Please wait - finding best movies...
When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa β¦rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)
Subgenre: | puppet animationstop motion animation |
Themes: | griefmonsterfeardeath |
Mood: | rain |
Locations: | sewerbaseballpolice carbicyclesmall towncemeteryswimming pool |
Characters: | mayorlittle boylittle girlbabystudentteacherhusband wife relationshipfather son relationshipmother son relationship |
Story: | science fairbaseball batscience experimentscience teacherfrankenstein spoofback to lifegrave robbingbaseball pitcherbaseball glovebaseball fieldbaseball gamescience projectbaby strollerpet catpet cemetery β¦giant monsterdeath of a petelectric kissfrench poodlesurgical stitchesvacuum cleaningmanhole coverboltnerd boyremake by original directorschoolhousehorror for childrenauditoriumscreenumpireclotheslinespeakerdog moviebanneromenmovie projectorloftphonograph recordcadaverniece3 dexhumationfairgroundreanimationangry mobarm slinghunchbackslimemovie camerafairpigtailsroller skatesanguishgravestonebased on short filmwindmillbackyardfrankensteinkiteblackboardelementary schoolbellgoldfishpopcornfencegatenotebookelectricityenergytombfiremanbatposterunclechainpet dogturtleaquarium3 dimensionalshovelthunderfull moonpromisetorchcarnivalhome movieaudiencefrogphone boothlosswatching a movielifespiderballoonapplauseexperimentrecord playernewspaper headlinestageratspeechscreamlightningdollumbrellasuburbmicrophonegravesearchcreaturehit by a cardrawingcoffinambulancecandleflashlightscienceclassroomneighborrunningtearssecretcatwatching tvrescuecorpsecryingfiresingingexplosionphotographone word titledog (See All) |
A young neurosurgeon (Gene Wilder) inherits the castle of his grandfather, the famous Dr. Victor von Frankenstein. In the castle he finds a funny hunchback called Igor, a pretty lab assistant named Inga and the old housekeeper, frau Blucher -iiiiihhh!-. Young Frankenstein believes that the work of h β¦is grandfather is only crap, but when he discovers the book where the mad doctor described his reanimation experiment, he suddenly changes his mind... (Read More)
Themes: | monster |
Locations: | cemetery |
Characters: | little girlstudenthusband wife relationship |
Story: | frankenstein spoofgrave robbingphonograph recordreanimationhunchbackfrankensteinkiteblackboardfull moontorchexperimentstageratlightninggrave β¦creaturecoffincandleclassroomcorpsesinging (See All) |
1972. Vada Sultenfuss (played by Anna Chlumsky) is an intelligent, bubbly, hypochondriacal 11-year old girl. Her father, Harry (Dan Aykroyd), is a mortician and a widower. Her best friend is Thomas J Sennett (Macaulay Culkin). Then her father hires a new receptionist, Shelly (Jamie Lee Curtis), and β¦life will never be the same again. (Read More)
Themes: | grieffeardeath |
Locations: | bicyclesmall town |
Characters: | little boylittle girlstudentteacher |
Story: | phonograph recordcadaverfairgroundblackboardgoldfishunclecarnivallosslifeapplauserecord playerscreammicrophonecoffinclassroom β¦neighbortearswatching tvcorpsecryingsingingphotograph (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r β¦eason too. (Read More)
Themes: | griefdeath |
Locations: | cemetery |
Characters: | little boylittle girlhusband wife relationshipfather son relationshipmother son relationship |
Story: | grave robbingpet catpet cemeteryanguishkitepet dogshovelpromisegravecoffinflashlightneighbortearssecretcat β¦watching tvrescuecorpsefireexplosionphotographdog (See All) |
When Coraline moves to an old house, she feels bored and neglected by her parents. She finds a hidden door with a bricked up passage. During the night, she crosses the passage and finds a parallel world where everybody has buttons instead of eyes, with caring parents and all her dreams coming true. β¦When the Other Mother invites Coraline to stay in her world forever, the girl refuses and finds that the alternate reality where she is trapped is only a trick to lure her. (Read More)
Subgenre: | puppet animationstop motion animation |
Themes: | monsterfear |
Mood: | rain |
Locations: | bicycle |
Characters: | little boylittle girlhusband wife relationship |
Story: | pet cathorror for childrenbatpet dog3 dimensionalthunderstageratlightningdollsearchcandleflashlightneighbortears β¦catrescuecryingsingingphotographone word titledog (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
Themes: | fear |
Locations: | police carbicyclesmall town |
Characters: | little boylittle girlbabyhusband wife relationshipmother son relationshipfather son relationship |
Story: | baby strollerpet catpigtailsnotebookaudienceapplausestagespeechscreamsearchdrawingcandlerunningtearscat β¦rescuecryingsinging (See All) |
Loosely based on Homer's "Odyssey," the movie deals with the picaresque adventures of Ulysses Everett McGill and his companions Delmar and Pete in 1930s Mississipi. Sprung from a chain gang and trying to reach Everett's home to recover the buried loot of a bank heist they are confronted by a series β¦of strange characters--among them sirens, a cyclops, bank robber George "Baby Face" Nelson (very annoyed by that nickname), a campaigning governor and his opponent, a KKK lynch mob, and a blind prophet who warns the trio that "the treasure you seek shall not be the treasure you find." (Read More)
Locations: | small town |
Characters: | little boylittle girlbabyhusband wife relationshipfather son relationship |
Story: | auditoriumscreenspeakerphonograph recordposterchainthundertorchaudiencefrogwatching a movieapplausestagescreamlightning β¦microphonegravesearchcoffinsecretrescuecryingfiresingingexplosionphotographdog (See All) |
SPOILER: In the summer of 1979, a group of friends in a small Ohio town witness a catastrophic train crash while making a super 8 movie and soon suspect that it was not an accident. Shortly after, unusual disappearances and inexplicable events begin to take place in town, and the local Deputy tries β¦to uncover the truth - something more terrifying than any of them could have imagined. (Read More)
Themes: | griefmonsterfeardeath |
Locations: | police carbicyclesmall towncemetery |
Characters: | father son relationshipmother son relationship |
Story: | science teachermovie projectormovie cameragravestonefencepet doghome movielosswatching a moviescreamsuburbmicrophonegravecreatureflashlight β¦tearssecretwatching tvrescuecryingfiresingingexplosionphotograph (See All) |
In the end of the Nineteenth Century, in London, Robert Angier, his beloved wife Julia McCullough and Alfred Borden are friends and assistants of a magician. When Julia accidentally dies during a performance, Robert blames Alfred for her death and they become enemies. Both become famous and rival ma β¦gicians, sabotaging the performance of the other on the stage. When Alfred performs a successful trick, Robert becomes obsessed trying to disclose the secret of his competitor with tragic consequences. (Read More)
Themes: | grieffeardeath |
Mood: | rain |
Locations: | small towncemetery |
Characters: | little boylittle girlbabyhusband wife relationship |
Story: | arm slinggatenotebookelectricitypostershovelthundertorchaudiencelossapplausestagelightningcoffincandle β¦secretcatcorpsefirephotograph (See All) |
Hugo is an orphan boy living in the walls of a train station in 1930s Paris. He learned to fix clocks and other gadgets from his father and uncle which he puts to use keeping the train station clocks running. The only thing that he has left that connects him to his dead father is an automaton (mecha β¦nical man) that doesn't work without a special key. Hugo needs to find the key to unlock the secret he believes it contains. On his adventures, he meets George Melies, a shopkeeper, who works in the train station, and his adventure-seeking god-daughter. Hugo finds that they have a surprising connection to his father and the automaton, and he discovers it unlocks some memories the old man has buried inside regarding his past. (Read More)
Themes: | death |
Locations: | cemetery |
Characters: | little boylittle girlhusband wife relationshipfather son relationshipmother son relationship |
Story: | screenmovie projector3 dmovie cameranotebookposterunclepet dog3 dimensionalaudiencewatching a movieapplausestagescreamgrave β¦searchdrawingrunningtearssecretcatrescuecorpsecryingfireexplosionphotographone word titledog (See All) |
When his partner is killed by the mysterious and possibly nonexistent Jaguar Shark, Steve Zissou and his Team Zissou crew set off for an expedition to hunt down the creature. Along with his estranged wife, a beautiful journalist and a co-pilot who could possibly be Zissou's son, the crew set off for β¦ one wild expedition. (Read More)
Themes: | death |
Mood: | rain |
Locations: | swimming pool |
Characters: | little boybabyfather son relationship |
Story: | pet catmovie camerapet dogturtleaudiencewatching a movielifeapplausestagemicrophonegravecreaturecoffinflashlightwatching tv β¦rescuecorpsecryingsingingexplosionphotograph (See All) |
A large spider from the jungles of South America is accidently transported in a crate with a dead body to America where it mates with a local spider. Soon after, the residents of a small California town disappear as the result of spider bites from the deadly spider offspring. It's up to a couple of β¦doctors with the help of an insect exterminator to annihilate these eight legged freaks before they take over the entire town. (Read More)
Themes: | feardeath |
Locations: | police carsmall towncemetery |
Characters: | little boylittle girlhusband wife relationshipfather son relationshipmother son relationship |
Story: | pet catphonograph recordexhumationpopcornspiderrecord playercoffinneighborcatcorpsefireone word titledog |
In Bedridge, Professor Parker Wilson finds an abandoned dog at the train station and takes it home with the intention of returning the animal to its owner. He finds that the dog is an Akita and names it Hachiko. However, nobody claims the dog so his family decides to keep Hachi.
Themes: | death |
Mood: | rain |
Locations: | cemetery |
Characters: | babystudentteacherhusband wife relationship |
Story: | french poodledog moviegravestonebellpopcornfenceposterapplausesuburbcoffinclassroomtearscatwatching tvcrying β¦dog (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
Themes: | feardeath |
Mood: | rain |
Locations: | cemetery |
Characters: | little boylittle girlbaby |
Story: | phonograph recordpigtailsgatethundertorchrecord playerstagelightningumbrellacandleflashlightsecretphotograph |
Zahra's shoes are gone; her older brother Ali lost them. They are poor, there are no shoes for Zahra until they come up with an idea: they will share one pair of shoes, Ali's. School awaits. Will the plan succeed?
Mood: | rain |
Locations: | bicycle |
Characters: | little boylittle girlbabystudenthusband wife relationshipmother son relationshipfather son relationship |
Story: | blackboardgoldfishpromiselightningsearchclassroomneighborrunningtearssecretwatching tvcryingdog |
The teenager Sarah is forced by her father and her stepmother to babysit her baby brother Toby while they are outside home. Toby does not stop crying and Sarah wishes that her brother be taken by the Goblin King. Out of the blue, Toby stops crying and when Sarah looks for him in the cradle, she lear β¦ns that he wish was granted and the Goblin King Jarethhas taken him to his castle in the Goblin City in the middle of a labyrinth. Sarah repents an asks Jareth to give Toby back; but the Goblin King tells that she has to rescue her brother before midnight, otherwise Toby will be turned into a goblin. Soon Sarah teams up with the coward goblin Hoggle, the beast Ludo and the knight Didymus and his dog Ambrosius in her journey. Will they rescue Toby in time? (Read More)
Themes: | monsterfear |
Mood: | rain |
Characters: | baby |
Story: | bellgatepet dogthunderfull moontorchlightningsearchcreaturecandlerunningtearscatrescuecrying β¦firesingingphotographone word titledog (See All) |
Walter Goodfellow, the vicar for the small English country parish of Little Wallop, has allowed his marriage to Gloria go stale, and he is so detached from his family that he has not taken notice that his 17-year-old daughter Holly is going through a succession of relationships with unsuitable boyfr β¦iends, and his son Petey fears going to school owing to being bullied. Out of desperation for affection, Gloria begins to fall for the advances of Lance, an American golf pro who is giving her "private" lessons. The problems upsetting the family start to fade away after Grace Hawkins, the new housekeeper, arrives and starts tending to matters as an older, and rather darkly mysterious version of Mary Poppins. (Read More)
Themes: | death |
Mood: | rain |
Locations: | bicyclesmall town |
Characters: | little boylittle girlhusband wife relationshipfather son relationshipmother son relationship |
Story: | speakerposterpet dogshovelthunderaudienceapplausestagespeechlightningmicrophoneneighbortearswatching tvcorpse β¦cryingphotographdog (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Themes: | feardeath |
Mood: | rain |
Locations: | sewerbicycleswimming pool |
Characters: | little girlteacher |
Story: | phonograph recordpopcornbatpet dogturtlethunderfroglifenewspaper headlineratscreamlightningdollumbrellasearch β¦drawingrunningtearscatrescuecryingfiredog (See All) |
In a 1950's mining town called Coalwood, Homer Hickam is a kid with only one future in sight, to work in the local coal mine like his father. However in October 1957, everything changes when the first artificial satellite, Sputnik goes into orbit. With that event, Homer becomes inspired to learn how β¦ to build rockets. With his friends and the local nerd, Homer sets to do just that by trial and a lot of error. Unfortunately, most of the town and especially Homer's father thinks that they are wasting their time. Only one teacher in the high school understands their efforts and lets them know that they could become contenders in the national science fair with college scholarships being the prize. Now the gang must learn to perfect their craft and overcome the many problems facing them as they shoot for the stars. (Read More)
Themes: | death |
Mood: | rain |
Locations: | small town |
Characters: | studentteachermother son relationshipfather son relationship |
Story: | science fairfairfencehome movierecord playerscienceclassroomtearswatching tvcryingfireexplosion |
In a futuristic Japan, an outbreak of canine influenza spreads throughout the (fictitious) city of Megasaki with the risk of becoming contagious to humans. The city's authoritarian mayor, Kenji Kobayashi, ratifies an official decree banishing all dogs to Trash Island, which is immediately approved d β¦espite the insistence of Professor Watanabe, the mayor's political opponent who states he is close to creating a cure for the dog flu. The first canine deported from the city is a white and black-spotted dog named Spots Kobayashi, who served as the bodyguard dog of 12-year-old orphan Atari Kobayashi, the mayor's distant nephew and ward.
Six months later, Atari hijacks a plane and flies it to Trash Island (now nicknamed "Isle of Dogs") to search for Spots. After crash-landing, Atari is rescued by a dog pack led by an all-black canine named Chief, a lifelong stray. With their help Atari first finds a locked cage that presumably contains Spots' skeleton, but learns that it is not him. They then fend off a rescue team sent by Mayor Kobayashi to retrieve Atari. Atari decides to continue his search for Spots, and the pack decides to help him, but Chief declines because of his refusal to have a human "master". He is then convinced by Nutmeg, a female ex-show dog, to help the boy out of obligation. The pack seeks advice from sage-like dogs Jupiter and Oracle, who surmise that Spots might be held captive by an isolated tribe of dogs rumored to be cannibals.
Meanwhile, Watanabe finally⦠(Read More)
Subgenre: | stop motion animation |
Themes: | fear |
Mood: | rain |
Locations: | cemetery |
Characters: | mayorstudent |
Story: | dog movieblackboardgatepostertorchapplausenewspaper headlinestageratspeechlightningsearchdrawingcoffinflashlight β¦scienceclassroomcatrescuecryingfireexplosionphotographdog (See All) |
When 'Walt Disney' (qv)'s daughters begged him to make a movie of their favorite book, 'P.L. Travers' (qv)' _Mary Poppins (1964)_ (qv), he made them a promise - one that he didn't realize would take 20 years to keep. In his quest to obtain the rights, Walt comes up against a curmudgeonly, uncompromi β¦sing writer who has absolutely no intention of letting her beloved magical nanny get mauled by the Hollywood machine. But, as the books stop selling and money grows short, Travers reluctantly agrees to go to Los Angeles to hear Disney's plans for the adaptation. For those two short weeks in 1961, Walt Disney pulls out all the stops. Armed with imaginative storyboards and chirpy songs from the talented Sherman brothers, Walt launches an all-out onslaught on P.L. Travers, but the prickly author doesn't budge. He soon begins to watch helplessly as Travers becomes increasingly immovable and the rights begin to move further away from his grasp. It is only when he reaches into his own childhood that Walt discovers the truth about the ghosts that haunt her, and together they set Mary Poppins free to ultimately make one of the most endearing films in cinematic history. (Read More)
Themes: | death |
Locations: | swimming pool |
Characters: | little girlbabyhusband wife relationship |
Story: | screenclotheslinespeakerfairgroundgatepet dogpromiseaudienceapplausestagespeechmicrophonedrawingrunningtears β¦watching tvcorpsecryingsingingphotograph (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
Themes: | monsterfeardeath |
Locations: | police carbicyclesmall town |
Characters: | little boyhusband wife relationshipmother son relationshipfather son relationship |
Story: | baseball batphone boothlightningcreatureflashlightcatwatching tvrescuecorpsefireexplosionphotographone word title |
During WWII in England, Charlie, Carrie, and Paul Rawlins are sent to live with Eglantine Price, an apprentice witch. Charlie blackmails Miss Price that if he is to keep her practices a secret, she must give him something, so she takes a bedknob from her late father's bed and places the "famous magi β¦c traveling spell" on it, and only Paul can activate it. Their first journey is to a street in London where they meet Emelius Browne, headmaster of Miss Price's witchcraft training correspondence school. Miss Price tells him of a plan to find the magic words for a spell known as Substitutiary Locomotion, which brings inanimate objects to life. This spell will be her work for the war effort. (Read More)
Themes: | feardeath |
Locations: | bicyclesmall town |
Characters: | little boylittle girl |
Story: | pet catpigtailsbellnotebookposterfull moonaudiencelifeapplausescreamcandleflashlightrunningsecretcrying β¦firesingingexplosion (See All) |
59 year old Ove is the block's grumpy man who several years earlier was deposed as president of the condominium association, but he could not give a damn about being deposed and therefore keeps looking over the neighborhood with an iron fist. When pregnant Parvaneh and her family moves into the terr β¦aced house opposite and accidentally backs into Ove's mailbox it turns out to be an unexpected friendship. A drama comedy about unexpected friendship, love and the importance of surrounding yourself with the proper tools. (Read More)
Themes: | griefdeath |
Mood: | rain |
Locations: | bicyclecemeteryswimming pool |
Characters: | little girlbabyteacherhusband wife relationshipmother son relationshipfather son relationship |
Story: | shovelpromiseapplausegravecoffinambulancecandleneighborrunningcatrescuecryingfirephotographdog |
Rachel Phelps is the new owner of the Cleveland Indians baseball team. However, her plans for the team are rather nefarious. She wants to move the team to Miami for the warmer climate and a new stadium. To justify the move, the team has to lose, and lose badly. So she assembles the worst possible te β¦am she can. Among these are a past-his-prime catcher with bad knees, a shrewd but past-his-prime pitcher, a young tearaway pitcher (and felon) with a 100 mph fastball but absolutely no control, a third baseman who is too wealthy and precious to dive, a voodoo-loving slugger who can't hit a curve ball and an energetic-but-naive lead off hitter and base-stealer who can't keep the ball on the ground. Against the odds, and after the inevitable initial failures, they iron out some of their faults and start to win, much to Ms Phelps' consternation. (Read More)
Locations: | baseball |
Story: | baseball batbaseball glovebaseball fieldbaseball gameumpirepet dogthunderaudienceapplausenewspaper headlinelightningmicrophoneflashlightwatching tvsinging β¦explosionphotograph (See All) |
Ray Ferrier (Cruise) is a divorced dockworker and less-than-perfect father. When his ex-wife and her new husband drop off his teenage son Robbie and young daughter Rachel for a rare weekend visit, a strange and powerful lightning storm suddenly touches down. What follows is the extraordinary battle β¦for the future of humankind through the eyes of one American family fighting to survive it in this contemporary retelling of H.G. Wells seminal classic sci-fi thriller. (Read More)
Themes: | monsterfeardeath |
Mood: | rain |
Locations: | baseballbicycle |
Characters: | little girlfather son relationshipmother son relationship |
Story: | electricityshovelratlightningcreatureflashlighttearswatching tvrescuecorpsecryingfiresingingexplosionphotograph |
When the Vatican observatory priest sees the appearance of a comet, the Church is sure that it confirms the eve of the Armageddon. Meanwhile, the USA President's godson Robert Thorn is informed in the maternity in Rome by Father Spiletto that his wife Katherine has just lost her baby and she had tro β¦ubles with her uterus and would not have another pregnancy. Spiletto suggests Robert that another just born child that lost his mother could be the substituted for his son, and Robert accepts the child and gives the name of Damien. Robert is promoted to ambassador in London after a tragic accident. When Damien's nanny commits suicide in his birthday party, a substitute, Mrs. Baylock, comes to work and live with the family. Along the years, Katherine realizes that Damien is evil, while Robert is contacted by Father Brennan, who tells him that Damien is the son of devil. When the priest dies in a bizarre accident, the photographer Keith Jennings shows evidences to Robert that the boy is the Antichrist. They travel to the town of Megiddo to learn how the boy can be stopped. (Read More)
Themes: | feardeath |
Mood: | rain |
Locations: | cemetery |
Characters: | babyhusband wife relationshipfather son relationshipmother son relationship |
Story: | manhole coveromenexhumationtombfull moonballoonnewspaper headlinescreamlightninggravehit by a carcandlesecretcorpsefire β¦explosionphotographdog (See All) |
Jesse Aarons trained all summer to become the fastest runner in school, so he's very upset when newcomer Leslie Burke outruns him and everyone else. Despite this and other differences, including that she's rich, he's poor, and she's a city girl, he's a country boy, the two become fast friends. Toget β¦her, they create Terabithia, a land of monsters, trolls, ogres, and giants and rule as king and queen. This friendship helps Jess deal with the tragedy that makes him realize what Leslie taught him. (Read More)
Themes: | griefdeath |
Locations: | police car |
Characters: | little boylittle girlstudentteacherhusband wife relationshipfather son relationshipmother son relationship |
Story: | anguishblackboardpet dogdolldrawingclassroomrunningtearswatching tvsingingphotographdog |
The story of Seita and Satsuko, two young Japanese siblings, living in the declining days of World War II. When an American firebombing separates the two children from their parents, the two siblings must rely completely on one another while they struggle to fight for their survival.
Themes: | feardeath |
Mood: | rain |
Locations: | bicyclecemetery |
Characters: | father son relationshipmother son relationship |
Story: | elementary schooltorchfrogrecord playerdollumbrellagraveneighborrunningtearscatcorpsecryingfiresinging β¦explosionphotograph (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Themes: | feardeath |
Locations: | police carcemetery |
Story: | baseball batphone boothspidernewspaper headlineratlightningdollumbrellahit by a cardrawingcoffinflashlightwatching tvrescuecorpse β¦cryingfirephotograph (See All) |
GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)
Themes: | death |
Locations: | sewerbicyclecemeteryswimming pool |
Characters: | little boymother son relationship |
Story: | speakeraudiencephone boothwatching a movienewspaper headlineratgravedrawingcoffincandleflashlightrunningtearssecretcat β¦corpsecryingsingingphotographdog (See All) |
Dr. Frankenstein and his monster both turn out to be alive, not killed as previously believed. Dr. Frankenstein wants to get out of the evil experiment business, but when a mad scientist, Dr. Pretorius, kidnaps his wife, Dr. Frankenstein agrees to help him create a new creature, a woman, to be the c β¦ompanion of the monster. (Read More)
Themes: | monster |
Locations: | cemetery |
Characters: | husband wife relationship |
Story: | reanimationangry mobwindmillfrankensteinkiteexperimentlightningcreaturefireexplosion |
Three grown prodigies, all with a unique genius of some kind, and their mother are staying at the family household. Their father, Royal had left them long ago, and comes back to make things right with his family.
Themes: | griefdeath |
Locations: | police carcemeteryswimming pool |
Characters: | little girlhusband wife relationshipfather son relationshipmother son relationship |
Story: | phonograph recordfiremanpet dogrecord playerratgravecoffinambulancewatching tvphotographdog |
The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit β¦e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)
Themes: | griefmonsterfeardeath |
Mood: | rain |
Locations: | sewerpolice car |
Characters: | little boylittle girlfather son relationship |
Story: | giant monsterlifesearchcreatureambulanceflashlighttearswatching tvrescuecryingfireexplosionphotographone word title |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing β¦ voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
Themes: | feardeath |
Mood: | rain |
Locations: | cemeteryswimming pool |
Characters: | studentteacherhusband wife relationshipfather son relationship |
Story: | pet catfencepet dogratgravecandleneighbortearssecretcatwatching tvcryingphotographdog |
Tracy Turnblad, a teenager with all the right moves, is obsessed with the Corny Collins Show. Every day after school, she and her best friend Penny run home to watch the show and drool over the hot Link Larkin, much to Tracy's mother Edna's dismay. After one of the stars of the show leaves, Corny Co β¦llins holds auditions to see who will be the next person on the Corny Collins show. With all of the help of her friend Seaweed, Tracy makes it on the show, angering the evil dance queen Amber Von Tussle and her mother Velma. Tracy then decides that it's not fair that the black kids can only dance on the Corny Collins Show once a month, and with the help of Seaweed, Link, Penny, Motormouth Maybelle, her father and Edna, she's going to integrate the show.....without denting her 'do! (Read More)
Locations: | police car |
Characters: | studentteacherhusband wife relationshipmother son relationship |
Story: | phonograph recordfairblackboardapplauserecord playernewspaper headlineratmicrophoneflashlightclassroomrunningtearswatching tvcryingsinging β¦photographone word title (See All) |
It hasn't even been a year since a plantation owner named Louis lost his wife in childbirth. Both his wife and the infant died, and now he has lost his will to live. A vampire named Lestat takes a liking to Louis and offers him the chance to become a creature of the night: a vampire. Louis accepts, β¦and Lestat drains Louis' mortal blood and then replaces it with his own, turning Louis into a vampire. Louis must learn from Lestat the ways of the vampire. (Read More)
Themes: | feardeath |
Mood: | rain |
Locations: | police carcemetery |
Characters: | little girl |
Story: | torchaudiencewatching a movieratdollcreaturecoffincandlerunningrescuecorpsecryingfiresinging |
A master chef, Kate, lives her life like she runs the kitchen at upscale 22 Bleecker Restaurant in Manhattan--with a no-nonsense intensity that both captivates and intimidates everyone around her. With breathtaking precision, she powers through each hectic shift, coordinating hundreds of meals, prep β¦aring delicate sauces, seasoning and simmering each dish to absolute perfection. (Read More)
Themes: | griefdeath |
Mood: | rain |
Locations: | cemetery |
Characters: | student |
Story: | home movielifedollgravesearchcandleneighbortearswatching tvcryingfiresingingphotograph |
Having bought a model ship, the Unicorn, for a pound off a market stall Tintin is initially puzzled that the sinister Mr. Sakharine should be so eager to buy it from him, resorting to murder and kidnapping Tintin - accompanied by his marvellous dog Snowy - to join him and his gang as they sail to Mo β¦rocco on an old cargo ship. Sakharine has bribed the crew to revolt against the ship's master, drunken Captain Haddock, but Tintin, Snowy and Haddock escape, arriving in Morocco at the court of a sheikh, who also has a model of the Unicorn. Haddock tells Tintin that over three hundred years earlier his ancestor Sir Francis Haddock was forced to scuttle the original Unicorn when attacked by a piratical forebear of Sakharine but he managed to save his treasure and provide clues to its location in three separate scrolls, all of which were secreted in models of the Unicorn. Tintin and Sakharine have one each and the villain intends to use the glass-shattering top Cs of operatic soprano the Milanese Nightingale to secure the third. With aid from bumbling Interpol agents the Thompson Twins our boy hero, his dog and the captain must prevent Sakharine from obtaining all three scrolls to fulfil the prophesy that only the last of the Haddocks can discover the treasure's whereabouts. (Read More)
Locations: | police carbicycle |
Story: | clotheslinebannergatepet dogaquarium3 dimensionalthundertorchaudienceapplausenewspaper headlineratlightningflashlightrunning β¦secretcatfiresingingexplosiondog (See All) |
Andrew Largeman is a semi-successful television actor who plays a intellectually disabled quarterback. His somewhat controlling and psychiatrist father has led Andrew ("Large") to believe that his mother's wheelchair bound life was his fault. Andrew decides to lay off the drugs that his father and h β¦is doctor made him believe that he needed, and began to see life for what it is. He began to feel the pain he had longed for, and began to have a genuine relationship with a girl who had some problems of her own. (Read More)
Mood: | rain |
Locations: | police carcemeteryswimming pool |
Characters: | babystudenthusband wife relationshipfather son relationshipmother son relationship |
Story: | pet catpet cemeterydeath of a petphonograph recordanguishhome moviephone boothliferecord playersuburbcoffinwatching tvcryingsingingdog |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Themes: | death |
Mood: | rain |
Locations: | small towncemetery |
Characters: | husband wife relationshipfather son relationshipmother son relationship |
Story: | baseball batfencechainlightninggravesearchcandlesecretwatching tvcorpsefireexplosionphotographdog |
Dawn grows up in the shadow of a nuclear power plant. In high school, while her biology class studies evolution, she realizes she may have a hidden curse, an "adaptation." She lives with her mom, step-father, and hard-edged step-brother. She likes Tobey, a guy at school, and he likes her. She takes β¦a pledge to remain chaste until marriage, so they date in groups, watch G-rated films, and don't kiss, but the power of teen hormones is great, so temptation beckons. Dawn has an admirer in Ryan, and when when things have an unexpected twist with Tobey, she turns to Ryan for help. Will he be her mythical hero and rescue her? Or can she find her way as her own hero, turning the curse into an asset? (Read More)
Themes: | death |
Mood: | rain |
Locations: | police carbicycle |
Characters: | studentteacherhusband wife relationshipfather son relationship |
Story: | turtlepromisewatching a moviespeechlightningmicrophonesearchdrawingcandleflashlightclassroomwatching tvrescuecorpsedog |
Scotty Smalls moves to a new neighborhood with his mom and stepdad, and wants to learn to play baseball. Rodriguez, the neighborhood baseball guru, takes Smalls under his wing - soon he becomes part of the local baseball buddies. They fall into adventures involving baseball, treehouse sleep-ins, the β¦ desirous lifeguard at the local pool, the snooty rival ball team, and the travelling fair. Beyond the fence at the back of the sandlot menaces a legendary ball-eating dog called The Beast, and the kids inevitably must deal with him. (Read More)
Locations: | baseballswimming pool |
Story: | baseball glovebaseball fieldbaseball gamefairfencecarnivalcandleexplosiondog |
Henry Frankenstein is a doctor who is trying to discover a way to make the dead walk. He succeeds and creates a monster that has to deal with living again.
Themes: | monster |
Locations: | cemetery |
Story: | grave robbingreanimationhunchbackwindmillfrankensteinelectricitytorchlightningfireone word title |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
Themes: | death |
Characters: | baby |
Story: | phonograph recordposteraudienceapplausestageratscreammicrophonegravesearchcandleflashlightrunningtearscat β¦corpsecryingsingingphotographdog (See All) |
In this comedy, Lars Lindstrom is an awkwardly shy young man in a small northern town who finally brings home the girl of his dreams to his brother and sister-in-law's home. The only problem is that she's not real - she's a sex doll Lars ordered off the Internet. But sex is not what Lars has in mind β¦, but rather a deep, meaningful relationship. His sister-in-law is worried for him, his brother thinks he's nuts, but eventually the entire town goes along with his delusion in support of this sweet natured boy that they've always loved. (Read More)
Themes: | grieffeardeath |
Locations: | small towncemetery |
Characters: | husband wife relationshipfather son relationship |
Story: | phonograph recordgravestonerecord playerdollgraveambulanceflashlightneighborsingingphotograph |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Themes: | grieffeardeath |
Mood: | rain |
Characters: | little boylittle girlhusband wife relationshipmother son relationshipfather son relationship |
Story: | tombthunderlossdollgravesearchdrawingcoffincandlerunningtearssecretrescuecorpsecrying β¦firephotographdog (See All) |
Evan Treborn grows up in a small town with his single, working mother and his friends. He suffers from memory blackouts where he suddenly finds himself somewhere else, confused. Evan's friends and mother hardly believe him, thinking he makes it up just to get out of trouble. As Evan grows up he has β¦fewer of these blackouts until he seems to have recovered. Since the age of seven he has written a diary of his blackout moments so he can remember what happens. One day at college he starts to read one of his old diaries, and suddenly a flashback hits him like a brick! (Read More)
Themes: | death |
Mood: | rain |
Locations: | bicyclesmall towncemetery |
Characters: | babystudentteacherfather son relationshipmother son relationship |
Story: | baseball batnotebookhome moviewatching a moviedolldrawingcoffinambulancetearscryingfireexplosiondog |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Themes: | monsterfeardeath |
Mood: | rain |
Locations: | baseballsmall townswimming pool |
Characters: | little girlstudentteacherhusband wife relationshipmother son relationshipfather son relationship |
Story: | science teacherfull moonapplausenewspaper headlineratscreamlightningcreatureclassroomneighborwatching tvcryingfiredog |
Preacher Graham Hess, played by Mel Gibson, has lost his faith in God after his wife dies in a brutal car accident. He along with his son and daughter and his brother Merrill lives in a farmhouse. Crop circles begin to appear in their corn fields which Graham dismisses as mischief by miscreants. Aft β¦er hearing strange noises and watching news coverage on crop circles appearing all over the world, the family grows suspicious of alien activities. Now they must stick together and believe, as a family to survive the ordeal and find a way to escape. (Read More)
Themes: | grieffear |
Locations: | baseballpolice carsmall town |
Characters: | little boylittle girlfather son relationship |
Story: | baseball batpet dogambulanceflashlightwatching tvphotographone word titledog |