmarital rapecopenhagenreformsmallpoxdestroying propertymarriage as hellreference to voltairevaccination1770slady in waitingmasked ballmasquerade partywoman in a bathfree thinkerringing a bellreference to jean jacques rousseaureference to king arthur1760sman in bathdanish politicsgovernment ministerpolitical reformmarriage troubleinoculationtalking to a horsemale male embracedowagerfancy dress party (See All) |
The year is 1795 and young Jane Austen is a feisty 20-year-old and emerging writer who already sees a world beyond class and commerce, beyond pride and prejudice, and dreams of doing what was then nearly unthinkable - marrying for love. Naturally, her parents are searching for a wealthy, well-appoin β¦ted husband to assure their daughter's future social standing. They are eyeing Mr. Wisley, nephew to the very formidable, not to mention very rich, local aristocrat Lady Gresham, as a prospective match. But when Jane meets the roguish and decidedly non-aristocratic Tom Lefroy, sparks soon fly along with the sharp repartee. His intellect and arrogance raise her ire - then knock her head over heels. Now, the couple, whose flirtation flies in the face of the sense and sensibility of the age, is faced with a terrible dilemma. If they attempt to marry, they will risk everything that matters - family, friends and fortune. (Read More)
Themes: | dancedeathlovemarriagebetrayaldrinkingweddingvoyeurismangerpovertygamblingunrequited lovewealthwritinghunting |
Mood: | rain |
Locations: | rural settingchurchbeachforestlondon englandwoodsfarmcourtroomenglandcastle |
Characters: | cousin cousin relationshipdancerfather daughter relationshipfamily relationshipshusband wife relationshipmother daughter relationshipsingerbrother brother relationshipbrother sister relationshipprostitutewriterlawyersister sister relationshipartistmaid β¦uncle nephew relationshipolder woman younger man relationshipuncle niece relationshipaunt nephew relationshipfiance fiancee relationship (See All) |
Story: | pastorministerbookbare buttdancingmale rear nuditymale nuditykisscharacter name in titlenuditydoggunfightsingingparty β¦voice over narrationsonghorsemirrordrinkletterriflepianoswimmingcandlewomanmontageboxingjudgemarriage proposalflash forwardskinny dippingpublic nuditylibraryauthorknocked outreadingcourtpianistpigclass differenceshunteririshembarrassmentcelebrationmutenovelistbalconypublic humiliationhorse and carriagesign languagehorseback ridingsermonwomen's rightsheartbreakestateindependenceunconsciousnesscricket the gameupper classboxing matchopera singerstar crossed loverspotatocountry lifeelopementjugglerfalling asleepvicarcountry estateladyseashoregeorgianwomen's liberationempire fashionjane austen1790sfire eaterlivestockdeath of fianceenglish country danceparishstiltwalkerdeaf and dumblove declarationcontessageorgian romancepublic readingrector (See All) |
She's All That is your typical high school prom king and queen story and the run in defending the star status in the upcoming election. High school hottie, Zack Siler is dumped by his prom-queen girlfriend, the equally attractive and extremely popular, Taylor Vaughan who fell for a second-hand world β¦ reject TV soap star who she met over the spring break. Having been publicly dumped, Zack defends his discomposure by stating that Taylor is all make-up and wonder-bra and he can make any ordinary girl a prom queen with a similar package. His high-school buddy, Dean Sampson, engages him in a bet following this statement and picks the geeky looking Laney Boggs out of the crowd as the girl Zack must transform into the new prom queen. Zack agrees since he has no option, but as time passes and Laney begins to transform, Zack begins to find her attractive. While all that falls beautifully in place, it's not your typical fairy-tale. Throw in Dean Sampson to complicate the situation, as when he first made the bet he never thought that Zack could rise to the challenge but looking at how Laney has transformed, it looks like Zack could be on a winning streak. (Read More)
Subgenre: | teen moviecult filmfish out of waterteen romanceteen comedy |
Themes: | friendshipdeceptionhumiliationrivalrybullyingfalling in love |
Mood: | high schoolnightmare |
Locations: | beachlos angeles california |
Characters: | father daughter relationshipteenagerfather son relationshiptattoobrother sister relationshipbullyself expression |
Story: | high school dancespontaneous choreographypromteen angstlocker roomdancingkisstitle spoken by characterpartybikinivomitingtransformationpublic nudityloss of mother β¦nerdjeepblack humorbreakupunderage drinkingmakeupyoung lovebetgraduationcafeteriamakeovermisfitvolleyballpopularitywagerjockhouse partychick flickperformance artopposites attractfast food restaurantjerkmodern artsoccer footballperformance artistart classtv starstudent athleteyearbookclown makeupcinderella storypool cleanerbeeperwrong side of the tracksbeatboxingtrippingugly ducklingpygmalionmusical sequence in non musical workfemale rivalryeyebrowsavante garde art (See All) |
Return to rockin' Rydell High for a whole new term! It's 1961, two years after the original Grease gang graduated, and there's a new crop of seniors - and new members of the coolest cliques on campus, the Pink Ladies and T-Birds. Michael Carrington is the new kid in school - but he's been branded a β¦brainiac. Can he fix up an old motorcycle, don a leather jacket, avoid a rumble with the leader of the T-Birds, and win the heart of Pink Lady Stephanie Zinone? He's surely going to try! (Read More)
Subgenre: | teen romance |
Themes: | dancelovegangsterrivalrybreak upboy girl friendship |
Mood: | high school |
Locations: | motorcycleschoolpolice cargas stationschool bustwo on a motorcycle |
Characters: | cousin cousin relationshipteenage boyteenage girlteenagerteacherstudentex boyfriend ex girlfriend relationship |
Period: | 1960s1950syear 1961 |
Story: | teen angstdancingkissnumber in titlesequelcigarette smokingsingingclassroomdinerrabbithigh school studentcheerleadergroup of friendsbikerbowling β¦leather jacketenglishman abroadpiano playingtween girlbowling alleybriton abroadopposites attracttalent showintergenerational friendshiptwin sistergogglesschool lifemotorcycle with a sidecargas station attendantnumber 2 in titledirt bikeplay rehearsalmotorcycle helmetboy meets girlbomb shelterdance numberblack leather jacketpublic address systemflag polemotorcycle jumpgreaserpink carsexy teachernurse cap (See All) |
The movie details a town split between the wealthy South Zone gang called 'The Socials' and the poor North Zone gang called 'The Greasers'. Dallas Winston, Ponyboy Curtis and Johnny Cade from 'The Greasers' befriend the rich Cherry Valance and Marcia at a drive-in. Later that night, a group of 'The β¦Socs' chase and beat up Johnny and attempt to drown Ponyboy in a fountain. However, Johnny stabs one Soc and kills him, saving Ponyboy. The desperate boys seek Dallas who finds a hideout for them in a nearby town. One week later, Johnny and Ponyboy decide to return to their hometown, with Dallas, to claim the murder as self-defense. But on their way back, they see the church on fire and Ponyboy and Johnny help the children trapped in the church and become heroes. However Johnny is badly wounded and confined to the hospital. Meanwhile The Socs and The Greasers prepare to fight. (Read More)
Subgenre: | teen moviecult filmcoming of agetragedy |
Themes: | murderdeathfriendshipdrinkingdrunkennessescaperobberyangerlonelinessdysfunctional familyrivalryunemploymenthomelessnesswriting |
Mood: | high schoolrainnightaffection |
Locations: | rural settingsmall townchurchhospitalbartraincarkitchenpolice car |
Characters: | teenage boyteenage girlteenagerpolicefriendbrother brother relationshipboygirlpolice officernursetough guybest friendsuicide by cop |
Period: | 1960s |
Story: | punchingcompassionteen angstbookface slapbeatingbare chested malebased on novelbloodviolenceflashbackgunfightcigarette smokingknife β¦chasepantiestelephone callfirevoice over narrationcryingdreamshot to deathunderwearshot in the chestrescuepunched in the facedrinklettershootingvomitingshowdownheld at gunpointbeertearsrunningrevolverfightingcriminaltelephonefoot chaseorphanflashlightgangambulancestabbingdeath of friendstabbed to deathhousewhite pantiesargumentdangerfugitiverabbitdomestic violencescarconvertiblethreatsadnessclass differencesrunawaymachismopoempokerstreetheavy rainfriendship between mengroup of friendsloss of friendmale bondingwatching a moviehomehitchhikinghomicidemale underwearwatching televisionswitchbladetrappedplaygroundunderage drinkingitalian americankickingdiscussiontitle appears in writingcard playingdead boyliving roombriefsjuvenile delinquentlaughingbonfireowlplaying cardst shirtmudleather jacketjoyheroismsunsetstorefinal showdownnotebookparalysisgang warstreet gangspit in the facenovelcar drivingarmed robberybitternesscomic reliefoutsidergang violencehospital roomhospital bednewspaper articleunconsciousnessconversationkickreading a bookunderage smokingwhite briefsshirtrunidolman wearing glassesmotorcycle copanguisharm wrestlingcoldintimacymedical doctorhopelessnessdreamingjuvenile delinquencyraccoonsolidaritysmilingcity parkreading a letterdrive inrainy nightblue jeanshostilitysodadelinquentgang warfarecult movie castbuilding on firewanderinghoodlumuncertaintymale chauvinismrebelliousnesswet jeansabandoned churchreference to paul newmanattempted drowningbrat packburn injurysiren the alarmgreaserteenage gangtroubled teenage boytulsa oklahomaman in showersocial consciousnesscartoon on televisiondrive in theatrerumbleholding someone's head underwatermovie screenrebellious teenagerreference to hank williamshiding outfellowshipdenimreference to robert frostscrapbroken teeth (See All) |
A man about forty years of age tells the story from when he was a teenager in upscale suburban Detroit of his and three of his friends' fascination with the mysterious and doomed Lisbon sisters. In 1974, the sisters were seventeen year old Therese, sixteen year old Mary, fifteen year old Bonnie, fou β¦rteen year old Lux, and thirteen year old Cecilia. Their fascination still remains as they try to piece together the entire story. The sisters were mysteries if only because of having a strict and overprotective upbringing by their father, who taught math at the girls' private co-ed school, and overly devout Catholic mother, who largely dictated the household rules. The story focuses primarily on two incidents and the resulting situations on the girls' lives. The first was an action by Cecilia to deal with her emotions over her life. And the second was the relationship between Lux - the sister who pushed the boundaries of the household rules most overtly in doing what most teenagers want to do - and Trip Fontaine, he who could have any girl he wanted but wanting solely Lux. (Read More)
Subgenre: | teen moviecult filmindependent filmcoming of ageblack comedycoming of age film |
Themes: | deathsuicideinfidelitybetrayalghostjealousyadulterydrinkingescapedeceptionmemoryextramarital affairobsessiondepressionunfaithfulness β¦mental illnessunrequited lovefirst loveregret (See All) |
Mood: | high school |
Locations: | hospitalschoolswimming poolcemeterytaxischool dance |
Characters: | priestdancerteenage boyteenage girlfather daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerteachersister sister relationshiplust β¦psychiatristcatholiccatholic priestgay fatherwriter directorself destructivenessdeath wishself inflicted injuryhomosexual father (See All) |
Period: | 1970ssummer |
Story: | high school danceoverprotective parentpromrepressionteen angstpassiondancingkisssexf ratedbased on novelflashbackcigarette smokingsingingparty β¦voice over narrationcryingsongtitle directed by femaledreamunderwearwatching tvdrinkvomitingtearssunglassesmarijuananeighborhallucinationvoyeurclassroomprayertelephoneambulanceimpalementsuicide attemptdinnerchild abusegraveyardtalking to the cameravirginsuburbpop musicpoisonstorytellinghangingdiarymanipulationtragic eventcrosssplit screenrock 'n' rollisolationdirectorial debutclassteenage sexrecord playerflirtingpot smokingloyaltyballoonloss of virginityrecordingcrucifixamerican footballwatching a moviemagazinemovie theatergossipgay parentflatulencehome movietennisvirginitypeeping tomgas masktelescopeunderage drinkingfootball playertheatre audiencecigarette lightertime lapse photographyaviationnotemelancholypromiscuityreflectionnews reportersexual awakeningteachingcannabishigh school teacherhomecomingpostcardfenceloss of daughtertombstonetween girltv reportersexual promiscuityinsomniarumorinfatuationpoisoninggeneration gapwrist slittingpopularityloss of childfootsie under the tablehearsemichiganschoolteacherdown syndromequarantinebeltfootball teamlabor unionknittingenigmateen suicidefirst sexual experiencecocktailunicornfemale to male footsie playingabusive mothertennis courtasphyxiationsexual explorationtamponmental instabilitylabor strikemirror ballsleeping pillsmodel airplanetv crewfootball stadiuminsulinsparklerfootball fieldlawn sprinklerpopsiclehouse arrestinnocence lostdebutantemorse codemass suicidelovesicksouvenirauditoriumhanged girlabused childrat poisonmentally challenged personchild suicidejumping off a rooffootball practicesuicide preventiondrugged foodpicket lineyale universitycarbon monoxide poisoninginsomniacgirls' bathroommathematics classmath teacherbrownie the foodprom dressschnappsgas stoveimpaled childstrict mothercataloguetalking to a plantemotional depressionhollyhomecoming dancereference to kiss the bandmaximum securityphotosynthesisdead child with eyes openreference to aerosmith the bandscotch tapemysteriousnesstwo on one footsie playingbaseball on tvelmiron fencemedicine overdosestrict parent (See All) |
Nineteen-year-old Brooklyn native Tony Manero lives for Saturday nights at the local disco, where he's king of the club, thanks to his stylish moves on the dance floor. But outside of the club, things don't look so rosy. At home, Tony fights constantly with his father and has to compete with his fam β¦ily's starry-eyed view of his older brother, a priest. Nor can he find satisfaction at his dead-end job at a small paint store. However, things begin to change when he spies Stephanie Mangano in the disco and starts training with her for the club's dance competition. Stephanie dreams of the world beyond Brooklyn, and her plans to move to Manhattan just over the bridge soon change Tony's life forever. (Read More)
Subgenre: | teen moviecult filmmelodrama |
Themes: | dancelovefriendshiprevengemarriagedrugsrapejealousypregnancydrunkennessracismhomophobiaunemployment |
Mood: | moving |
Locations: | hospitalnew york citynightclubsex in car |
Characters: | priestdancerteenagerfather son relationshipmother son relationshipfriendbrother brother relationshipcatholicgrandmother grandson relationship |
Period: | 1970s |
Story: | blockbusterhairy chestgay slurdancingbare chested malesexfemale nuditythree word titlecar accidentcondombrawlfalling from heightcafemarijuanamanhattan new york city β¦death of friendbridgesubwayracial slurfired from the jobattempted rapepremarital sexfirst partreference to william shakespeareclass differencesdiscogroup of friendsworking classassaultbrooklyn new york cityitalian americansexismracistethnic slurmisogynyworld trade center manhattan new york citycannabisconstruction workermisogynistexotic dancerintoleranceunhappinessday in titlevanityreference to shakespeare's romeo and julietpuerto ricancamera focus on female buttunwed pregnancyhardware store19 year olddance contestbased on articlebased on magazine articledance studiosoundtrackreference to david bowiereference to bruce leechauvinismdisco dancingdisco musicreference to al pacino8 trackaccidental suicidereference to laurence oliviergreasersalesclerksaturdayname droppingfalse informationreference to eric claptonreference to farrah fawcettwhite castlereference to cat stevensthe bee geesreference to paul anka (See All) |
Four members of a high school band called Mystery do everything they can to attend a KISS concert in Detroit. In order to make it to the show they must steal, cheat, strip, deal with an anti-rock mom and generally do whatever it takes to see the band that has inspired them to be musicians.
Subgenre: | teen moviecult filmcoming of ageperiod pieceteen comedy |
Themes: | friendshipdrugsmoneydrinkingtheftdrug usehomophobia |
Mood: | high school |
Locations: | citychurchbarrestaurantcarelevatorstrip clubcatholic churchsex in carschool bus |
Characters: | priestteenage boyteenage girlfather daughter relationshipteenagerfamily relationshipshomosexualfather son relationshippolicemother son relationshipmother daughter relationshipfriendsingerbrother brother relationship β¦boyteacherstudentpolicemanthiefjewishcatholicolder woman younger man relationshipalcoholic drinkreligious mother (See All) |
Period: | 1970s |
Story: | title based on songobscene finger gesturegay slurbeatingkisssexfemale nudityblooddogfightcigarette smokingejaculationtitle spoken by charactersinging β¦chaseerectiontelephone callfiresongunderwearcar accidenturinationslow motion scenedrinklierifleplace name in titlerock musiccafemarijuanabathroomhallucinationhandcuffsclassroomguitarsubjective camerawinebandconcertrock bandapologynunvanmicrophonestrippingvirginstripteaseliarpay phonecity name in titlecrosssplit screenrock 'n' rollclassrecord playerpizzanerddiscoloss of virginitylistening to musiccomic bookrecordingred dressvandalismcrucifixflatulencevirginityheavy metalface paintrock concerthit in the crotchblack brafirst kisshot tubgeekreckless drivingposterdrumsstolen carreference to elvis presleyporn magazinebongmenstruationvomitcafeterialong hairdetroit michiganconfessionalfilm projectordomineering motherradio stationtape recordinglsdwetting pantsstonedreference to albert einsteinmushroomstation wagondisc jockeycar radiodetentiongynecologistfemale to male foot in crotchreference to richard nixoncleveland ohioloudspeakerpremature ejaculationattempted robberyboy bandguard dogpizza delivery boyswedishfemale sitting on a toiletfrisbeetamponmusic concertmusic groupcult music bandauto theftcrossing selfpainted facepinball machinebubble gumvolvogargoylepokiesgym classstage frightsparklerreference to andy warholchop shopbelchroadieprodigal sonlava lampreference to jimmy carteri.d.porno moviechain smoking8 trackreference to john travoltapolkaclassic rock musicgirls' bathroomkneed in the crotchfour best friendshustler magazinepimpleface paintingacnesmiley facereference to burt reynoldsbell bottomsreligious parentsreference to lassiereference to the village peoplereference to farrah fawcettbackstage passconcert ticketradio contestreference to richard pryortest tube babyreference to patty hearstday glokiss the bandorff carmina buranareference to bobby kennedyreference to general motorsreference to sonny and cherreference to the hulkreference to john belushireference to blue oyster cultreference to carly simonreference to henry winklerreference to lee majorsreference to steve martinreference to the bay city rollersreference to the carpentersst. bernard (See All) |
Although cheerful, friendly, intelligent, well-dressed, authentic and wealthy, Charlie Bartlett has problems. With his father gone and his mother loopy and clueless, he's been expelled from every private school for his victimless crimes. Now he's in a public school getting punched out daily by the s β¦chool thug. He ever longs to be popular - the go-to guy - and the true crux of his troubles is that he invariably finds the means to this end, whatever that might be. At Western Summit High, he makes peace with his tormentor by going into business with him - listening to kids' problems and selling them prescription drugs. Charlie's a hit, but attraction to Susan (daughter of the school's laissez-faire principal), new security cameras on campus, a student's overdose, and Charlie's open world view all converge to get him in serious trouble. Can this self-made physician possibly heal himself and just be a kid? (Read More)
Subgenre: | teen moviecoming of age |
Themes: | friendshipinfidelitydrugsmoneyadulteryprisondrinkingdrunkennessextramarital affairdivorcedepressiondrug usedysfunctional familyunfaithfulnessdating β¦humiliationbullyingabductionalcoholismwealth (See All) |
Mood: | high school |
Locations: | small townbarrestaurantswimming poolpolice carschool bussex in a carschool bus driver |
Characters: | dancerteenage boyteenage girlfather daughter relationshipfather son relationshippolicemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerteacherstudentpolicemanwriter β¦bullysingle motheralcoholicpsychiatristtalking to oneself in a mirrorstudent protest (See All) |
Story: | sexual repressioncompassionteen angstbookundressingbeatingdancingbare chested malekisssexfemale nuditycharacter name in titlebloodguncigarette smoking β¦title spoken by charactersingingpartypistoltelephone callcryingcell phonesongunderwearmirrorpunched in the facecomputerdrinkarresttearssunglassescafemarijuanapianojailclassroomrevolverguitartelephonewinebandconcertmansionbasketballdrug dealermontagesuicide attempttoiletrock bandinternetman with glassesanti herounderwater scenelimousinemicrophonevirgincoming outprotestfired from the jobfantasy sequenceauditionbodyguardcheerleadersplit screendateloss of fatherhandgunclassclass differencesteenage sexgarageriotloss of virginityice creamjail cellvandalismdemonstrationamerican footballassaulttherapistfraudtennisskateboarddrug overdoserampageremote controlpillssurveillance cameraresearchbackstagepool tablefootball playermedicationfirst kissschool uniformdaydreamblack eyelonerclassmatebriefcasebrushing teethpajamaschauffeurpiano playervideo tapeteenage loveoverdoseconfessionalplaywrightpeer pressurebare chested boymegaphonepopularitylollipoppsychiatryprivate schoolfootball teamwatching a videorescue from drowningteen suicideloudspeakersuicidal thoughtsvillain turns gooddriver's licensefrench accentbritish accenthigh school principalsocial outcastpetitionfake idsedativepenitentiarytoilet stallfalling into a swimming poolanti depressantdestruction of propertystreakingtoilet bowlgiving the fingerschool expulsionmentally challenged personprescription drugsfake doctortax evasionboys' bathroomsexual confusionprozacchauffeured limousineattention deficit disorderhead in toiletkid outsmarts adultrailroad tracksritalintoy boatgarage doorxanaxdrive in movie theatrepsychiatric institutionbackseatmodel boatzoloftschool blazerdestructivenessfight in men's roomnicotine gumpassing notehigh school playrave the partysocial acceptanceschool superintendentchuck taylor gym shoesfake psychiatristmisdiagnosis (See All) |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the β¦ Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
Subgenre: | cult film |
Themes: | dancefriendshipmoneypregnancydrinkingdrunkennessweddingmemory |
Mood: | breaking the fourth wall |
Locations: | motorcyclechurchnew york citybarbeachhotelairplanenightclubtaxirooftopoceanyacht |
Characters: | priestdancerfather daughter relationshiphomosexualmother daughter relationshipfriendsingerfemale protagonistmusicianwritersingle motherolder woman younger man relationship |
Story: | blockbustertitle based on songbookbare buttdancingmale rear nuditymale nuditykissf ratednudityflashbackdogsex sceneejaculationphotograph β¦singingpartypunctuation in titlecryingsongtitle directed by femalemirrorslow motion scenedrinkthongfalling from heightlettertearspianoislandguitarswimmingbandwomanbridgetoiletinternetfishno opening creditsdrawingbartenderlimousinebinocularsfantasy sequencesuitcaseflowersscene during end creditsdiaryexclamation point in titlepianistsplit screencloseted homosexualtouristfaintinglifting someone into the airbarnoverallsarchitectbuttocksbrideladdergoatearthquakepassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptiondonkeypeasantharbortriple f ratedlaundrydocksailboatold flameraftmailmailboxillegitimate childmusic boxjumping into waterbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airbased on stage musicaltoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropesummer romancewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All) |
Two unpopular teenagers, Gary Wallace and Wyatt Donnelly, fail at all attempts to be accepted by their peers. Their desperation to be liked leads them to "create" a woman via their computer. Their living and breathing creation is a gorgeous woman, Lisa, whose purpose is to boost their confidence lev β¦el by putting them into situations which require Gary and Wyatt to act like men. On their road to becoming accepted, they encounter many hilarious obstacles, which gives the movie an overall sense of silliness. (Read More)
Subgenre: | teen moviecult filmcoming of ageteen comedyerotic fantasycult comedyscience fiction comedy |
Themes: | friendshipfeardrunkennessmonstervoyeurismsupernatural powerblackmailhumiliationbullyingtechnology |
Mood: | high schoolcar chasebreaking the fourth wall |
Locations: | motorcyclebarrestauranttrainschoolswimming poolsnowtaxikitchenpolice carchicago illinoisstormschool bullywater gun |
Characters: | teenage boyteenage girlteenagerhusband wife relationshipfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipbrother brother relationshipteacherpolicemanbest friendbullyolder woman younger man relationshipgrandfather grandson relationship β¦grandmother grandson relationshipself discoverydream girllow self esteemself confidencerunning from policenew teacher (See All) |
Period: | 1980s |
Story: | male in showerundershirtteen angsthairy chestgay slurbare buttface slapshowermale rear nuditymale nuditykissfemale nuditynuditybare breastsfemale frontal nudity β¦masturbationdogtwo word titlegunphotographexplosionpartychaseerectionpantiesurinationblondeshotgunwatching tvcomputermaskshootinglieriflebathroomrobotpianovoyeursciencecleavagebrabased on comic bookgangwhite pantiesbrunetteapologyscantily clad femalecigar smokingtransformationbartendergunshotblack pantiesvirginsuburbdollbaseball batgymhigh school studentbrothercharacter says i love youfreeze framesexual fantasytopless womanexperimentnerdshavingdestructionfriendship between menlistening to musicfaintingsexual attractionhuntermagazineflatulencevisitteenage protagonistembarrassmentandroidbikermale underwearrampagereverse footageplayboy magazinethunderbraveryboxer shortsguestbuddyunderage drinkingtaking a picturefirst kissthunderstormfriendship between boysred pantiesduckbarefoot femalewishbriefsgeekfemale in showerreckless drivingplaying pianowoman in underwearmale virginrocketmale objectificationbriberytaking a showerbarking dogtaking a photographporn magazinestorehiding in a closethigh school teacherpubertypiano playingcomputer crackerescalatorsexual tensioncamera shot of bare feetmale in underwearoutsidermallmasturbation referenceburnt faceman in underwearenvy15 year oldteenage sexualityreference to albert einsteincreationtopless girlurinatingunderage smokinghorninesshouse partyplumberwhite briefsperfumecowardexperiment gone wrongawkward situationgeniewashing machineseductive behaviorvisitorreference to john waynescrewballbiker gangfeet on tablenegotiationdovepointing a gun at someonewrapped in a towelseductive womanframed photographnuclear weaponloss of memoryreference to ludwig van beethovenhysterical womannight clubwoman in showercmnfnuclear missilecharacter says i'm sorryfemale objectificationsocially awkwardscientific experimentfantasy becomes realityclothed male naked malereference to frankensteinhumanoidgym classsocial outcastgym teacherobese womancmnmreconstructionfantasizingmorphingcmnm scenefake idhomophobic slurid cardclothed male naked femalepurple pantiesshared showerbarbie dollcmnf scenescience experimenttaking off shoesgrandparentsblue eyesuninvited guestcatatoniacurly hairfainting manblackmailerburpingbrat packseductive manbouncing breastscabriolettitle as songsleep overpink dressreference to harry houdinitalking about masturbationriding a motorcyclesocial awkwardnesswedgieblowing smoke in someone's facereference to time magazinepants pulled downcreator creation relationshiplingerie storepantryartificial humanfalling chandeliermale fantasysquirt guntitle songgirl wearing pantiesdrunken teenagerman wrapped in a towelnerd boycartoon on televisionflushing a toiletobscene hand gesturechased by policerejectstrict parentsfire placeshowering togetherunplugged electronic worksface injuryartificially created womanphotograph comes to lifecigar smokerdestroying a computerhiding erectionhigh school bullyreference to playboy magazineunderage driverwind tunneltrashed housedouble takehysterical motheropera glovesperfect womanstrapless dressbuzz cutclose up of lipsdead duckimitating masturbationnerdy boyshermer illinoisunpopularitygrabbed by the lapelsblowing smoke into someone's faceboy wearing female underwearcrossing fingershalf shirtlearning to kisspicture comes to life (See All) |
Based on actual events. Brandon Teena is the popular new guy in a tiny Nebraska town. He hangs out with the guys, drinking, cussing, and bumper surfing, and he charms the young women, who've never met a more sensitive and considerate young man. Life is good for Brandon, now that he's one of the guys β¦ and dating hometown beauty Lana; however, he's forgotten to mention one important detail. It's not that he's wanted in another town for GTA and other assorted crimes, but that Brandon Teena was actually born a woman named Teena Brandon. When his best friends make this discovery, Brandon's life is ripped apart. (Read More)
Subgenre: | independent filmtragedy |
Themes: | dancemurderdeathfriendshiprapeprisonlesbianismdrinkingseductionbrutalitydrug usedysfunctional familysexualityhome invasionhomophobia β¦transgenderprejudice (See All) |
Locations: | rural settingsmall townbarkitchenfarmcampfire |
Characters: | cousin cousin relationshiphomosexualpolicemother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshippolicemantranssexualsingle motherself mutilationdeath of girlfriendself worth |
Period: | 1990s |
Story: | title based on songobscene finger gesturegay slurundressingbeatingshowerkisssexfemale nudityf ratednudityviolenceflashback β¦female rear nuditycigarette smokingpartylesbian kissthree word titlepistolbased on true storyvoice over narrationpunctuation in titletitle directed by femaleshot in the headpunched in the facewritten by directordrinkarrestsex in bedshootingbirthdayapostrophe in titlejailrevolvernewspaperstrap on dildobreast sucklingdisguisebrunettebirthday partycontroversylatex glovesstrippingfugitivefemale removes her clothestragic eventthreatdirectorial debutcross dressinghatetwenty somethingtransvestitemachismoclaim in titlestabbed in the stomachrape victimbar fighthaircutrole playingredneckimpostorrejectionkaraokelove at first sightprison cellbigotrypassionate kisssexual assaultsodomymain character diesfemale female kissmenstruationoutcastgay bashingtrue crimedouble lifeintolerancesexual violencefarmhousemisfitnewspaper articlehate crimefactory workerwhite trashcontraction in titlebiologyex confisticuffsmugshotmurder by gunshotsociologyftmmain character shotunwanted kisssexual identitygender disguisegirlfriend girlfriend relationshipnebraskaostracismrite of passagelesbian slurgender confusiongirl disguised as boybinding breaststransphobiasexual identity crisistransgender protagonistfemale dressed as maletraffic ticketmale impersonationroll in the haylincoln nebraska (See All) |
Beyond being in the same class at Shermer High School in Shermer, Illinois, Claire Standish, Andrew Clark, John Bender, 'Brian Johnson (XIV)' (qv) and Allison Reynolds have little in common, and with the exception of Claire and Andrew, do not associate with each other in school. In the simplest and β¦in their own terms, Claire is a princess, Andrew an athlete, John a criminal, Brian a brain, and Allison a basket case. But one other thing they do have in common is a nine hour detention in the school library together on Saturday, March 24, 1984, under the direction of Mr. Vernon, supervising from his office across the hall. Each is required to write a minimum one thousand word essay during that time about who they think they are. At the beginning of those nine hours, each, if they were indeed planning on writing that essay, would probably write something close to what the world sees of them, and what they have been brainwashed into believing of themselves. But based on their adventures during that nine hours, they may come to a different opinion of themselves and the other four. (Read More)
Subgenre: | teen moviecult filmindependent filmcoming of ageblack comedyteen comedycoming of age film |
Themes: | dancejealousyescapeangerdysfunctional family |
Mood: | high school |
Locations: | carofficechicago illinois |
Characters: | teenage boyteenage girlteenagerteacherstudentbullyteacher student relationshipself discoveryself esteemself acceptance |
Period: | 1980s |
Story: | teenage rebellionconfrontationteen angstobscene finger gesturegay slurbookdancingkisstitle spoken by characterthree word titlepantiessongfalling from heightrunningmarijuana β¦f wordbasketballjokewhite pantiesbrunettescantily clad femaleconfessionlibraryargumentvirginsuburbprankhigh school studentthreatredheadpot smokingrevelationelectronic music scoreragevirginityjanitorimaginationdiscussionrejectionlaughterfrustrationlipstickone daylonerinsultabusive fatherjuvenile delinquentgeekwrestlerpractical jokedirector cameoboredomsandwichhigh school teacherpink pantieslockermakeoverearringpeer pressuremisfitprincipaladult actress playing teenage girlsuicidalpopularityhallwayjockhigh school girlsushiopposites attractriskdrug humordetentiontroubled teenconformityreference to john lennonantiherosingle set productionteenage angststudent athletehigh school boyschool lockerteenagehiddenair ductdefiancekleptomaniabrat packcompulsive liarpopular girlhiding under a tablehuis clossaturdaymusical sequence in non musical workexposed underwearreference to barry manilowview under tableadult actor playing teenage boydandruffshermer illinoiscult following (See All) |
Ronald Miller is tired of being a nerd, and makes a deal with one of the most popular girls in school to help him break into the "cool" clique. He offers her a thousand dollars to pretend to be his girlfriend for a month. It succeeds, but he soon learns that the price of popularity may be higher tha β¦n he expected. (Read More)
Subgenre: | teen moviecoming of ageteen romance |
Themes: | dancefriendshipmoneyredemptionunrequited lovebreak up |
Mood: | high school |
Locations: | motorcycleairplane |
Characters: | teenagerfamily relationshipspoliceboyfriend girlfriend relationshipbest friendex boyfriend ex girlfriend relationshipdream girl |
Period: | 1980s |
Story: | high school dancecowboy bootstitle based on songteen angstkisspantiespunctuation in titlebeerbedapostrophe in titlebathroomneighborhalloweenbedroomcult β¦missioncheerleaderclass differencesnerdtraditionpoolnew year's evescamremote controltelescopereconciliationbootsshopping malltvfrustrationcrowdvodkareflectionhappy endingtruthcafeteriaboy with glassespopularityobsessive lovehouse partystation wagonopposites attractferraridetentionschool lifepoker gamesocial climberlawn mowernew year's eve partycheerleadinghigh school footballostracismthe beatles songhalloween pranknylon stockingsremadefoolpersonality changetucson arizonahappy new yearhunkcable tvfavorpygmalionsocial isolationparty goerhanging outegging a housedog barksenior yearboogieautomatic pilot (See All) |
It's the proverbial end of the summer 1962 in a small southern California town. It's the evening before best friends and recent high school graduates, Curt Henderson and Steve Bolander, are scheduled to leave town to head to college back east. Curt, who received a lucrative local scholarship, is see β¦n as the promise that their class holds. But Curt is having second thoughts about leaving what Steve basically sees as their dead end town. Curt's beliefs are strengthened when he spots an unknown beautiful blonde in a T-bird who mouths the words "I love you" to him. As Curt tries to find that blonde while trying to get away from a local gang who have him somewhat hostage, Curt may come to a decision about his immediate future. Outgoing class president Steve, on the other hand, wants to leave, despite meaning that he will leave girlfriend, head cheerleader and Curt's sister, Laurie Henderson, behind. Steve and Laurie spend the evening "negotiating" the state of their relationship. Meanwhile, two of their friends cruise around town for the evening. Steve has left his car to meek and mild-mannered Terry "Toad" Fields to look after during his absence. The wheels give Toad a new sense of confidence, which he uses to try and impress Debbie Dunham, a more experienced girl generally out of his league. And John Milner, who is seen as the king of the street race in his souped-up yellow deuce coupe, tries to get rid of precocious pre-teen, Carol Morrison, who has somehow become his passengerβ¦ (Read More)
Subgenre: | teen moviecult filmindependent filmcoming of agesemi autobiographical |
Themes: | dancefriendshipjealousyrobberyangerdatingunrequited lovefirst love |
Mood: | high schoolone night |
Locations: | small townmotorcyclecarairplaneairporturban settingpolice carschool dance |
Characters: | teenage boyteenage girlteenagerpoliceboyfriend girlfriend relationshipbrother sister relationshipgirlpolice officerlove triangleself discoveryself esteemdream girlself acceptance |
Period: | 1960ssummeryear 1962 |
Story: | high school danceteenage rebellionblockbusterteen angstbookfistfightdancingtwo word titlefightsingingpartysurprise endingpantiestelephone callsong β¦underwearcar accidentblondepunched in the facewatching tvvomitingtearscar crashmarijuanacollegetelephonegangcaliforniadinerwhite pantiesbrunettescantily clad femaleradiogunshotvirginsuburbmini skirtprankconvertiblegymfemale removes her clotheshigh school studentautomobilethreatrock 'n' rollclass differencesrecord playergirl in pantiesnerdpot smokingrevelationwhat happened to epiloguecountry name in titlelistening to musicragevandalismcrushdriving a carforbidden lovevirginitymechanicjanitorunderage drinkingrejectionlove at first sightensemble castfrustrationlipstickyoung loveone daylonerjuvenile delinquentgeekwrestlermusic bandreflectionsexual awakeningmultiple storylineboredomrobberstreet gangfirst datepink pantieslockerjukeboxmakeoverearringscooterboy with glassescrashpeer pressureradio stationmaking outtape recordinggeneration gapmooningpopularityreference to albert einsteinamericanahallwayhouse partydisc jockeycadillacreference to john f. kennedyroller skatesopposites attractcruisingdrug humorradio djliquor storeairlinercar salesmanconformitydance contestauto theftstreet racingantiheroslumber partydrag racingcableloss of innocenceauthoritypopsicleyearbooktelephone boxhoodlumschool lockerd.j.yellow pantieshot rodshaving creamteen loveparty dressrebellious youthambiguous titlewrong side of the trackswild partyshy girltwist the dancelistening to the radioteen rebelreference to the lone rangersputnikgreaserhigh school sweetheartrecord collectiondrive in restaurantreference to the beach boyshigh school loveshot in sequencereference to buddy hollyhigh school yearbookexposed underwearmulti protagonistroadsterdandruffthunderbirdblack and white television1955 chevroletliquor store hold upreference to dick clark (See All) |
This is the story of Enid and Rebecca after they finish the high school. Both have problems relating to people and they spend their time hanging around and bothering creeps. When they meet Seymour who is a social outsider who loves to collect old 78 records, Enid's life will change forever.
Subgenre: | teen moviecult filmindependent filmcoming of agecoming of age film |
Themes: | lovefriendshipsurrealismjealousyobsessiondysfunctional family |
Mood: | high school |
Locations: | los angeles californiabuswheelchairsummer school |
Characters: | teenage boyteenage girlfather daughter relationshipfriendsingerteacherjewishteacher student relationshippsychiatristolder man younger woman relationshipdysfunctional relationshipart teacher |
Story: | censorshipculture clashteen angstdancingbare chested malesexf ratedtwo word titlegunfightpartypistolvoice over narrationcryingbased on comic book β¦old mandinerdrawingsuburbmini skirthigh school studentcult directorsingle parentrecord playerjazzcakemovie theaterbossgirl with glassescynicismunderage drinkingironymay december romancepunk rockalienationadolescentsurprise after end creditsage differencepractical jokecoffee shopreflectionreal estate agentgraduationboredomloss of jobvideo storesarcasmbus stopclinicmisfitprincipalinfatuationbased on graphic novelshort skirtart exhibitionbechdel test passedracial stereotypeblues musicintimacysex shopolder man younger womanidentity crisisforty somethinghigh school graduationhigh school friendolder man young girl relationshipdyed hairart classsocially awkwardpersonal adnunchakucrossroadsmilkshakeuncertaintysketchbookfried chickenyounger woman older man relationshipolder man younger girlprank telephone callreference to laurel and hardyyounger girl older mangraduation partyelitismgarage salefirst jobplasterconcession standmini martdrama queenrecord collectorrude customer (See All) |
In 1963, Frances "Baby" Houseman, a sweet daddy's girl, goes with her family to a resort in upstate New York's Catskill Mountains. Baby has grown up in privileged surroundings and all expect her to go on to college, join the Peace Corps and save the world before marrying a doctor, just like her fath β¦er. Unexpectedly, Baby becomes infatuated with the camp's dance instructor, Johnny Castle, a man whose background is vastly different from her own. Baby lies to her father to get money to pay for an illegal abortion for Johnny's dance partner. She then fills in as Johnny's dance partner and it is as he is teaching her the dance routine that they fall in love. It all comes apart when Johnny's friend falls seriously ill after her abortion and Baby gets her father, who saves the girl's life. He then learns what Baby has been up to, who with and worse - that he funded the illegal abortion. He bans his daughter from any further association with "those people". In the first deliberately willful action of her life, Baby later sneaks out to see Johnny - ostensibly to apologize for her father's rudeness - and ends up consummating her relationship with Johnny. A jealous fellow vacationer sees Baby sneaking out of Johnny's bungalow the next morning, and in an act of retribution, tells management that he is responsible for a theft the evening before, knowing he would not furnish his real whereabouts. (Read More)
Subgenre: | teen moviecult filmindependent filmcoming of ageteen romance |
Themes: | dancelovetheftabortionfirst love |
Mood: | rainnight |
Locations: | rural settingstorm |
Characters: | dancerteenage girlfather daughter relationshipteenagerfamily relationshipshusband wife relationshipmother daughter relationshipdoctorfemale protagonistsister sister relationship |
Period: | 1960ssummeryear 1963 |
Story: | dance lessonfamous songblockbusterdancingbare chested maletwo word titlesingingpantiesvoice over narrationblondesunglassescleavagenew yorkwhite pantiesbrunette β¦false accusationapologyman with glassesscantily clad femalepantyhosemicrophonevacationsensualitypremarital sexdirectorial debutclass differencesapplausewaiterscene during opening creditsred dressgossipvisitdriving a carforbidden lovecamera shot of feetbarefootnicknametitle at the endopening a doorhappy endingsexual awakeningpink pantieslegsmarried coupleknocking on a doorresortmegaphoneteenage daughterlying on bedchick flickwatermelonopposites attractwaking upunwanted pregnancyeuphemismsong during end creditsfade to blackdriving at nightfamous lineliberalolder man younger womanprotective maleshort shortsfamily vacationalliterative titlebreaking a car windowsexual euphemismparking a cardance instructortightstwo sistersspeaking to audienceclass systemwrong side of the tracksreference to cleopatrafather daughter hugsummer romancecatskills1957 chevroletlabor day (See All) |
Rocky Balboa is forced to retire after having permanent damage inflicted on him in the ring by the Russian boxer Ivan Drago. Returning home after the Drago bout, Balboa discovers that the fortune that he had acquired as heavyweight champ has been stolen and lost on the stockmarket by his accountant. β¦ His boxing days over, Rocky begins to coach an up-and-coming fighter named Tommy Gunn. Rocky cannot compete, however, with the high salaraies and glittering prizes being offered to Gunn by other managers in town. (Read More)
Subgenre: | cult filmcoming of ageboxing movieboxing film |
Themes: | revengechristmasmoneybetrayalherodeceptionangerpovertyredemption |
Locations: | motorcyclebarschoolairplaneapartmentart museum |
Characters: | priesthusband wife relationshipfather son relationshipmother son relationshipafrican americanboyfriend girlfriend relationshipdoctortattoobrother sister relationshiplawyertough guyaction herobullyteacher student relationshipuncle nephew relationship |
Period: | 1980s1990s |
Story: | teenage rebellionpunchingsweatteen angstlocker roomfistfightshowerbare chested malemale rear nuditymale nuditykisscharacter name in titlebloodsequelflashback β¦fightcigarette smokingphotographpartysurprise endingslow motion scenepunched in the facebrawlshowdownrunningsubjective cameramansionmontageboxingdrawingnews reportcigar smokingnecklacetraininglimousinecharacter repeating someone else's dialoguecharacter's point of view camera shotproduct placementstatuechristmas treemanipulationgymamerican flagsplit screenbasementmanagerchampionnewspaper headlinefreeze frameeavesdroppingscene during opening creditsjoggingroman numeral in titleboxerbuttockspress conferenceretirementwatching televisionhaunted by the pastrap musicbraveryfanitalian americanmentorblack and white scenepunched in the chestghettoblack eyebody landing on a carphiladelphia pennsylvaniadark pastlens flaretrophybruisefifth partsports carwritten by starnewspaper clippingmedia coverageauctionsouthern accentunderdogbarbed wiremagic trickfighterfinal showdownmusclemanstrongmanfencebully comeuppanceearringweightliftingcameramanarenastreet fightbankruptcyboxing matchpunching bagunderage smokingfur coatembezzlementrepeated lineboxing ringcomebackairfieldtragic pastroman numbered sequelman wearing glassesbrain damagereference to batmanbeefcakechantingboxing glovescoattrainersanta claus suitpinball machinebrother in law brother in law relationshipreference to pablo picassoel trainexercisingtelling a jokebare knuckle fightingtraining montagefistconcubinepet shopboxing gymprotegebirdcagesit upsairport securitymadison square garden manhattan new york citymulletreference to mark twainriches to ragssports heroboxing trainerrockyheavyweight championpromoterreference to disneylandfighting moviearthritisreference to the lone rangerformer athleteloudmouthsimple manloose cannonboxer herocoin trickheavyweightestate saleboxing promoterunusual method of trainingsequel to best picture winnerrecap segmentreference to rocky marcianosouthpawboxing arenaloss of fortune (See All) |
Sara wants to be a ballerina, but her dreams are cut short by the sudden death of her mother. She moves in with her father, who she has not seen for a long time. He lives on the other side of town, in a predominantly Black neighborhood. She gets transferred to a new school where she is one of the fe β¦w White students there. She becomes friends with Chenille, and later, falls in love with Chenille's brother, Derek. (Read More)
Subgenre: | teen movie |
Themes: | dancejealousyracismdeath of motherrivalryprejudice |
Mood: | high schoolhip hop |
Locations: | new york citynightclubkitchenpolice carchicago illinoisfire escapefight in bar |
Characters: | father daughter relationshipteenagerafrican americanbrother sister relationshipsingle motherinterracial relationshipsecurity guardex boyfriend ex girlfriend relationshipgrandmother grandson relationshipgrandmother granddaughter relationshiplow self esteemformer best friend |
Story: | dance lessonteen angstgay slurdancingviolenceflashbackphotographarrestcar crashclassroomprayerbasketballdinerracial sluraudition β¦balletmachismointerracialcatfightoverallsclubinterracial romancemourningmentorghettoyoung lovepassionate kissbruisedead motherintimidationprayingimperative in titlehead woundold dark houselockeroutsidertrain rideroad accidentdrive by shootingchick flickracial tensionschool lifefedoradeath of parentel trainmodern dancegym classjazz musiciantriumphslangdance instructorteenage mothercross cultural relationscultural diversityghetto blasterballet dancingballet shoesforced relocation (See All) |
Mia, an aggressive fifteen-year-old girl, lives on an Essex estate with her tarty mother, Joanne, and precocious little sister Tyler. She has been thrown out of school and is awaiting admission to a referrals unit and spends her days aimlessly. She begins an uneasy friendship with Joanne's slick boy β¦friend, Connor, who encourages her one interest, dancing. (Read More)
Subgenre: | teen moviemusic videocoming of agefish out of water |
Themes: | infidelitymoneyadulterydrinkingdrunkennessextramarital affairtheftdysfunctional familyunfaithfulnessabduction |
Mood: | rainhip hopambiguous ending |
Locations: | traincarkitchenurban settingapartmentlaketrain stationsinging in a car |
Characters: | dancerteenage boyteenage girlteenagerfamily relationshipsmother daughter relationshipboyfriend girlfriend relationshipchildrentattoogirlsister sister relationshipthieflittle girlsingle motherolder man younger woman relationship β¦alcoholic motherdaughter seeing mother have sex (See All) |
Period: | 2000s |
Story: | teenage rebellionteen angstbare buttundressingface slapbeatingdancingbare chested malemale nuditykisssexfemale nudityf ratednuditydog β¦female rear nudityfightcigarette smokingphotographsingingpartypantiestelephone callcryingcell phonetitle directed by femaleunderwearsex on couchhorsemirrorurinationslow motion scenewatching tvdrinkarrestbeertearssunglassesanimal in titlerunningvoyeurrivertelevisionsubjective camerabedroomflashlightcookingvideo camerainternetfishwhite pantieschild abusedrivingspankingvirginscreamingsuburbauditionsleepingsingle parentgirl in pantieshugginghead buttbreaking and enteringwarehouseballoonloss of virginitylistening to musicsexual attractionrecordingstealingworking classyoutubestreet lifeapartment buildingbarefoottensionbloody noserap musicthundercouchunderage drinkingconvenience storebalconyswingsocial workerlooking at self in mirrorsunbathingposterparking lotvodkatriple f ratedgatejunkyardbandagegerman shepherdwalletfencelooking out a windowdouble lifetrailer homeclimbing through a windowponytail15 year oldunconsciousnessteenage daughtercdmailboxactual animal killedwindmillteenage crushgame playingsex with a minorwatching a videorescue from drowningundressing someoneteenage girl in underwearhoodieswingingtrespassingchild abductionpackingsleeping on a couchdiyguard dogoverhearing sexabusive motherbrickhardware storeleaving homeliquor store19 year olddance contesthamsterclothes linealcohol abuseapplying makeupwatching sexplastic bagpadlockhand on crotchrottweilerdead fishhousing projectteen drinkingstatutory rapevoice maillaundry drying on clothes linelimpinglittle sisterprincess costumehigh risespying on couple having sexlower classpiggy back rideband aidswing setmother's boyfriendclimbing a fencefish in titleinternet cafelistening to sexmother and daughter have sex with the same manpitbullschool expulsionfoot injurymother daughter estrangementafrican anglopushed into watertoolscouncil estateabandoned apartmenturban violenceshooting a horsehousing estatechild smoking a cigaretteessexsound of sexrunning mascaraunwanted childwant adautomobile junkyardhand cutnagging motherwrecking yardid badgehigh rise apartment buildingtossing rocks at a windowdance auditiondeath of a horsesony video camerahandfishingtaking off someone's shoesfoot woundfoot cutnegligent mothercarrying a girldrinking water from a faucethead slap (See All) |
Teenager Ethan Wate is obsessed with his urge to finish high school and go on to college in order to leave the small town of Gatlin, South Carolina behind, until a mysterious girl begins to inhabit his dreams. When he meets Lena Duchannes, a newcomer who has just enrolled in his school, Ethan knows β¦she is the girl in his dreams. Lena is rejected by the rest of her classmates for being the niece of Macon Ravenwood, whom the town's superstitious residents consider to be a devil-worshiper. But Ethan gives her a ride anyway and they fall in love. Lena reveals to her new boyfriend that she is a witch, and that on her sixteenth birthday she will be claimed by either the forces of light or of darkness. She will remain in the light, but only if she does not remain in love with Ethan. To make matters worse, her evil mother, Sarafine, is casting spells to push Lena to the dark side. Ethan joins her in a search to find a magic spell to save their doomed love. Will the lovers succeed? (Read More)
Subgenre: | coming of ageblack comedysuspenseconspiracysupernaturalmelodrama |
Themes: | near death experiencefriendshipsurrealismchristmasbetrayalfeardrunkennessescapedeceptionmagicseductionangersupernatural powerparanoiadysfunctional family β¦poetryunrequited loveamnesiaself sacrificebook of magic (See All) |
Mood: | high schoolrainnightmarecar chaseambiguous endingbittersweet |
Locations: | small townchurchforestsnowcemeteryboatwoodsfarmcampfirestormsinging in a car |
Characters: | cousin cousin relationshippriestteenage boyteenagerfamily relationshipsmother son relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipsister sister relationshipchristianwitchmayorpolice chase β¦grandmother granddaughter relationshipuncle niece relationshipaunt niece relationshipaunt nephew relationship (See All) |
Period: | 2010s |
Story: | teen angstbookbare chested malekissbased on novelflashbacktwo word titlephotographexplosionsurprise endingfirevoice over narrationcell phonedreamhorse β¦car accidentshot in the chesturinationrescuewritten by directorbattleriflesunglassesbirthdaypianodemongood versus evilorphandisguisemansionmontagemapfalse accusationno opening creditsdrawingdouble crossvoice overfemme fataletransformationlibrarycursecharacter repeating someone else's dialoguepossessionrace against timeknocked outlightningmanipulationscarspeechhigh school studentsuspicionsacrificebattlefielddestinybulletlooking at oneself in a mirrorcatfightjoggingloss of loved onemovie theatervillainessgossipmind controlforbidden lovefatepreacherfull moonreverse footagevisionhatredbroken glasslove at first sighthypnosisswampthrown through a windowaccidental killinglonercaneclassmateeye patchpassionate kissdemonic possessionstadiumplaying pianotelekinesismoral dilemmasouthern accentceremonyillusionoutcasthigh school teacherteenage lovespiral staircaseworld dominationmegalomaniactornadogreenhousepremonitioncookiehypnotismamerican civil warjockguardianstar crossed loversreference to googlesubterraneanreclusecar rolloverforce fieldglowing eyeslocketmagic spellstarts with narrationhit by a trainloss of memorymedallionsouth carolinacliquebritish actor playing american charactertalismanhigh school principalgrand pianobased on young adult novelwalking in the raindeath of uncleteenage romancesketchbookbenefactorerased memoryrecurring dreamweather manipulationflipping carshape shiftingmeet cuteshared dreamsiren the creatureseerreference to jane austenreference to the titanicbuilding firestanding in the rainplanetary alignmentcivil war reenactmentreference to charles bukowskireference to kurt vonnegutmacaroonpolice car rollover (See All) |
Three teenagers are confined to an isolated country estate that could very well be on another planet. The trio spend their days listening to endless homemade tapes that teach them a whole new vocabulary. Any word that comes from beyond their family abode is instantly assigned a new meaning. Hence 't β¦he sea' refers to a large armchair and 'zombies' are little yellow flowers. Having invented a brother whom they claim to have ostracized for his disobedience, the uber-controlling parents terrorize their offspring into submission. The father is the only family member who can leave the manicured lawns of their self-inflicted exile, earning their keep by managing a nearby factory, while the only outsider allowed on the premises is his colleague Christina, who is paid to relieve the son of his male urges. Tired of these dutiful acts of carnality, Christina disturbs the domestic balance. (Read More)
Themes: | dancedeathmoneyfeardeceptionincestparanoiadysfunctional familymental illnesssadismcrueltyfather daughter incest |
Locations: | swimming poolcarairplanebathtub |
Characters: | dancerteenage boyfather daughter relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipsingerbrother sister relationshipprostitutehostagesister sister relationshipsecurity guard β¦fatherself mutilation (See All) |
Story: | overprotective fatherslappingblood on facehairy chestbookbare buttundressingface slapbeatingdancingbare chested malemale rear nuditymale nuditykisssex β¦female nuditynuditybloodviolenceone word titlebare breaststhreesomefemale frontal nuditymale frontal nuditymasturbationdogsex scenefemale rear nudityfighttitle spoken by charactermale full frontal nuditysingingpartyknifeerectionpantiestelephone calltopless female nuditylickingcryingsongdreamunderwearblood splatterfoodmirrorslow motion scenecatsecretpaintinglietearsrunningbedpianoprostitutionmale pubic hairguitarcompetitiontelephonemenage a troisvideo camerawomaneatinghousefemale pubic hairfishchild abusebathritualunderwater scenesearchpantyhosestrippingscreamingliarfactoryreadingscreamflowersscarpianistfilm within a filmbrothergardenblindfoldsleepingtwinrecord playertopless womaneyeglassesapplausegamekilling an animallooking at oneself in a mirrorcakelistening to musictape recorderrecordingexercisehammerplanetvideotapebarefoot maleswimsuitbrother sister incestsharkhome movieteenage protagonistsocial commentarymale underwearsubmissioncelebrationrear entry sexboxer shortsgreecehit on the headsibling rivalrysuperstitionknife fightalternate realitylooking at self in mirrorfamily dinnerunsimulated sextrophyalienationolder woman younger man sexexplicit sexceremonypiano playermale objectificationsexual awakeningearphonesbarking doggategreekdead animalfencefilm in filmvacuum cleanerguitar playingmasochismsex educationfantasy worldman in swimsuitmercedes benzperfumegame playingdead catwatching a videotaking off clotheshit with a hammersaltshared bathignorancecreationismpencildressingspeedowedding anniversarykeyboardwalkmanhide and seekvcrguard dogsex with socks ontoothsister sister incestreference to frank sinatrabody part in titleperson in a car trunkbottled waterfemale objectificationheadbandcountry estateorange juicecprharpoonneurosisdictionarydobermankeyholefake bloodlooking through a keyholeknife attackperson in car trunktouching someone's breastskilling a cattaking off pantstaking off underwearseclusiondog traininggarden shearserect penismale bare feetbrother sister sexdoor lockbarkingthrowing a rockwashing a carisolated housecar washingcartwheelwatching a porn videoanestheticblood on handarm woundface woundhiding in a car trunktoy airplaneattacked with a knifedog trainerholding one's breath underwaterartificial respirationdeath of catsocial isolationtape measurepost punksleepmaskstomachachenordicmemorizationwatering a planthair gelpolishing shoesswimming gogglesstickermouthwashanother planetdog cagelistening at a doorfemale security guardarm bandageisolationismclipping toenailsmisinformationbroken toothpretending to drownarm cutcutting one's armhome securitybreath holding contestlearning to fightmutilated doll (See All) |
Based on the true life experiences of poet Jimmy Santiago Baca, the film focuses on step-brothers Paco and Cruz, and their bi-racial cousin Miklo. It opens in 1972, as the three are members of an East L.A. gang known as the "Vatos Locos", and the story focuses on how a violent crime and the influenc β¦e of narcotics alter their lives. Miklo is incarcerated and sent to San Quentin, where he makes a "home" for himself. Cruz becomes an exceptional artist, but a heroin addiction overcomes him with tragic results. Paco becomes a cop and an enemy to his "carnal", Miklo. (Read More)
Subgenre: | tragedyheistepicdisney |
Themes: | murderdeathfriendshiprevengerapemoneybetrayalprisonfuneralrobberyracismtheftdrug useprejudicedrug addiction |
Mood: | car chase |
Locations: | churchhospitalcemeterylos angeles californiabuskitchenwheelchairpolice carprison rapepainting a car |
Characters: | cousin cousin relationshipbibledancerfather daughter relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipafrican americanfriendtattoobrother brother relationshipboynurse β¦detectivepolicemanlawyerthiefartistlatinocatholichispanicuncle nephew relationshippolice shootoutgrandfather grandson relationshipaunt nephew relationshipstepfather stepson relationshipdeath of boy (See All) |
Period: | 1980s1970s |
Story: | cousinobscene finger gesturebare buttface slapbeatingshowerdancingmale nuditykisssexfemale nuditybloodviolenceflashback β¦gunfightcigarette smokingphotographexplosionpartyknifechasesurprise endingbased on true storyshootoutunderwearfoodcar accidentwatching tvcamerashootingpaintingriflesunglassesrunningbirthdaymarijuanashot in the backcookinggangcaliforniastrangulationstabbingeatingcocaineprisonerboxingbirdpaintercoffinvangraveyardracial slurlibrarydrug addictorganized crimestatueinjectiontragic eventcrossratlas vegas nevadaclass differencesgraffitiheroingaragehatepowerriotmachismodestinydrag queenhypodermic needleslow motionlawcrucifixdrug abuseboxerart galleryhonorburialtowelstreet lifemexicandrug overdoseprison guardbribecard playingundercover copcanemale male kissgrowing upjuvenile delinquentethnic slurlandlordreckless drivingmexican americanserial murderlatinaface maskgang warspit in the faceaccordionstreet marketmegalomaniacweightliftingstakeoutcripplecolombialoan sharkrehabilitationscholarshipcrotch grabroosterparolereference to ronald reagantequilabiracialmorphineu.s. marine corpsgrudgespray paintstudyingcity hallknife held to throatbandanagloveknife in the chestmuralprison riotbeverly hills californiacrossing selfguatemalarole modelostracismprobationel salvadorshooting upecuadorfoosballprotegebroken backprofessional hitblow torchlowriderpanamahalf brother half brother relationshipprison gangpain killerchicanoartificial legparoleestepbrother stepbrother relationshipdeath by overdosenarceast los angeles californiapcpwhite powerhair netaryan brotherhoodbarrioparole boardyucatanboxing clubgedsucking on fingerpaycheckreference to the los angeles lakersblack militantcholocutting one's handsan quentin penitentiarymurdered in a churchart competitionrecidivismreference to pancho villamexican gangu turncinco de mayoslamming a car door on someone's handlaw librarylos angeles river channelreference to little bo peep (See All) |
Ken Park focuses on several teenagers and their tormented home lives. Shawn seems to be the most conventional. Tate is brimming with psychotic rage; Claude is habitually harassed by his brutish father and coddled, rather uncomfortably, by his enormously pregnant mother. Peaches looks after her devou β¦tly religious father, but yearns for freedom. They're all rather tight, or so they claim. But they spend precious little time together and none of them seems to know much about one another's family lives. This bizarre dichotomy underscores their alienation # the result of suburban ennui, a teenager's inherent sense of melodrama, and the disturbing nature of their home environments. (Read More)
Themes: | murderdeathlovesuicidemarriageinfidelityreligionadulterypregnancydrinkingdrunkennessincestextramarital affairangerdeath of father β¦death of motherdrug usedysfunctional familyunfaithfulnessdeath of wifedyingreligious upbringing (See All) |
Mood: | rain |
Locations: | cemeterykitchenpolice carschool bus |
Characters: | religious zealotreligious fanaticbibleteenage boyteenage girlfather daughter relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother daughter relationshipbrother brother relationshipprostitutesister sister relationship β¦older woman younger man relationshipgrandfather grandson relationshipgrandmother grandson relationshipsingle fatheralcoholic father (See All) |
Story: | teen angstgay slurbare buttundressingbeatingmale nuditykissfemale nuditycharacter name in titlebloodviolencethreesomefemale frontal nudityflashback β¦male frontal nuditymasturbationdogguncigarette smokingejaculationphotographtitle spoken by characterknifeerectionpantiesvoice over narrationlickingcryingunderwearfoodmirrorurinationdrinkthongbeertearsmarijuanapianoprayermale pubic hairbracaliforniavideo camerastabbingstabbed in the chestwhite pantieschild abusebathcontroversygraveyardgravereadingcrossteenage sexpot smokingcaketape recordertied to a bedcaught having sextennisskateboardwatching televisionrear entry sexticklingmobile phonestabbed in the throatunfaithful wifesex talkwedding dressabusive fatherfamily dinnerunsimulated sextrophyphoto albumadulterous wifeteenage pregnancyporn magazinebongmale explicit nudityweightliftinghot dogmale rapeteenage sexualityteethunderage sexspitdisillusionmentmagnifying glassteen suicidescrabbleincestuous desirepillow fightskateboardergun held to one's headhot dog standjumping ropehand on crotchteen drinkingdictionarytalking to the deadwatching pornographymarriage ceremonydouble murderbelchwaterbeddentureslava lampskipping ropecrossing oneselfbrushing hairreference to jerry springercircumcised penisautoerotic asphyxiationthree legged dogreport cardsex with girlfriend's motheranomieskateboard parktoenailtitle character not the main characterhand in pantsclipping toenails (See All) |
Teenager Hubert haughtily regards his mother with contempt, and only sees her tacky sweaters and kitsch decorations. In addition to these irritating surface details, there is also his parent's cherished mechanisms of manipulation and guilt. Confused by this love/hate relationship that obsesses him m β¦ore and more each day, Hubert drifts through the mysteries of adolescence - artistic discoveries, illicit experiences, the opening-up to friendship, and ostracism. The turbulent relationship between mother and son unfolds with a compelling combination of savage fury and melting affection. The stunning, semi-autobiographical directing debut of 20-year-old actor Xavier Dolan. (Read More)
Subgenre: | coming of agesemi autobiographical |
Themes: | murderlovefriendshipweddingangerdivorceblackmaildrug usedysfunctional familyguiltpoetrychildhoodinheritancegay love |
Mood: | high school |
Locations: | restaurantschoolbusbicycle |
Characters: | dancerteenage boyfather son relationshipmother son relationshipfriendteacherstudentgay sexreference to godgay kisssingle motherlittle boymotherhomosexuality β¦teacher student relationshipcatholicgay teenagergay relationshipparent child relationshipboyfriend boyfriend relationshipgay student (See All) |
Story: | teen angstobscene finger gesturegay slurundressingface slapbeatingshowerdancingbare chested malemale nudityflashbackcigarette smokingknifechase β¦telephone callcell phoneunderwearfoodmirrorslow motion scenewatching tvcomputerletterpaintingliecafemarijuanareference to jesus christclassroomrivertelephonef wordcookingvideo cameramontageeatingsubwayapologylibrarycoming outfantasy sequencepay phonewritten and directed by cast memberdollmanipulationpursuithatesingle parentchessrunawayclaim in titlepot smokinglgbtlooking at oneself in a mirroroverallsrebellionhome moviereconciliationboxer shortsbackpackkickingrejectiontime lapse photographyschool uniformgay sonboarding schoolmale male kissbriefsbrushing teethphoto albumvideo tapegay bashingvideo storeadolescencedvdvacuum cleaner17 year olddomineering motherschool principal16 year oldgay clubdivorced parentsoverbearing motherinner title cardbipolar disorderwashing dishesreference to bugs bunnyreference to james deanreference to buddhalove hate relationship7 year oldreference to leonardo dicaprioboys' bathroompublic schoolmother son conflictlove hatebegins with a quotemale homosexualityreference to jackson pollockmother slaps sonreference to jean cocteaucontemptreport cardreference to christmasimaginary worldsaint lawrence riverspeed the drugwriting contestthrowing a telephone (See All) |
This urban nightmare chronicles several days in the life of Caine Lawson, following his high-school graduation, as he attempts to escape his violent existence in the projects of Watts, CA.
Subgenre: | teen moviecult filmindependent filmcoming of ageblack comedy |
Themes: | near death experiencemurderdeathlovefriendshiprevengedrugsmoneybetrayalprisonpregnancyfeardrunkennessescapegangster β¦robberyangerpsychopathdeath of fatherbrutalitydeath of motherparanoiahumiliationexecutionhopedyingvengeancepolice brutality (See All) |
Mood: | high schoolgoreneo noirarchive footageaffection |
Locations: | hospitalcarlos angeles californiaurban settingpolice stationgas stationinner city |
Characters: | cousin cousin relationshipteenagerfamily relationshipshusband wife relationshippolicemother son relationshipafrican americanfriendboyfriend girlfriend relationshipbrother brother relationshippolice officerdetectivesingle motherpolice detectivemuslim β¦grandfather grandson relationshipgrandmother grandson relationshippolice chasepolice dog (See All) |
Period: | 1990s1970s |
Story: | gay slurfistfightbeatingbare chested malenumber in titlebloodviolenceflashbackdoggunfightcigarette smokingpartyknifechase β¦three word titlesurprise endingpistolvoice over narrationshootoutshot to deathblood splattermachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facewatching tvarrestgunfightbrawlshootingvomitingheld at gunpointbeersunglassesinterrogationhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chaseorphanflashlightgangcaliforniadeath of frienddrug dealercocaineprisonerhouseno opening creditsanti herochild in perilcontroversyracial slurflash forwarddrug addictorganized crimecharacter repeating someone else's dialoguebeaten to deathproduct placementlightningstreet shootoutshot in the shoulderlong takehigh school studentloss of fatherpremarital sexthreatened with a knifedirectorial debutloss of motherprofanityshot in the armheroinhatesingle parentcrime bossmachismouzicard gamepokerstreetheavy rainslow motiontold in flashbackjail cellroman numeral in titlekicked in the stomachvideotapecovered in bloodparking garagehonorstreet lifehomicidedrug dealingdrug overdosethugswitchbladestealing a carunderage drinkingdual wieldhatredconvenience storeescape attemptblack and white scenebible quoteghettoblood on shirtrainstormbarbecuerelease from prisonjuvenile delinquentethnic slurhustlerdesert eaglemarijuana jointgraduationstorehigh school teachercar drivingpistol whipfemale teacheroverdosekoreanvulgarityurban decaypolice interrogationn wordshot in the handsubmachine gundrive by shootingcarjackingblaxploitationtragic endingshrinefade to blackdreadlockssocial decayattempted robberygangstaslow motion action scenechild swearingchild with a gungangsta griphoodlumlatin americanchop shopdominoesdrive thrudeath of cousinconvenience store robberyurban violencemuslim convertice cream vanblack slangwatts riotschevrolet impala convertible (See All) |
Friendship, love, and coming of age in New York City, summer of 1994. Luke Shapiro has just graduated from high school, sells marijuana, and trades pot for therapy from a psychologist, Dr. Jeffrey Squires. Luke is attracted to a classmate, Stephanie, who's out of his league and Squires' step-daughte β¦r. By July, he's hanging out with Stephanie, taking her on his rounds selling pot out of an ice-cream pushcart. Then things take a turn. In the background, Squires and his wife as well as Luke's parents are having their troubles. (Read More)
Subgenre: | independent filmcoming of ageerotic fantasy |
Themes: | lovefriendshipinfidelitydrugsmoneydrinkingdrunkennessdivorcelonelinessparanoiadepressiondrug usedysfunctional familyunrequited lovefalling in love β¦first love (See All) |
Mood: | high schoolhip hop |
Locations: | new york citybarbeachtrainbicycleelevatorlakerooftopoceansex in shower |
Characters: | dancerteenage boyteenage girlteenagerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanfriendpolice officerpolicemanmusician β¦best friendpsychiatristolder man younger woman relationshipgrandfather grandson relationshipgrandmother grandson relationshipdoctor patient relationshipsuicide by hangingstepfather stepdaughter relationshipolder man younger man relationshipparty girlsuicide by drowningconsidering suicidesuicide by pills (See All) |
Period: | 1990ssummeryear 1994 |
Story: | dancing in the streetobscene finger gesturebookbare buttundressingshowerdancingbare chested malemale rear nuditymale nuditykisssexfemale nuditymasturbationdog β¦guncigarette smokingphotographtitle spoken by characterpartyerectionpistoltelephone callvoice over narrationcryingdreammachine gunmirrorurinationslow motion scenewatching tvdrinkcondomarrestvomitingbeertearsmarijuanasex standing upbathroomcollegejailvoyeurreference to jesus christguitarmanhattan new york citysubjective cameraswimmingnewspapercandledrug dealermontagecocainesuicide attempttoiletsubwayunderwater scenecoffeebartenderparkprologuefantasy sequencepay phonemassagereadingpremarital sexcharacter says i love youhandgungraffititherapyfreeze framesexual fantasypot smokingloss of virginitylistening to musicice creamjail cellexerciseguitaristdrug abusetherapisteccentricphone boothswimsuitvirginitystreet lifepillsnew jerseyattempted suicidehypocrisyunderage drinkingbackpackpet dogheadphonescigarette lightercard playingnintendoraised middle fingertuxedobrushing teethmarital problemworld trade center manhattan new york cityferrymidlife crisisfast motion scenemale virginimpotencenarrated by charactersandwichbongshortscentral park manhattan new york cityevictionmen's bathroomsnorting cocainejukeboxstonermasseusedrug dealmaking outtape recordingunconsciousnessstonedpopularitybeach housecdplaying a video gamereindeeraudio cassettealtered version of studio logopsychoanalysisbroken heartaerobicshomeless personpsychotherapyheatpremature ejaculationhigh school graduationboom boxcrossword puzzlewife leaves husbandbailgeneration xcassette tapehidden moneyillegal drugspagerwriting on a wallempire state building manhattan new york cityreference to bob dylansweatingsocial outcastshared showerwatching pornographygame boycheating on wifemagic mushroompeepholesummer jobprescription drugsbeeperwanting a divorceattempted drowningreference to kurt cobaingraduation partyrotterdam netherlandswater ballooneye dropsforeign exchange studentterrierbongo drumdog urinationoutdoor showerritalincrying during sexeuphoriahigh school yearbookscratching facereference to goldilocks and the three bearsgraduation cap and gownreference to pearl jamworkout video40 ozmagic markerwest highland white terrierflushing drugs down a toiletpush cartcigarette behind earpracticing a line of conversationreference to rudy giulianialcohol in brown paper bagapartment evictionice cream cartblowing smoke ringscharacter lies about agefalling out of lovereference to boyz ii men (See All) |
A rookie firefighter tries to earn the respect of his older brother and other firefighters while taking part in an investigation of a string of arson/murders. This detailed look into the duties and private lives of firemen naturally features widespread pyrotechnics and special effects.
Subgenre: | cult filmindependent filmmelodrama |
Themes: | deathfuneralinvestigationcorruptionpsychopath |
Mood: | night |
Locations: | barofficechicago illinoisusafire truckfire station |
Characters: | family relationshipsbrother brother relationship |
Period: | 1990s1970s |
Story: | male in showerblockbusterobscene finger gesturehairy chestbare buttfistfightshowerbare chested malemale rear nuditymale nuditynudityone word titlesex scenecigarette smoking β¦title spoken by characterexplosionsurprise endingfirerescuepunched in the facebrawlmale pubic hairriveralcoholtelephonef wordaxeambulancepantyhosedangeractor shares first name with characterdeath of brotherloss of fatherdie hard scenariokissing while having sexarsonmachismofemale stockinged legscaptainwarehousebeer drinkinghelmetpsychocamera shot of feetlieutenantloss of brothermannequinmain character diesfirefighterfemale stockinged feetfiremanirish americantelling someone to shut upstrong languageburnt bodybmwreference to john waynelifting person in airrookiecigarfemale photographerfirefightingfire hoseinfernopyromaniacburn injuryd box motion codepyromaniawhite pantyhosepost it notearson investigator (See All) |
Shakespeare's classic tale of romance and tragedy. Two families of Verona, the Montagues and the Capulets, have been feuding with each other for years. Young Romeo Montague goes out with his friends to make trouble at a party the Capulets are hosting, but while there he spies the Capulet's daughter β¦Juliet, and falls hopelessly in love with her. She returns his affections, but they both know that their families will never allow them to follow their hearts. (Read More)
Subgenre: | cult filmtragedy |
Themes: | murderdeathlovefriendshiprevengesuicidemarriagedysfunctional family |
Characters: | cousin cousin relationshipteenage boyteenage girlfather daughter relationshipfamily relationshipsfather son relationshipmother son relationshipmother daughter relationship |
Story: | teen angstpassionmale rear nuditymale nuditycharacter name in titlebased on playswordbrawlsword fightdeath of frienddisarming someoneduelpoisonopening action sceneloss of virginity β¦buttocksfaked deathforbidden lovefeudexileyoung lovebalconysword dueldaggermain character diesswordsmanadolescencepoisoningteenage sexualitystreet fightobsessive lovepotionstar crossed loversfamous scoretragic loveteen suicidefamily feudsecret lovebanishmentnobilityshakespeare's romeo and julietstory continued during end creditslying in bedclergyshakespeare playbrief female frontal nuditydoomed loverapierends with funeralnursemaidsecret from familypressure from fatherverona italybreasts covered by hair (See All) |