Best popular movies like Friday The 13th: A New Beginning:

Do you need specific genre & keyword selection to find films similar to Friday The 13th: A New Beginning?
<< FIND THEM HERE! >>

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent film
Themes:
police investigationexploitationevilsadisminsanitybrutalitypsychopathfeardeathmurderrevenge
Mood:
darknessslashernightnightmareraingore
Locations:
backwoodsamericawoodssmall towncemetery
Characters:
slasher killerserial murderermysterious villainmysterious killerserial killercountry boyterrorsheriffvillainkillerbrother brother relationshipmother son relationshipteenagerpolice
Period:
1980s
Story:
machete mutilationcopycat killerpsycho terrorpsycho killermale victimpsychotronic filmgrindhouse filmfemale victimserial teen murdererhomicidal maniacgrave robbersmall town sheriffmasked villainserial teen killeraxe in the head β€¦psychopathic killermasked killeraxe murderevil mandark and stormy nightsadistic psychopathattempted child murderlifting a woman into the airspike in the headcrystal lake new jerseywessex county new jerseygory violencetrailer narrated by don lafontainesequel to cult filmvertigo shotfriday the thirteenthpopular musiccopycatjason voorheesgarden shearssource musicimpostereast coastjumpsuitdrive in classicdeath of grandfathercandy barmurder of a nude womanclotheslinehockey maskdate in titlemurder spreereturning character with different actormultiple homicidebloody violencebreakdancingweirdoknife murderstabbed with scissorschopping woodgraphic violenceextreme violencedisturbed individualcrime spreefatbutcherycut into piecesorchestral music scorestabbed in the facelunaticcrushed headmeat cleavereyeballhillbillyserial murdercomic reliefslashingtombstonehuman monstersummer campsequel to cult favoritedefecationmysterious mancar troublelaundrybad guymadmancharacters killed one by onepsychoticfifth partbody countstabbed in the eyeeye gougingslaughterpsychotronicbutcheritalian americannew jerseymental institutionrampageredneckmasked manvictimgrindhousepsychostabbed in the stomachlifting someone into the airbarnmutilationmachetekissing while having sexchainsawmaniacobscene finger gesturedeath of sondeath of brothermurdererstalkingcharacter's point of view camera shotstalkergravechild in perilthroat slittingimpalementmassacreaxesword fightsubjective cameradecapitationnumbered sequellow budget filmdead bodyblood splatterdigit in titlepantiessurprise endingchasedancingfemale frontal nuditynumber in titlefemale nuditybare breastsbloodsexkisssequelviolence (See All)

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror
Themes:
evilsadisminsanitybrutalitypsychopathmurderdeathtorturesupernatural power
Mood:
slashergorebreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerbrother sister relationshipteenage girlteenage boy
Period:
1980s
Story:
machete mutilationpsycho terrorpsycho killergrindhouse filmserial teen murdererhomicidal maniacmasked villainserial teen killerpsychopathic killermasked killerevil mansadistic psychopathgory violencewessex county new jerseycrystal lake new jersey β€¦trailer narrated by don lafontainesequel to cult filmfriday the thirteenthjason voorheeseast coastdrive in classicmurder of a nude womanhockey maskmurder spreebloody violenceknife murdergraphic violenceextreme violencedisturbed individualcrime spreebutcherystabbed in the facelunaticmeat cleaverhillbillyserial murderslashinghuman monstersummer campmysterious mancar troublebad guymadmancharacters killed one by onebody countslaughterbutchernew jerseyredneckrampagemasked mangrindhousepsycholifting someone into the airmutilationmaniacobscene finger gesturemurdererstalkingcharacter's point of view camera shotchild in perilimpalementmassacresubjective cameradecapitationlow budget filmblood splatterpantiessurprise endingfemale frontal nuditynumber in titlefemale nuditybare breastsviolencesequelbloodsexmale nuditymasturbationmale rear nudityfemale rear nuditycorpseunderwearmaskstrangulationstabbed to deathsevered headlooking at the cameraskinny dippingstabbed in the backpremarital sexcabinloss of motherkillingsexual attractionragemorguefourth parttowelback from the deadhit in the crotchstabbed in the neckstabbed in the headdisembowelmentdisfigurementbody landing on a carkilling spreestabbed in the handkillshot in the eyenaked dead womandeformityvillain not really dead clichedeeply disturbed persondisturbinglifting a female into the airruraltorturergiallo esquestabbedboogeymanskull crushinggruesomehead shavingcorkscrewmutilated bodyaxe in the chestknife through the necksadistic killerdeformedtwin actresses for twin sistersnose pushed into brainslaughteredmurder in a shower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmsuspenseb horrorindependent horror
Themes:
exploitationevilinsanitybrutalitypsychopathfearmurderdeath
Mood:
darknessslashergore
Locations:
backwoodswoodswheelchairpolice carlakecampfirerunning through the woodschase in the woods
Characters:
slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerteenagerboyfriend girlfriend relationship
Period:
1980ssummeryear 1984
Story:
machete mutilationpsycho terrorpsycho killerpsychotronic filmgrindhouse filmserial teen murdererhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathcrystal lake new jerseywessex county new jerseytrailer narrated by don lafontaine β€¦sequel to cult filmfriday the thirteenthjason voorheeseast coastdrive in classicmurder of a nude womanmurder spreemultiple homicidebloody violenceknife murderweirdocrime spreebutcheryorchestral music scorelunatichillbillyserial murderslashinghuman monstersummer campmysterious mancar troublebad guymadmancharacters killed one by onepsychoticbody countslaughterpsychotronicbutchernew jerseyrampageredneckmasked manvictimgrindhousepsycholifting someone into the airmutilationmachetekissing while having sexchainsawmaniacobscene finger gesturemurdererstalkingcharacter's point of view camera shotstalkerthroat slittingimpalementmassacresubjective cameradecapitationnumbered sequeldead bodyblood splatterdigit in titlepantiessurprise endingfemale frontal nuditynumber in titlefemale nuditykissviolencebloodsexsequelflashbackfightnipplestelephone callcorpseblondeslow motion scenecatbikinimasksecond partswimmingbrastrangulationjokesevered headcontroversyskinny dippingprologueopening action sceneconvertiblelove interestkillingsplatterchessfireplacespearnipples visible through clothingmass murdergothicragevillainessphone boothbra and pantieshit in the crotchstabbed in the headbetrefrigeratorlens flarekilling spreenude swimmingreturning character killed offfreakskirtsexual violencewetting pantsday in titletow truckparaplegicmultiple murderpitchforksole survivordying during sexvillain not really dead clichecreepkilled during sexmystery killershackdisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticboogeymanhorror movie remadesickolost dogice pickcampfire storygruesomedouble impalementbad jokeatonal music scoreurinating in feartea kettleviolentbrutalgarrottingtoasting marshmallowssymphonic music scorechild psychologyfade to whitesack maskscare involving catkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
psycho thrilleramerican horrorcult filmsupernaturalparanormal phenomenaslasher flickteen horror
Themes:
evilinsanitypsychopathdeathmurderprisonmonstersupernatural powermurder of a police officer
Mood:
darknessslashergorecar chasebreaking the fourth wall
Locations:
americawoodssmall towncemeteryforestboatlake
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpoliceteenagerzombie
Period:
1980s
Story:
machete mutilationpsycho terrorpsycho killerfemale victimserial teen murdererhomicidal maniacmasked villainpsychopathic killermasked killerevil mandark and stormy nightsadistic psychopathgory violencecrystal lake new jerseywessex county new jersey β€¦friday the thirteenthjason voorheeseast coastdrive in classichockey maskmurder spreereturning character with different actorbloody violenceknife murderbutcherycut into piecesstabbed in the faceserial murderslashingsummer campsequel to cult favoritebad guymadmanbody countslaughterbutchernew jerseyrampagemasked manvictimpsycholifting someone into the airmutilationmachetemaniacmurdererstalkingmassacredecapitationnumbered sequelblood splattersurprise endingnumber in titlesequelsexviolencecharacter name in titleflashbackmaskdemonflashlightambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionneck breakingunderwatersevered armdismembermentkillingundeadblood spattersplattermass murdergothicback from the deadshovelstabbed in the headsevered legkilling spreebloodbathbeheadingkillactual animal killedsixth partrecreational vehicleheart ripped outoff screen murdervillain not really dead clicheghoulpaintballhead ripped offreanimationstruck by lightningdead teenagerlifting a female into the airdemonicgrave robbingunderwater fightdouble impalementmutilated bodystabcamaropsycho filmviolentbrutalcomic drunkcut to piecespolice officer crushedstabbing a police officerkilled by machete (See All)

Friday The 13th Part III (1982) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
american horrorcult filmslasher flick
Themes:
exploitationpsychopathdeathmurderrevengeabduction
Mood:
darknessslashergore
Locations:
woodslake
Characters:
slasher killerserial murderermysterious killerserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipteenage girlteenage boylow self esteem
Period:
1980s
Story:
psycho killerpsychotronic filmgrindhouse filmhomicidal maniacmasked villainserial teen killerpsychopathic killermasked killerevil mansadistic psychopathwessex county new jerseycrystal lake new jerseygory violencetrailer narrated by don lafontainesequel to cult film β€¦friday the thirteenthjason voorheeseast coastdrive in classichockey maskdate in titlemurder spreeextreme violencedisturbed individualcrime spreeeyeballhillbillyserial murderslashinghuman monstersequel to cult favoritedefecationcar troublebad guymadmancharacters killed one by onestabbed in the eyeslaughterpsychotronicnew jerseyrampagemasked mangrindhousepsycholifting someone into the airbarnmachetemaniacmurderercharacter's point of view camera shotimpalementaxesubjective cameranumbered sequeldigit in titlenumber in titlebloodsequelsexnudityshowerbikinimaskthird partcabinsevered armdismembermentsplattermass murderrageroman numeral in titlesevered handstupiditystabbed in the throat3 dimensionalconvenience storekilling spreetorso cut in halfsexual violenceshot in the eyehammockfamous scoreknittingpitchforksole survivordeformitybiker gangmass murdererlifting female in airsliced in twopregnant woman murdered3 ddisturbinggiallo esqueyo yoskull crushinggruesomedorkcult favoritebrutalhead crushing3d sequel to 2d filmkilled with machetesack maskpopcorn making (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspenseslasher flickteen moviemurder mysteryteen horror
Themes:
evilsadisminsanitybrutalitypsychopathfearmurderrevengedeathvoyeurismcorruptionhumiliationcrueltytraumamysterious death
Mood:
darknessslashernightgoreblood and gore
Locations:
woodscarmotorcycleboatwaterrural settingpolice carlaketruck
Characters:
slasher killerserial murderermysterious villainserial killerterrorsheriffvillainkillerpoliceteenagerfriendteenage boypolice officerpolicemanartist β€¦mothertruck driver (See All)
Period:
1970s1950ssummer
Story:
machete mutilationpsycho terrorpsycho killergrindhouse filmfemale victimhomicidal maniacserial teen killeraxe in the headpsychopathic killeraxe murderdark and stormy nightsadistic psychopathwessex county new jerseycrystal lake new jerseytrailer narrated by don lafontaine β€¦friday the thirteenthjason voorheeseast coastdrive in classicdate in titlemurder spreemultiple homicidebloody violenceweirdoknife murdergraphic violenceextreme violencecrime spreebutcheryorchestral music scoreserial murderslashinghuman monstersummer campmysterious mancar troublecharacters killed one by onepsychoticbody countslaughterpsychotronicbutchernew jerseyrampagevictimgrindhousepsychostabbed in the stomachmachetekissing while having sexmaniacdeath of sonmurdererstalkingthroat slittingmassacreaxesubjective cameradecapitationlow budget filmdead bodyblood splatterdigit in titlepantiessurprise endingnumber in titlefemale nuditybare breastssexviolencekissmale nuditymale rear nuditybare chested malefemale rear nuditynipplesthree word titlebeatingcorpsefistfightblondeslow motion scenebikinithongbeerrunningmarijuanahallucinationvoyeurguitarbedroombracandleold manstabbingwomanstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionfirst partcabinkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainhathammervillainessswimsuitdead womanfull moonbra and pantieslow budgetstabbed in the throatobesitymercilessnesspower outagemutelostthunderstormbathingdisembowelmentsurpriseatticperversiondead manlens flareroomkilling spreearrowdeath of loved onetank topphysical abuset shirtjoysexual awakeningbeheadingshortsdead animalcanoeadolescencerepressionsexual perversionrestroomfemale psychopathjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanfamous scoreanthropologydisfigured facesexual repressionmenacemurderessmultiple murdergame playingbowboard gamepillowsole survivortraumatic experiencewet clothesgrudgeoff screen murdervillain not really dead clichemurder victimcurtaintroubled teenblond boybitingmystery killersweatermistreatmentfemale serial killerawakeningdead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticmutilated corpsedeath by impalementaxe murdererbad girlcamp counselorcampfire storygruesomeunknown killerbody mutilationatonal music scoremonopoly the board gamepsycho filmknife through the neckcanoeingkilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmparanormal phenomenaslasher flickteen horror
Themes:
evilpsychopathmurderrevengedeathmonstersupernatural powerdrug addictionmurder of a police officer
Mood:
slasherraingorehigh school
Locations:
americawoodsnew york cityboatseacitysewer
Characters:
slasher killerserial murderermysterious villainserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationship
Period:
1980s
Story:
psycho terrorpsycho killerserial teen murdererhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathwessex county new jerseycrystal lake new jerseyfriday the thirteenthjason voorheeseast coastmurder of a nude woman β€¦hockey maskmurder spreeknife murderbutcherylunaticcrushed headserial murdersummer campsequel to cult favoritebad guymadmancharacters killed one by onebody countstabbed in the eyeslaughterbutchernew jerseyrampagemasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotthroat slittingimpalementaxedecapitationnumbered sequelblood splatterpantiesnumber in titlefemale nudityviolencebloodsequelcharacter name in titlebare chested maleexplosionmirrordemonhallucinationguitarmanhattan new york cityflashlightgangnew yorkstrangulationvideo camerastabbingstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionattempted rapeunderwaterundeadhypodermic needleback from the deadmale underwearblack bradead childdisembowelmentbeheadingaccidental shootingstatue of liberty new york citydisembodied headcruise shiptoxic wastedeformitymetrooff screen murdermass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerlifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear gunmutilated bodykilled with a forkhit with a guitarjerseybig applegirl strangling (See All)

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspensesupernaturalparanormal phenomenaslasher flickcanadian horror
Themes:
evilinsanitybrutalitypsychopathfearmurderdeathrevengesuicidekidnappingghosttorturedrunkennessdeath of fathersupernatural power β€¦death of motherabductiontraumafear of water (See All)
Mood:
slashernightmareraingorehigh schoolbreaking the fourth wallblood and gore
Locations:
small towncemeteryforestpolice stationlakeschool nurse
Characters:
slasher killerserial murderermysterious villainserial killerterrorsheriffvillainkillermother son relationshipfather son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombie β€¦little girl (See All)
Period:
2000s
Story:
machete mutilationpsycho terrorpsycho killerpsychotronic filmfemale victimserial teen murdererhomicidal maniacmasked villainserial teen killerpsychopathic killermasked killerevil mansadistic psychopathcrystal lake new jerseygory violence β€¦wessex county new jerseyfriday the thirteenthjason voorheeseast coasthockey maskmurder spreebloody violencegraphic violencebutcheryserial murderslashingsummer campmysterious manbad guymadmancharacters killed one by onebody counteye gougingslaughterpsychotronicbutchernew jerseyrampagemasked manvictimpsycholifting someone into the airmutilationmachetemaniacdeath of brothermurdererstalkingcharacter's point of view camera shotchild in perilimpalementdecapitationblood splattersurprise endingbloodsequelviolencecharacter name in titleflashbackphotographexplosionpartypistolshowerfirevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemonfoot chasestabbingsevered headdream sequenceunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover updeath of childhigh school studentneck breakingpremarital sexcabinsevered armdismembermentkillingundeadsplatterchild murderburned aliveheroinemass murdercomaragesevered handgoatcrushed to deathsevered fingermisunderstandingmedicationmurder of a childalternate realitydemonic possessionkilling spreegeekburned to deathnewspaper clippingtorso cut in halfblood on camera lensbeheadingfinal showdownnecrophiliakilldockohiolockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalclawdeformitybreaking through a doormass murderervillain not really dead clicheghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partmidwestchild killerobituarychild murdererhand through chestdead teenagertorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizerlucid dreamsataniccamp counselorgruesomedouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegermonster versus monsternightmare becomes realityreanimated corpsepsycho filmbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererevil versus evilkilled with machetekiller vs killerdreams vs realitykilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Henry: Portrait Of A Serial Killer (1986) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmindependent horror
Themes:
exploitationevilinsanitybrutalitypsychopathdeathmurderdrugsrapetortureincestmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
slasher killerserial murderermysterious villainserial killerterrorvillainkillerbrother sister relationshipprostitutemurder of a prostitute
Period:
1980s
Story:
psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder of a nude womanmurder spreeknife murderextreme violencedisturbed individualcrime spreebutcherycut into pieces β€¦serial murderslashinghuman monstermysterious manbad guymadmanbody countstabbed in the eyeslaughterpsychotronicbutcherrampagepsychostabbed in the stomachmutilationmaniacstalkingstalkerdecapitationlow budget filmblood splattersurprise endingfemale nuditybare breastsviolencebloodcharacter name in titlenuditygunshot to deathshot in the chestmarijuanacriminalbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhoseattempted rapeneck breakingdismembermentkillingsplatterfemale stockinged legsragerapistlow budgetdark humorperversionmurder of a childabusive fatherkilling spreepervertvillain played by lead actorkillsexual violencenaked dead womanvideo footagematricideoff screen murderchild rapebroken neckexploitation filmcreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
exploitationevilsadisminsanitybrutalitypsychopathfearmurderdeathfriendshipsurrealismkidnappingrapetorturedeath of father β€¦death of motherunrequited lovehome invasiondeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessslashernightnightmaregorecar chaseblood and gore
Locations:
backwoodswoodshospitalforestbathtubrural settingroad tripfrancetruckgas stationsinging in a carback country
Characters:
slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillermother son relationshippolicefamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationship β€¦friendboybrother sister relationshipteenage girlfemale protagoniststudentbest friendfrenchbest friendsdeath of boy (See All)
Story:
psycho killergrindhouse filmfemale victimhomicidal maniacpsychopathic killeraxe murderevil mansadistic psychopathgory violencejumpsuitmurder spreebloody violenceweirdographic violenceextreme violence β€¦disturbed individualcrime spreebutcherycut into piecesstabbed in the faceserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countslaughterbutcherrampageredneckgrindhousepsychostabbed in the stomachmutilationchainsawmaniacdeath of sondeath of brothermurdererstalkingthroat slittingimpalementmassacreaxesubjective cameradecapitationlow budget filmdead bodyblood splattersurprise endingchasefemale frontal nudityfemale nuditybare breastsviolencebloodf ratedflashbackmasturbationdogguncigarette smokingphotographknifelesbian kissshowertelephone calldreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashbathroomneighborvoyeurtelephoneshot in the backsurvivalflashlightbound and gaggedstabbingstabbed in the chesthousesevered headscantily clad femalevanon the rundolldeath of childpursuitdeath of husbandsleepingeuropekillingblood spattersplatterchild murderfireplacekilling an animalmass murderlistening to musicsurvivorsevered handstrangerrape victimfollowing someonerapistfemale killertensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionmurder of a childswingclassmatesexual assaultkilling spreeparrotdead dogbeing followedpervertblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a dogfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanmurder of wifefilling stationmurderesscar radiohiding under a beddeath of familyfeetlesbian subtextbutcher knifevineyardchainsdriving at nightbludgeoningwalkmanexploitation filmstraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagcircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardsickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murderershower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
psycho thrilleramerican horrorcult filmsuspenseslasher flickholiday horror
Themes:
insanitybrutalitypsychopathfearmurderdeathjealousytorturevoyeurismmemoryseductionobsessionparanoiablindnesstrauma β€¦madnessmurder investigationmurder of a police officerpsychological trauma (See All)
Mood:
darknessslashernightgore
Locations:
small townhospitalcarwheelchairpolice carhospital fire
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenagerpoliceboyfriend girlfriend relationshipteenage girlpolice officernursedetectivepoliceman
Period:
1970syear 1978
Story:
psycho terrorpsycho killergrindhouse filmfemale victimserial teen murdererhomicidal maniacsmall town sheriffmasked villainserial teen killerpsychopathic killermasked killersadistic psychopathsequel to cult filmjumpsuitdrive in classic β€¦murder spreemultiple homicidebloody violenceknife murdergraphic violenceextreme violencebutcheryserial murderslashinghuman monstermysterious mancar troublebad guymadmancharacters killed one by onebody countstabbed in the eyeeye gougingslaughterbutcherrampagemasked manvictimgrindhousepsychostabbed in the stomachlifting someone into the airmutilationmaniacmurdererstalkingcharacter's point of view camera shotstalkerthroat slittingsubjective camerablood splatterchasenumber in titlefemale nuditybare breastssequelsexkissbloodviolencenuditymale nuditymale rear nuditytwo word titlefemale rear nuditycigarette smokingnipplesexplosionknifetelephone callfirecryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolvergood versus evilhalloweenflashlightold manstrangulationambulancestabbingstabbed to deathaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisonproduct placementcollege studentscreaminjectionglasseswitnesstrapsplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractioncowboy hatwalkie talkiehammerhidingbuttockscaucasianpoolpsychologistbuttdriving a cardead womantowelback from the deadhomicidepresumed deadcamera shot of feetstabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead mandisfigurementdark pastdead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokeflat tirefemale stockinged feetdead girlconfusionstoreneedlemedical masksurgical maskdark secretbandagelighteralonesuit17 year oldearringnurse uniformdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessflamelighting a cigarettenurse outfitmurder attemptmultiple murderroman numbered sequelbutcher knifeman on firepool of bloodscarenude bathingsilhouettevillain not really dead clichezippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemidwestsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicboogeyman21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmtemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanvulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
psycho thrilleramerican horrortragedyslasher flick
Themes:
police investigationevilsadisminsanitybrutalitypsychopathdeathmurdersuicidekidnappingrapetorturedysfunctional familyhome invasionmurder of a police officer β€¦mysterious death (See All)
Mood:
darknessslashernightgoreblood and gore
Locations:
small townstrip club
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenagerafrican americanboyfriend girlfriend relationshipboyhostagepsychiatrist
Period:
1970s
Story:
psycho terrorpsycho killerfemale victimmasked villainpsychopathic killermasked killerevil mansadistic psychopathgory violencejumpsuitmurder spreemultiple homicidebloody violenceweirdoknife murder β€¦graphic violenceextreme violencecrime spreebutcheryserial murderslashingtombstonehuman monsterbad guymadmancharacters killed one by onepsychoticbody countbutchermental institutionrampagemasked manvictimpsycholifting someone into the airmaniacmurdererstalkingcharacter's point of view camera shotchild in perilthroat slittingimpalementmassacresubjective cameradead bodyblood splatterchasefemale frontal nudityfemale nuditybloodviolencesexmale nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifepistolwoman on topbeatingcorpseremakeshot in the headfalling from heightmasktelevisionstrippershot in the backf wordstrangulationstabbingstabbed to deathstabbed in the chestjokecontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformbaseball bathangingshot in the shoulderpremarital sexloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderrageloss of friendpsychologisthome moviebroken legcrime scenetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childdark pastbroken armduct tapekilling spreepumpkinbloodbathswearinghit with a baseball batpervertmexican americanporn magazinedead animaltrick or treatingabandoned housesexual violenceschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitaldisfigured facemultiple murdermatricidebutcher knifeloss of familydying during sexanimal killingmass murderervillain not really dead clichejack o'lanterndying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmidwestcreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushingsatanicsickocontroversialcarrying a dead bodymurder of a policewomanclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Halloween H20: 20 Years Later (1998) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β€¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmslasher flickteen horror
Themes:
evilinsanitypsychopathdeathmurderdrugsparanoiaabductionalcoholism
Mood:
slashernightmarehigh school
Locations:
small townschoolelevatorkitchentruck
Characters:
slasher killermysterious villainserial killerterrorvillainmother son relationshippoliceteenagerfamily relationshipsboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlnurse β€¦policemansecurity guardalcoholicsecretary (See All)
Period:
1990syear 1998
Story:
psycho terrorpsycho killerfemale victimhomicidal maniacmasked villainserial teen killerpsychopathic killermasked killeraxe murderevil mansadistic psychopathtrailer narrated by don lafontainejumpsuitmurder spreebloody violence β€¦knife murdergraphic violencestabbed in the faceserial murderslashingmysterious mancar troublebad guymadmancharacters killed one by onebody countrampagemasked manvictimpsycholifting someone into the airmaniacstalkingcharacter's point of view camera shotstalkerthroat slittingaxesubjective cameradecapitationdead bodychasenumber in titleviolencesequelbloodknifepistolcar accidentfalling from heightmaskbirthdayneighborhallucinationtelephonegood versus evilhalloweenflashlightwinecandlecaliforniaambulancestabbingdeath of friendstabbed to deathtoiletstabbed in the chestweaponsevered headattempted murderstabbed in the backprologuekeyuniformmistaken identityactor shares first name with characterreunionflowersplatterbreaking and enteringheroinesurvivorrageloss of friendhidingfaked deathtrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingdivorceesecret identitypumpkinnewspaper clippinghockeyreflectionstolen caranniversarybeheadingfire extinguisherreturning character killed offhiding in a closetgatebody baghiding placebutcher knifevillain not really dead clichesittingseventh partmichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalwhite maskhome intruderevil uncleschool counselor (See All)

Halloween (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β€¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmslasher flickteen movieteen horrorholiday horror
Themes:
evilpsychopathfearmurderdeathcorruptionparanoiamurder of family
Mood:
slashernighthigh school
Locations:
small towncarcar theftkitchen knife
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerhusband wife relationshipboyteenage girlteenage boyfemale protagonistgirllittle girllittle boy β€¦psychiatristdoctor patient relationship (See All)
Period:
1970s1960syear 1963year 1978
Story:
psycho terrorpsycho killergrindhouse filmfemale victimhomicidal maniacsmall town sheriffmasked villainpsychopathic killermasked killerevil mansadistic psychopathjumpsuitdrive in classicmurder spreeweirdo β€¦knife murderserial murderhuman monsterbad guymadmanbody countmasked mangrindhousepsychostabbed in the stomachlifting someone into the airmutilationmaniacmurdererstalkingcharacter's point of view camera shotthroat slittingsubjective cameralow budget filmblood splattersurprise endingfemale nudityviolencenudityone word titledogguncigarette smokingtitle spoken by characterknifeshot to deathshot in the chestwatching tvfalling from heightmaskrunningmarijuananeighbortelevisiontelephonegood versus evilhalloweenstrangulationstabbingstabbed to deathchildgunshotattempted murderprologuesuburbfirst of seriespay phonehalloween costumelong takefirst parthandgunkillingpot smokingteen angstbulletelectronic music scorebabysitterblockbusterdead womanwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonedead doggothmental patientyellingclosethiding in a closetkillsuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpenterknittingbutcher knifeoff screen murderwetnessvillain not really dead clicheescaped mental patientno endingpayphonelight bulbmidwestghost costumewoman smoking cigarettecreepymichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeyman21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodysmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wolf Creek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β€¦are after the backpackers find a way to escape. (Read More)

Subgenre:
cult filmindependent filmsuspenseslasher flickaustralian horrorsadistic horror
Themes:
exploitationevilsadisminsanitybrutalitypsychopathfeardeathmurderkidnappingrapedrinkingtorturedrunkennessescape β€¦abductioncruelty (See All)
Mood:
darknessslashernightnightmaregorecar chaseblood and gore
Locations:
barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β€¦australian outbackcar on fireshed (See All)
Characters:
slasher killerserial murderermysterious villainmysterious killerserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilation
Period:
year 1999
Story:
psycho terrorpsycho killermale victimgrindhouse filmfemale victimhomicidal maniacpsychopathic killerevil mansadistic psychopathgory violencemurder spreebloody violenceknife murdergraphic violenceextreme violence β€¦disturbed individualbutcheryserial murderslashinghuman monstermysterious mancar troublebad guymadmancharacters killed one by onebody countslaughterbutcherredneckrampagevictimpsychomutilationmaniacobscene finger gesturemurdererimpalementmassacrelow budget filmdead bodyblood splatterchaseviolencekissblooddogtwo word titleguncigarette smokingphotographtitle spoken by characterexplosionsingingpartyknifebased on true storysongcorpseshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassescafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedvideo camerastabbingstabbed to deathfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partdismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangerhome movierapisthomicidesufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultkilling spreebloodbathdrugged drinkreflectionpervertbarking dogcrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on firemeteorcamcorderfilling stationoverturning carbriton abroadcaravantied up while barefootwaking upsole survivorkangaroocar rollovermass murdererdriving at nightvillain not really dead clicheexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackertrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormalindependent horror
Themes:
evilsadisminsanitypsychopathmurderdeathsurrealismdrugsghosttorturesupernatural powerdeath of motheramnesia
Mood:
darknessslashernightmareraingorehigh school
Locations:
small townairplaneroad trip
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfamily relationshipsfather son relationshipfather daughter relationshipteacherself mutilationyounger version of characterdeafnessgerman american β€¦evil father (See All)
Period:
1990s1970s1960s1940s1950s
Story:
psycho terrorpsycho killerhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathgory violencetrailer narrated by don lafontainesequel to cult filmdrive in classicmurder spreebloody violencebutcherylunatic β€¦serial murderhuman monsterbad guymadmanpsychoticbody countslaughterbutcherrampagevictimpsychomutilationmaniacmurdererchild in perilimpalementsubjective camerablood splattersequelviolencebloodf ratedcharacter name in titleflashbackbare chested maletitle spoken by characterknifefirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalgood versus evilstrangulationstabbed in the chestboxingmapchild abusedrawingshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodykillingundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothorphanagerapistback from the deadcameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreenewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actorstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characteranimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticabusive stepfatherboogeymanburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldsleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathstabbed in the ear3d sequel to 2d filmtroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

Friday The 13th (2009) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (2009)

A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β€¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)

Subgenre:
psycho thrillerslasher flick
Themes:
evilbrutalitypsychopathdeathrevengemurdertorturedrunkennessdeath of mothermurder of a police officer
Mood:
darknessslashergorehorror movie remake
Locations:
backwoodswoodsforestmotorcycleboatbathtubbicyclewaterpolice carlakecampfiretunnelschool bussex in a tent
Characters:
serial murderermysterious villainterrorsheriffvillainkillerpoliceafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlasian americanblonde girlgirl nudity
Period:
1980s
Story:
machete mutilationpsycho terrorpsycho killerfemale victimserial teen murdererhomicidal maniacmasked villainpsychopathic killermasked killeraxe murderevil mansadistic psychopathcrystal lake new jerseywessex county new jerseyfriday the thirteenth β€¦source musichockey maskweirdoknife murdergraphic violenceserial murderslashinghuman monstersummer campbad guycharacters killed one by onepsychoticbody countstabbed in the eyenew jerseyrampagemasked manpsychomutilationmachetekissing while having sexmaniacstalkingstalkerthroat slittingimpalementmassacreaxedecapitationdead bodyblood splatterdigit in titlesurprise endingchasefemale frontal nuditynumber in titlefemale nuditybare breastsbloodviolencenuditymasturbationdogbare chested malesex scenefemale rear nuditynipplespistoltelephone callfiretopless female nuditywoman on topcorpseurinationblonderemakeshot in the headbare buttmaskmarijuanahallucinationalcoholswimmingflashlightbracandlestrangulationtoplessvideo camerastabbingdeath of friendstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstabbed in the backprologuescreamingmini skirtmoaningmissing persontentopening action scenedisappearancepremarital sexsuspicionlove interestpot smokingfireplacebow and arrowburned aliveelectronic music scorescene during opening creditscaptivewalkie talkiebuttockscampcovered in bloodrear entry sexgrocery storebackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carsevered legarrowburned to deathmannequinplantvillain played by lead actorbeheadingporn magazinestabbed in the handbongcanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removingopen endedcheating boyfriendmurderessspitting blooddeformitytelevision setpool of bloodold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttwoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesskitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in bratouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyleg ripped offatonal music scoreaxe in the chestcampgroundhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kalifornia (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β€¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent film
Themes:
evilsadisminsanitypsychopathfearmurderdeathkidnappingrapetorturetheftphotographywritingmurder of a police officerrape and murder
Mood:
slashergoreneo noir
Locations:
barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
slasher killerserial murdererterrorvillainkillerpoliceboyfriend girlfriend relationshipwriterhostagewaitresschinese foodshooting a police officer
Story:
psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathgory violencebloody violencegraphic violencecrime spreebutcherylunatichillbillyserial murderhuman monsterbad guy β€¦madmanpsychoticbody countbutcherrampageredneckvictimpsychostabbed in the stomachmutilationmaniacmurdererdead bodyblood splatterfemale nuditysexviolencebloodnuditymale nudityone word titlemale rear nuditybare chested malegunfightcigarette smokingphotographtitle spoken by characterpistolshot to deathcar accidentshot in the chesturinationshot in the headshotgunbare buttbeersex standing upgay slurjournalistcaliforniastabbed to deathnarrationjourneyblack pantiesstabbed in the backon the roadautomobilekillingarsontape recorderragerape victimrapistmale underweartensionstabbed in the throatgash in the facedark humorblack brabilliardsperversionrainstormsexual assaultkilling spreeblack bra and pantiesphysical abusepervertkillpistol whippolice officer shot in the chestsexual violenceknocked unconsciousyuppietrailer parkwhite trashcactushit with a shovelintentionally misspelled titlecross countryabusive boyfriendmass murdererbreaking a bottle over someone's headpittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yopolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen movieteen horrorindependent horror
Themes:
evilpsychopathmurderrevengesurrealismfuneralsupernatural power
Mood:
slashernightmaregorehigh schoolavant garde
Locations:
cemeterybathtubpolice station
Characters:
slasher killerserial murderermysterious villainserial killerterrorvillainkillermother son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlalcoholicpolice chase β€¦self mutilationpolice lieutenant (See All)
Period:
1980s
Story:
psycho terrorgrindhouse filmhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathdrive in classicgraphic violencebutcheryserial murderbad guymadmancharacters killed one by onebody count β€¦butchervictimgrindhousepsycholifting someone into the airmaniacdeath of sonstalkingcharacter's point of view camera shotsubjective camerablood splattersurprise endingbloodviolencebare chested malecigarette smokingdreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonegood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of serieshangingpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothichatcrucifixstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementcellaralarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendmaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clicheplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deadserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β€¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
american horrorindependent filmsuspenseindependent horrorsadistic horrorslasher horrorhorror b movie
Themes:
exploitationevilsadisminsanitybrutalitypsychopathmurderdeathtortureescapehome invasioncrueltymurder of a police officer
Mood:
slashernightgoreblood and gore
Locations:
strip clubtrying to escape
Characters:
mysterious villainmysterious killerserial killerterrorvillainkillerteenagerhusband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlhostagethiefself mutilationtalking to oneself in a mirror β€¦the familykiller dogdirector of photography (See All)
Story:
psycho killerpsychotronic filmgrindhouse filmhomicidal maniacmasked villainpsychopathic killermasked killerevil mandark and stormy nightsadistic psychopathmurder spreemultiple homicidecrime spreebutcherycut into pieces β€¦serial murderslashinghuman monstermysterious manbad guycharacters killed one by onepsychoticbody countstabbed in the eyeslaughterpsychotronicbutcherrampagemasked manvictimpsychomutilationmaniacchild in perilimpalementdead bodyblood splattersurprise endingfemale frontal nudityfemale nuditybare breastsbloodviolencecharacter name in titleflashbacktwo word titlefightcigarette smokingnipplesknifelesbian kisspistolbeatingcorpsemirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingstabbed to deathstabbed in the chesthousetied to a chairscantily clad femalehit by a cardangerscreamingelectrocutiondebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationcovered in bloodteddy bearhomeanimal attackhomicideeaten alivewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the faceescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolineboxbloodbathdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirewifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodsheddead cattrickjewelcut handhouse on firedragging a bodyviolent deathex wifeexploitation filmcaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partyburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Texas Chain Saw Massacre (1974) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedysuspensetragedyslasher flicksurvival horrorteen horrorindependent horror
Themes:
exploitationevilsadisminsanitybrutalitypsychopathfeardeathmurderfriendshipkidnappingtortureescapeparanoiadysfunctional family β€¦paniccannibalisminheritancemadnessnear death experience (See All)
Mood:
darknessslasheravant gardeambiguous ending
Locations:
cemeterycarkitchenwheelchairfarmroad triptruckgas stationtexascountryback country
Characters:
slasher killerserial murdererserial killerterrorvillainkillerbrother brother relationshipteenagerfamily relationshipsboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyhostageself mutilation β€¦truck driverself inflicted injury (See All)
Period:
1970syear 1973
Story:
psychotronic filmgrindhouse filmfemale victimhomicidal maniacmasked villainpsychopathic killermasked killerevil mandrive in classicmurder spreebloody violenceweirdodisturbed individualbutcheryeyeball β€¦hillbillyserial murderslashinghuman monstercar troublebad guymadmancharacters killed one by onebody countpsychotronicbutcherredneckrampagemasked manvictimgrindhousepsycholifting someone into the airbarnmutilationchainsawmaniacdeath of brothermurdererstalkinggraveimpalementmassacredecapitationlow budget filmblood splattersurprise endingchaseviolencebloodphotographknifevoice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunningcollegesurvivalfoot chaseflashlightbound and gaggedambushdeath of friendstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outskeletonscarhairy chestcountrysidetragic eventglassespigtied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckropegothicgroup of friendsloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodproduced by directorskullhitchhikerhitchhikingfull moonwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormuteescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathsouthern accentclose up of eyeshysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditsmeatestatetexanabandoned housefarmhouseanimal crueltycar washfilm starts with texthit by a truckoffscreen killingheld captivesummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerasledgehammercut handclose up of eyeastrologyfurniturebonelifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskincreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrorfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspensepsychological horror
Themes:
insanitypsychopathfearmurderdeathmarriagemoneyfuneraldeceptionvoyeurismdivorcetheftguiltdatingmental illness β€¦unrequited lovemadness (See All)
Mood:
darknessslasherrainbreaking the fourth wall
Locations:
small townchurchhotelbathtubdesertrural settingpolice carmotelcar in water
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillermother son relationshipfamily relationshipsfriendpolicemansister sister relationshipthiefpsychiatristsecretary
Period:
1960syear 1960
Story:
psycho terrorpsycho killergrindhouse filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathdrive in classicmurder of a nude womanmurder spreebloody violenceknife murderweirdodisturbed individualcrime spree β€¦butcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onepsychoticbody countbutchervictimgrindhousepsycholifting someone into the airmutilationmaniacmurderercharacter's point of view camera shotstalkersubjective camerasurprise endingbloodviolencebased on novelone word titleinterviewflashbackbare chested malephotographshowertelephone callvoice over narrationcorpseunderweararrestundressingsecretbathroomjailhallucinationvoyeurgood versus evilnewspaperbracaliforniadisguisestabbingwomanwidowstabbed to deathtoiletstabbed in the chestbirdbathold womanwidowerfirst of seriesmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnessbasementtrapfirst partthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintingblockbusterimpersonationphone boothskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormextortionnervous breakdowncellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathfemale stockinged feetimpotencevillain played by lead actordirector cameoold dark housefemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricidereclusesilhouettefade to blackpeep holeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendtaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

Halloween II (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (2009)

Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off  β€¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)

Themes:
exploitationevilinsanitybrutalitypsychopathdeathsuicideghostdrunkennesshomelessnessmurder of a police officerdeath of daughter
Mood:
darknessslashernightmareraingore
Locations:
hospitalhelicopterstrip club
Characters:
serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner
Story:
female victimhomicidal maniacserial teen killerpsychopathic killeraxe murderevil mansadistic psychopathgory violencejumpsuitmurder of a nude womanreturning character with different actorbloody violencegraphic violenceextreme violencecrime spree β€¦stabbed in the faceserial murderslashinghuman monsterbad guycharacters killed one by onebody countmental institutionrampagevictimmaniacmurdererstalkingstalkerthroat slittingimpalementdecapitationblood splatterchasefemale frontal nuditynumber in titlefemale nudityviolencebloodsequelinterviewflashbackfemale rear nuditysingingpartypistolbeatingdreamcorpsecar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperf wordhalloweenflashlightbandstrangulationstabbingdeath of friendstabbed to deathstabbed in the chestexploding carhit by a carlatex glovesflash forwardmicrophonestabbed in the backportraitclownattackhalloween costumescarglassesneck breakingprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodsheepschizophreniagirl with glassesduct tape over mouthcorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexbeheadinggroupg stringreturning character killed offmedical masksurgical masksexual violencedental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseoverturning carpentagramschizophrenicbreaking through a doormass murdererbreaking a mirrorpole dancingjack o'lanternshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymansequel to remakesatanicaxe murderertape over mouthwoman wearing glassesstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Misery (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Misery (1990)

Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in β€¦ the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)

Subgenre:
psycho thrilleramerican horrorsuspensesurvival horror
Themes:
evilsadisminsanitypsychopathrevengemurderdeathkidnappingtortureescapeinvestigationangerlonelinessobsessionmental illness β€¦abductionwritingmadnessmurder of a police officerclaustrophobia (See All)
Mood:
darknessneo noir
Locations:
woodssmall townhelicoptersnowwheelchairsnow storm
Characters:
slasher killerserial murderermysterious killerserial killerterrorvillainkillernursewriterhostageshooting a police officerbaby killer
Story:
psycho killermale victimpsychotronic filmhomicidal maniacpsychopathic killerdark and stormy nightsadistic psychopathdrive in classicbloody violenceweirdobutcheryserial murderslashinghuman monsterpsychotic β€¦butcherrampagevictimpsychomutilationmaniacobscene finger gesturemurderercharacter's point of view camera shotsubjective camerasurprise endingviolencebloodbased on novelone word titlegunfighttitle spoken by characterknifebeatingshot to deathcar accidentshot in the chestshotgunrescueslow motion scenecar crashstabbingwomansearchduelattempted murderauthorisolationpigbasementtypewriterkillingsociopathragecaptivevillainesspsychologydesperationfemale killerbroken legtensionthunderfanfight to the deathmedicationmurder of a childhighwaydark pastnewspaper clippingphysical abuseintimidationnovelold dark housefemale psychopathblizzardfemale villainevil womanmatchidolmurderesspsychological torturereclusesledgehammervillain not really dead clichecreepmysterious strangerscrapbooktauntingdeeply disturbed personbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killercreepychild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All)

Halloweenviii: Resurrection (2002) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β€¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen horror
Themes:
evilpsychopathfearmurderdeathrevengedeceptionsurveillancemurder of a police officer
Mood:
slashergoresatire
Locations:
woodsforestkitchenwheelchairrooftopfire truck
Characters:
slasher killerserial killervillainkillerteenage girlteenage boynursesecurity guardpsychiatristcoroner
Period:
2000s
Story:
homicidal maniacserial teen killerpsychopathic killermasked killeraxe murderevil mansadistic psychopathjumpsuitcrime spreeserial murderhuman monstersequel to cult favoritebad guycharacters killed one by onebody count β€¦mental institutionrampagemasked manlifting someone into the airchainsawmaniacobscene finger gesturemurderercharacter's point of view camera shotthroat slittingimpalementaxesubjective cameradecapitationblood splattersurprise endingchasefemale nudityviolencebloodsequelflashbacktwo word titlefightknifefirecell phonecorpsefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordgood versus evilhalloweenfoot chaseflashlightstrangulationambulancemontagestabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutionproduct placementkicked in the facecollege studentlightningskeletondisappearanceneck breakingthreatened with a knifesevered armkillingheavy rainsecurity cameraloss of loved onemorgueskullfatebroken legstabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinecasual sexkilling spreenewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark houseabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingsee you in hellcult film referencedecomposed bodybutt grabclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
american horrorcult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
evilsadismbrutalitypsychopathfeardeathrevengemurderfriendshipsurrealismkidnappingghostescapemonstervoyeurism β€¦supernatural powerparanoiapanicmysterious deathshower murder (See All)
Mood:
darknessslashernightmareraingorehigh schoolpoetic justice
Locations:
small townbarschoolswimming poolbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
slasher killerserial murdererserial killerterrorvillainkillermother son relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationshipmother daughter relationship β€¦friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteachergirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All)
Period:
1980syear 1985
Story:
psycho terrorpsycho killerpsychotronic filmgrindhouse filmserial teen murdererhomicidal maniacpsychopathic killerevil mansadistic psychopathattempted child murdergory violencesequel to cult filmdrive in classicmurder spreebutchery β€¦serial murderslashingbad guymadmanbody countbutcherrampagegrindhousepsychostabbed in the stomachlifting someone into the airmutilationmaniacobscene finger gesturemurderercharacter's point of view camera shotchild in perilimpalementmassacresubjective cameranumbered sequeldead bodyblood splatterdigit in titlesurprise endingchasenumber in titlebloodsequelviolencecharacter name in titlenuditymale nuditymale rear nuditybondagedogbare chested malefightcigarette smokingpartyknifeshowertelephone callfirecryingdreamunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titleneighbordemonhallucinationvoyeurclassroomcriminalf wordfoot chasename in titlestabbingbasketballfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firepossessionkicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratcharacter says i love youthreatened with a knifeclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musicjoggingmousebarefoot malevisitcovered in bloodsadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moondamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonewet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsmale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hunted (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hunted (2003)

In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A β€¦t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)

Subgenre:
psycho thrilleramerican horrormartial artssuspense
Themes:
evilpsychopathdeathmurderescapelonelinesshunting
Mood:
slashernightmaregorecar chaseblood and gore
Locations:
woodsbarforesthelicoptersnowbicyclesewer
Characters:
slasher killerserial murdererserial killerterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship
Period:
1990s2000s
Story:
psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathgory violencemurder spreebloody violenceknife murdergraphic violenceextreme violencedisturbed individualcrime spreebutchery β€¦stabbed in the faceserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countslaughterbutchervictimpsychostabbed in the stomachmutilationmaniacobscene finger gesturemurdererthroat slittingimpalementmassacreblood splatterchasebloodviolenceflashbackknifepistolshootoutcorpseshot to deathfistfightmachine guncar accidentshot in the headcatgunfightbrawlfalling from heightvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingstrangulationstabbingdeath of friendbridgestabbed in the chestone man armypolice officer killedshot in the foreheadduelkaratefbifugitivecabinwaterfallsevered armdismembermentsubtitled scenekillingwolfhunterswat teamhonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandocaptureknife throwingdark pastwar veteransevered legkilling spreefountainpostcardstabbed in the armyugoslaviamilitary uniformsole black character dies clicheoregonmilitary trainingmass graveportland oregonsevered foothooddeeply disturbed personauto theftjumping off a bridgebritish columbiapacific northwestdisturbingkosovobalkanbiblical quoteanimal traptrackingsurvivalistbloody spraygruesomebasic trainingbody partsethnic cleansingpsycho filmdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All)

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
american horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horrorurban fantasy
Themes:
evilsadisminsanitybrutalitypsychopathfearmurderdeathfriendshiprapeghostpregnancymonsterinvestigationsupernatural power β€¦depressiontrauma (See All)
Mood:
slashernightmaregore
Locations:
hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident
Characters:
slasher killerserial murdererserial killerterrorvillainkillermother son relationshipteenagerfather son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctor β€¦boyfemale protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
psycho terrorpsycho killerpsychotronic filmgrindhouse filmhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathsequel to cult filmdrive in classicmurder spreebloody violencecut into piecesserial murder β€¦slashingmysterious manbad guymadmancharacters killed one by onepsychoticfifth partbody countslaughtermental institutionrampagevictimlifting someone into the airmutilationmaniacmurdererstalkingimpalementblood splattersurprise endingchasefemale nuditybare breastsviolencebloodsexsequelf ratednudityflashbackbare chested malegunfemale rear nudityphotographpartyknifepistolshowertelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of frienddinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollscreamskeletonautomobilepremarital sexsevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantloss of friendspidercrying womanskateboardbirthfollowing someonepicnicback from the deadcelebrationdamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childdisfigurementdark pastbarefoot femalegay stereotypeasylumkilling spreenewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthmental patienttaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietswimmerwet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticboogeymanhorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapesleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

Jason X (2001) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason X (2001)

Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks  β€¦the colonists in a whole new environment. (Read More)

Subgenre:
independent filmmartial artsblack comedysuspensedark comedyb movieabsurdismfish out of waterteen horror
Themes:
brutalitypsychopathfeardeathmurderescapemonstermilitarysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia
Mood:
slashergoreambiguous ending
Locations:
woodslakeouter spacelaboratoryspace stationresearch stationship explosion
Characters:
terrorvillainteenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyteacher student relationshipprofessorengineerbabe scientist
Period:
2000s
Story:
machete mutilationfemale victimmasked villainpsychopathic killermasked killerevil mancrystal lake new jerseywessex county new jerseysequel to cult filmfriday the thirteenthjason voorheesmurder of a nude womanhockey maskextreme violencecrushed head β€¦slashinghuman monstersummer campmadmancharacters killed one by oneslaughternew jerseyrampagemasked manvictimstabbed in the stomachmutilationmachetekissing while having sexstalkingstalkerthroat slittingimpalementmassacredecapitationnumbered sequelblood splattersurprise endingchasefemale frontal nuditynumber in titlefemale nudityviolencekissbloodsequelcharacter name in titleflashbackbare chested malesex scenefightnipplesexplosionknifepistolfirebeatingcorpseshot to deathfistfightmachine gunshot in the chestface slapshot in the headshotgunrescuepunched in the facecomputerfalling from heightmaskshowdownrifleheld at gunpointhand to hand combatrobotkung fuscientistshot in the backsurvivalflashlightambushstrangulationstabbed to deathmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timekicked in the facetough girlinjectionexploding bodyneck breakingthreatened with a knifemercenarysevered armlove interestdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlecowboy hatroman numeral in titlespacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvirtual realityback from the deadandroidpresumed deadcyborgdual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramdisfigurementknife throwingfemale doctorsevered legtank topgatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierface maskfemale fightercameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shouldermicroscopewoman fights a manroman numbered sequelman wearing glassesmorphinearm cut offarmy basemass murdererstupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyshooting starbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airsuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashleg ripped offman murders a womanleg blown offwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestkilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Child's Play 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play 2 (1990)

Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β€¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)

Subgenre:
psycho thrilleramerican horrorblack comedysupernatural
Themes:
evilpsychopathdeathsupernatural power
Mood:
slasherraingorecar chase
Locations:
chicago illinoisschool buswater gun
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicehusband wife relationshipboyteachernew student
Period:
1990s
Story:
psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbloody violencebutcheryorchestral music scoresequel to cult favoritebad guymadmanbody countstabbed in the eyeeye gouging β€¦butcherpsycholifting someone into the airmaniacobscene finger gesturemurdererchild in perilthroat slittingdigit in titlesequelbloodcigarette smokingsingingpunctuation in titlecorpsecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancestabbed to deathstabbed in the chesttied to a chairfalse accusationlimousinebeaten to deathelectrocutionpossessiondolllightningdeath of husbandbasementneck breakingthreatened with a knifefalling down stairsburned alivegothictied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windowswingraised middle fingersocial workersevered legvoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machinehiding under a beddigging a gravelocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorcult filmindependent filmmartial artsblack comedysuspensesupernaturalparanormal
Themes:
evilpsychopathrevengemurderfuneralsupernatural power
Mood:
slashernightmareraingorehigh school
Locations:
small towncemeteryhospitalbeachelevatorschool nurseblood in water
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfather son relationshipfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress
Period:
1980s
Story:
psycho killerhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathsequel to cult filmdrive in classicmurder spreereturning character with different actorbutcheryserial murderslashingdefecationbad guy β€¦butcherrampagestabbed in the stomachlifting someone into the airmutilationmaniacdeath of sondeath of brothermurderernumbered sequelblood splatterdigit in titlesurprise endingfemale frontal nuditynumber in titlesequelblooddogbare chested malecigarette smokingphotographfiredreamcorpseurinationface slappunched in the faceplace name in titlerock musiccar crashneighbordemonambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phonekicked in the faceskeletoncheerleaderglassesunderwatersevered armsleepingkillingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glasseskicked in the stomachfourth partmovie theatercrushed to deathback from the deadseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorreturning character killed offneedlejunkyardohioold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimtime loopplant in titlehead ripped offwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticreference to aristotleserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

The Hills Have Eyes 2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β€¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
evilinsanitypsychopathdeathrevengemurdersuiciderapetorturecannibalismrape and revenge
Mood:
slashergore
Locations:
desertwaternew mexico
Characters:
slasher killerserial killerterrorvillain
Period:
year 2007
Story:
psycho killerpsychotronic filmgrindhouse filmhomicidal maniacaxe in the headpsychopathic killeraxe murderevil mansadistic psychopathbloody violencegraphic violenceextreme violencestabbed in the facemeat cleaverserial murder β€¦human monsterbad guymadmanbody countrampagepsychomaniacimpalementnumbered sequelblood splattersurprise endingfemale nuditybare breastssequelnudityfightexplosionpistolfirelickingcorpseshot to deathshot in the chestremakeshot in the headfalling from heightriflef wordgood versus evilsurvivalgay slurstabbingarmystabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backkicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathbroken legguardsevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminekilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetbleeding to deathdrillunwanted pregnancydeformitysledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Devil's Rejects (2005) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β€¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
psycho thrillercult filmindependent filmblack comedysadistic horror
Themes:
exploitationevilsadisminsanitybrutalitypsychopathfearrevengedeathmurderfriendshipsuicidekidnappingrapebetrayal β€¦tortureescapedeceptionseductionangerdeath of fatherdeath of motherparanoiahumiliationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All)
Mood:
nightmaregoreambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
serial killerterrorsheriffvillainbrother brother relationshipmother son relationshippolicefamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationship β€¦prostitutepolice officernursehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
grindhouse filmfemale victimhomicidal maniacpsychopathic killeraxe murderevil manmurder spreereturning character with different actormultiple homicideknife murdergraphic violencecrime spreebutcheryserial murderhuman monster β€¦bad guymadmanbody countslaughterbutcherrampageredneckmasked mangrindhousestabbed in the stomachmaniacobscene finger gesturedeath of sondeath of brothermurdererchild in perilthroat slittingimpalementaxelow budget filmdead bodyblood splatterpantieschaseviolencesequelbloodflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifepistolshowerfireshootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partinterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationdeath of frienddrug dealercocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herodouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationsplit screenpigbasementneck breakingthreatened with a knifechickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatkicked in the stomachphone boothcovered in bloodrapistfemale killerinterracial friendshipgas maskwatching televisioncrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackingexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticcocaine snortinghouse on firemass murdererevil clownbilingualisminnocent person killedknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtcmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Split (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
psycho thrilleramerican horrorblack comedysuspensesuperherotragedysurvival horrorteen horrorpsychological thriller
Themes:
insanitybrutalitypsychopathfeardeathmurderfriendshipsurrealismkidnappingrapebetrayalescapefuneralmonsterdeception β€¦voyeurismdeath of fatherparanoiamental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
woodstrainforesttaxikitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfather daughter relationshipafrican americandoctorteenage girlpolice officerhostagesecurity guardpsychiatrist β€¦uncle niece relationshippolice dog (See All)
Period:
2010s
Story:
psycho terrorpsycho killerfemale victimhomicidal maniacpsychopathic killerevil mansadistic psychopatheast coastbloody violenceweirdodisturbed individualserial murderhuman monsterbad guycharacters killed one by one β€¦body countrampagevictimpsychomaniacmurdererstalkingcharacter's point of view camera shotstalkersubjective camerapantiessurprise endingchasedancingviolencebloodsequelone word titleflashbackdogbare chested maletitle spoken by characterpartyknifecell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderdangermissing persontentknocked outbaseball batflowersscarinjectiontragic eventhigh school studentbasementlaptoploss of fathersuspicionkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskpump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastkilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite braschizophreniclocked in a roommolestationchild rapefade to blacksinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophagusair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedydark comedysurvival horror
Themes:
evilsadisminsanitypsychopathdeathmurderkidnappingdeceptionincestmental illnesshome invasiongreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
darknessslashergoresatiresocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreedisturbed individualserial murderslashinghuman monsterbad guymadmanbody count β€¦rampagemasked mangrindhousepsychostabbed in the stomachmutilationmaniacchild in perilimpalementblood splatterviolenceblooddogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathshot in the chestface slapshotgunbirthdayflashlightmansionhousechild abusevanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondolldeath of childskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragespidersevered handskullsadomasochismsevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordgothperverthiding in a closetold dark houseschemeevictionlighterfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
psycho thrillersuspensesupernaturalparanormal
Themes:
evilinsanitypsychopathfeardeathmurdersuicidekidnappingmarriagerapeghostprisontortureescapememory β€¦supernatural powerparanoiadrug usemental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessslashernightnightmareraingoreneo noir
Locations:
hospitalswimming poolcarbathtubtaxipolice stationpolice car
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillermother son relationshippolicefamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipdoctortattoo β€¦female protagonistnursepolicemanlawyerreference to godsecurity guardpsychiatristself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
psycho terrorpsycho killerfemale victimhomicidal maniacpsychopathic killeraxe murderevil mansadistic psychopathbloody violencegraphic violenceextreme violenceserial murderslashingbad guymadman β€¦mental institutionpsychobarnmaniacmurdererstalkingthroat slittingaxesubjective camerablood splattersurprise endingchasefemale frontal nudityfemale nuditykisssexviolencebloodf ratedinterviewflashbackbare chested malegunfightphotographexplosionknifepistolshowertelephone callfirecryingcell phonedreamcorpsecar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreporterswimmingsurvivalfoot chaseflashlightvideo camerawomanbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionlightningattempted rapeinjectionpursuitdeath of husbandtrustkillingtherapypizzasyringehypodermic needlegothicheavy rainsecurity camerajail cellpatientbuttocksdesperationrape victimrapistbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctornervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockcamcorderinmateman on firetrapdoorpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Blow Out (1981) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blow Out (1981)

This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β€¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmconspiracyb horrorpolitical thrillerpolitical conspiracy
Themes:
exploitationevilsadismpsychopathdeathmurderpoliticstorturefilmmakinginvestigationparanoiaguiltsurveillancetechnologyclaustrophobia
Mood:
slashernightneo noir
Locations:
hospitaltrainsnowcityrooftoptrain stationpennsylvaniacar in water
Characters:
slasher killerserial murdererserial killervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute
Period:
1980swinter
Story:
psycho killerpsychotronic filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killerevil mansadistic psychopatheast coastdrive in classicmurder spreedisturbed individualserial murderslashingbad guy β€¦madmancharacters killed one by onepsychoticbody countslaughterrampagevictimgrindhousepsychomutilationmaniacmurderergravesurprise endingchasefemale frontal nudityfemale nuditybare breastsnudityflashbacktwo word titlebare chested maleguntitle spoken by characterknifeshowerwoman on topcar accidenturinationrescuewatching tvlingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgestabbed to deathpoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upattempted rapehairy chesttragic eventsplit screenfilm within a filmwitnessfireworkscult directorgraffititrustkillingtape recorderrecordingcaught having sexcrying womanmovie theaterphone boothfrogparadedead womanmale underwearwatching televisionwoman in jeopardydamsel in distressveteranmustachephiladelphia pennsylvanialonerbriefsdead woman with eyes openkilling spreereckless drivingpolitical corruptionfilm industryinterrupted sextruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmastrangled to deathtapetelevision reporterbroken bottlewiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepydisturbingred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation
Themes:
evilsadisminsanitypsychopathdeathmurderghostfuneralmonstersupernatural power
Mood:
slashernightmaregore
Locations:
cemeterybarchurchschool boy
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfather daughter relationshipmother daughter relationshipdoctornursetough guylittle girlsingle motherself mutilation β€¦alcoholic fatherevil nurse (See All)
Period:
1980s
Story:
psycho killerhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathdrive in classicmurder spreebloody violencebutcheryserial murderslashingbad guymadmancharacters killed one by one β€¦body countstabbed in the eyebutcherrampagevictimlifting someone into the airmaniacmurdererchild in perilimpalementdecapitationnumbered sequelblood splatterdigit in titlesurprise endingnumber in titlefemale nudityviolencesequelbondagebare chested malecigarette smokingfiredreamcorpseslow motion scenethongfalling from heightbedrock musicbathroomdemonfoot chasenewspaperstabbingdeath of friendstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiotonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollskeletonisolationbasementcharacter says i love youkillingundeadsplatterfalling down stairsteen angstelectronic music scorecomaragetied to a bedcrucifixback from the deadclockdrug overdoseswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementkilling spreepajamassmokealleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymansexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
sadisminsanitybrutalitypsychopathdeathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneral β€¦investigationangercorruptiondeath of fatherparanoiablackmailillnesshome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
darknessslashernightgore
Locations:
cemeteryhospitalbarrestaurantschoolcarbathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice stationpolice car β€¦cityitalytruck (See All)
Characters:
slasher killerserial murderermysterious villainserial killerterrorvillainkillermother son relationshippolicehomosexualfather son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctor β€¦singerboygirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendself pity (See All)
Period:
1970s
Story:
psychotronic filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathdrive in classicmurder spreegraphic violenceextreme violencebutcherycrushed headmeat cleavereyeballserial murder β€¦slashinghuman monstermysterious mancharacters killed one by onepsychoticbody counteye gougingslaughterbutcherrampagevictimgrindhousestabbed in the stomachmaniacmurdererstalkingimpalementaxesubjective cameradecapitationdead bodyblood splattersurprise endingchasekissviolencebloodflashbacktwo word titleguncigarette smokingphotographsingingknifetelephone callfiresongshootoutbeatingcorpsemirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningcafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersurvivalgay slurnewspaperbedroomflashlightjournalistbandold manstrangulationstabbingstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianistthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagiciantoyarchitectpsychologycomposerdesperationdriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionwhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead mandisfigurementdark pastfemale reportergay stereotypeliving roomdead woman with eyes openkilling spreevoodoolightplaying pianotelepathycrowclose up of eyesdead girldrumsapparitiondark secretkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodlocked doorfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanfamous scoremacabrepsychic powerbourgeoisiedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodhouse firehouse on fireclose up of eyefingerprintsilhouettehatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

I Spit On Your Grave (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β€¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
american horrorcult filmindependent filmb movievideosadistic horrorhorror b movie
Themes:
exploitationevilsadismbrutalitypsychopathfearrevengemurderdeathkidnappingrapetorturevoyeurismseductionanger β€¦humiliationcrueltyvengeancerape and revengerevenge murder (See All)
Mood:
slashergore
Locations:
small townnew york citychurchforestcarbathtubbicyclewaterlakegas stationcountry
Characters:
serial murdererserial killervillainkillerfemale protagonistgirlwriterlustself justicesex with a stranger
Period:
1970s
Story:
psycho killergrindhouse filmfemale victimpsychopathic killeraxe murderevil mansadistic psychopathgory violenceeast coastdrive in classicmurder spreemultiple homicidegraphic violenceextreme violenceserial murder β€¦human monstercharacters killed one by onepsychoticbody countredneckvictimgrindhousemutilationmurderergraveaxelow budget filmpantiesfemale frontal nudityfemale nuditybare breastsviolencebloodmale nuditymale frontal nuditybare chested malegunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingfondlingcryingbeatingmirrorbikinivoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokingauthorscreamingunderground filmhangingfemale removes her clothesglassesthreatcabinhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragedesperationrape victimrapistfemale killerwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationbruisekilling spreemisogynywoman in bathtubpervertkillviolence against womenvigilantismmisogynistcanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockmurderesssmall breastsfemale prisonershared bathone woman armyviolent deathdelivery boynoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticeye candyinfamymisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

Halloween 4: The Return Of Michael Myers (1988) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween 4: The Return Of Michael Myers (1988)

It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β€¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickholiday horror
Themes:
evilpsychopathmurderpanic
Mood:
slashernightgore
Locations:
small townschoolcarpolice stationrooftop
Characters:
slasher killermysterious villainserial killerteenagerteenage girlgirlsister sister relationshipcrying girl
Period:
1980syear 1988
Story:
psycho killerhomicidal maniacsmall town sheriffmasked villainpsychopathic killermasked killerevil mantrailer narrated by don lafontainejumpsuitmurder spreeknife murdercrime spreeserial murderhuman monstermadman β€¦characters killed one by onebody countrampagelifting someone into the airmaniaccharacter's point of view camera shotthroat slittingimpalementsubjective cameranumbered sequeldigit in titlesurprise endingnumber in titlesequelbloodcharacter name in titledoggunknifeshot in the chestfalling from heightmaskgood versus evilhalloweenflashlightambulanceanimalpart of serieshit by a carpolice officer killedelectrocutionhalloween costumepickup truckfalling down stairsfourth parthitchhikingpump action shotgunchild's point of viewseven word titlemanhuntpower outageattickilling spreedead dogreturning character killed offtrick or treatingalarmelementary schoolteasingkiss on the lipsmatchillinoisoff screen murdervillain not really dead clicheescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecemichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Green Inferno (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Green Inferno (2013)

In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β€¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)

Subgenre:
american horrorsuspenseslasher flickbody horrorsadistic horrorspanish horrorcanadian horror
Themes:
fearmurdersuicidetorturedeceptioncannibalism
Mood:
slashernightmareraingoreblood and gore
Locations:
americanew york cityboatvillagejunglerain forest
Characters:
slasher killerterrorvillainfather daughter relationshiptattoolawyeramerican abroad
Story:
machete mutilationpsychotronic filmsadistic psychopathgory violenceeast coastbloody violencegraphic violenceextreme violenceslashinghuman monsterbad guycharacters killed one by onebody countstabbed in the eyeeye gouging β€¦slaughterpsychotronicmasked manvictimmutilationmachetethroat slittingimpalementdecapitationblood splatterfemale nudityviolencemale frontal nuditymale rear nuditybare chested malelesbian kissthree word titlepistolcell phoneshot to deathshot in the chesturinationwritten by directorvomitingmarijuanacollegeislandmale pubic haircolor in titlerivershot in the backcookingsevered headdream sequenceritualroommatenecklaceshot in the foreheadcharacter repeating someone else's dialogueprotestcollege studentscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplatterspidercovered in bloodbroken legeaten alivemale masturbationcannibalfalling to deathlesbian coupleairplane crashtitle at the endbroken armsevered legenvironmentalismcapitalismactivisttorso cut in halfsatellitemarijuana jointkillshot in the neckunited nationshomageflutenaivetyamazonveganantbleeding to deathkiller childmiddle classperureference to twittertied up while barefootcamera phonedeforestationignoranceenvironmentalistbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophaguseating human fleshfemale genital mutilationman eaterbody partshead on a stakeugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All)

Halloween 5 (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween 5 (1989)

It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation  β€¦at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)

Subgenre:
american horrorindependent filmslasher flick
Themes:
evilfearmurderdeathfriendshipescapeself sacrifice
Mood:
darknessslasher
Locations:
forestcarbathtubbuspolice stationpolice carrunning in the forest
Characters:
slasher killerserial killervillainpolicefrienddoctorgirlpolice officernursepsychiatristuncle niece relationship
Period:
1980s20th century
Story:
masked villainserial teen killermasked killerattempted child murdertrailer narrated by don lafontainejumpsuitstabbed with scissorsserial murderhuman monstersequel to cult favoritelaundrybad guyfifth partbody countpsychotronic β€¦masked manlifting someone into the airbarnmurdererstalkingcharacter's point of view camera shotchild in perilsubjective camerasurprise endingchasenumber in titlesequelkissbloodviolencecharacter name in titledoggunphotographexplosionpartyknifecryingmirrorcatfalling from heightmaskrunninggood versus evilhalloweencandleambulancestabbingdeath of friendweaponexploding carchildanimalcoffinpolice officer killedattempted murdertreedangercostumescreamingscreambracelethangingautomobilethreatneck breakingtrapratsplatterhateholidayropehuggingheroinelooking at oneself in a mirrorslow motionloss of friendhidingpresumed deaddeath threatscissorsstairsdead manfieldlaughingkilling spreepumpkinlightsirendead dogreflectionpetpresentyellingtablereturning character killed offdead animalold dark housediscoveryclimbingkittenglasslocked doorhanged mancapepitchforkscythemass murdererliquidsittingemergencydustlight bulbpolice officer knocked unconsciousmichael myerscarrying someonelifting a female into the aircrawlingboogeymanpleadingcrying childunmaskingopening a windowstringcult film referencestrawpink dresspolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All)

Friday The 13th Part Vi: Jason Lives (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Vi: Jason Lives (1986)

Determined to finish off the infamous killer Jason Voorhees once and for all, Tommy Jarvis and a friend exhume Jason’s corpse in order to cremate him. Things go awry when Jason is instead resurrected, sparking a new chain of ruthlessly brutal murders. Now it’s up to Tommy to stop the dark, devio β€¦us and demented deaths that he unwittingly brought about. (Read More)

Subgenre:
american horrorcult filmsuspenseslasher flickteen horrorsupernatural horror
Themes:
evilsadisminsanitybrutalitypsychopathfearmurderdeathprisonmonstersupernatural power
Mood:
darknessslashergorecar chasebreaking the fourth wall
Locations:
americawoodssmall towncemeteryforestboatpolice stationlakeschool bus
Characters:
slasher killermysterious villainterrorsheriffvillainkillerteenagerpolicefather daughter relationshipfriendzombie
Period:
1980s
Story:
machete mutilationpsycho terrorgrindhouse filmfemale victimhomicidal maniacmasked villainserial teen killermasked killerevil mandark and stormy nightsadistic psychopathcrystal lake new jerseywessex county new jerseyfriday the thirteenthjason voorhees β€¦east coastdrive in classichockey maskdate in titlemurder spreereturning character with different actorbloody violenceknife murdercut into piecesstabbed in the faceserial murdersummer campsequel to cult favoritemysterious manbad guybody countslaughterbutchernew jerseyrampagemasked manvictimlifting someone into the airmutilationmachetemaniacstalkingmassacredecapitationnumbered sequeldigit in titlesurprise endingnumber in titlesequelsexbloodviolencecharacter name in titleflashbackcorpsewritten by directormaskdemonrevolverflashlightambulancestabbingstabbed to deathsevered headunderwater scenelooking at the cameradrowningelectrocutionchampagnelightningdarkneck breakingsevered armdismembermentundeadblood spattermass murdergothicjail cellroman numeral in titleoverallsback from the deadstabbed in the neckresurrectionshovelstabbed in the headsevered legchainbloodbathengagement ringmale name in titleactual animal killedday in titlesixth partmultiple murderrecreational vehicleheart ripped outoff screen murderhead ripped offvolkswagen beetlestruck by lightningdead teenagerlifting a female into the airhorror icongrave robbingdeath by impalementunderwater fightcamp counselordouble impalementmutilated bodychevrolet camarocomic drunkpolice officer crushedstabbing a police officerlightning roddigging up a gravestabbed with broken bottle (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hills Have Eyes (2006) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes (2006)

While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β€¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)

Subgenre:
psycho thrillertragedy
Themes:
evilsadismbrutalitypsychopathdeathmurderrevengesuicidekidnappingrapetorturedeath of fatherdeath of motherdeath of wifecannibalism β€¦self sacrificemadnessmurder of familyghost town (See All)
Mood:
slashergorehorror movie remake
Locations:
desertcavegas stationsuv
Characters:
serial killerterrorvillainkillerfamily relationshipsbrother sister relationshipteenage girlteenage boybaby
Period:
year 2006
Story:
homicidal maniacaxe in the headpsychopathic killeraxe murderevil manbloody violencegraphic violenceextreme violencecut into piecesstabbed in the faceserial murderhuman monsterbad guymadmanbody count β€¦rampagevictimmutilationmaniacmurdererimpalementaxeblood splattersurprise endingbloodviolencedogpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolverfoot chasestabbed in the chestexploding carsevered headcontroversyshot in the foreheadstabbed in the backperson on firevacationbaseball batamerican flagglassesfirst partsevered armdismembermentkillingsplatterclaim in titleburned alivekilling an animalmutantragewalkie talkierapisthomicidesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminemutationsevered legkilling spreedeath of loved onemannequinhysteriacrucifixionex copkilldead animalkilling a doghead blown offgerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyminersiblingdeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All)

Se7en (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Se7en (1995)

A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath β€¦ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmtragedy
Themes:
evilinsanitypsychopathrevengemurderdeathrapereligionjealousytortureinvestigationangergreedmurder investigation
Mood:
slasherraingoreneo noir
Locations:
hospitalbarhelicopternightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicehusband wife relationshipprostituteteacherdetectivephotographerlawyerinterracial relationshiplust β€¦security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All)
Story:
psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreecrime spreeserial murderhuman monsterbad guymadmanbody countvictimpsychomutilation β€¦maniacmurdererdecapitationblood splatterdigit in titlepantiessurprise endingchasenumber in titleviolencebloodone word titleinterviewdogbare chested malephotographtitle spoken by characterpistolshootoutcorpseshot to deathcar accidentshot in the headshotgunarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminalfoot chasegay slurflashlightambulancedinersubwaywhite pantiessevered headscantily clad femalehit by a carnews reportshot in the foreheadattempted murderlibrarysadnesstied uptypewriterkillingfreeze framegirl in pantiestv newscard gamepokergothictape recordersociopathtied to a bedfbi agentcrucifixloss of wifeblockbusterswat teamsevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingboxkilling spreeage differencedead dogalleycartoon on tvkillspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettibarbershopmass murdererinnocent person killedstairwellpolice partnerjumping from a rooftopwriting in bloodel trainswatpolice protagonistbreaking down a doorcreepysleeping pillsreference to ernest hemingwaydisturbingfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All)

Maniac (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maniac (2012)

Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession  β€¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)

Themes:
sadisminsanitybrutalitypsychopathfearmurderdeathtorturelonelinessobsessiondepressiondrug useunrequited lovephotographychildhood trauma β€¦psychological trauma (See All)
Mood:
slashergoreneo noir
Locations:
restaurantlos angeles californiasex in public
Characters:
mysterious villainserial killerterrorvillainkillermother son relationshiphomosexualtattooprostitutephotographer
Period:
1980s2010s
Story:
female victimpsychopathic killerevil manmurder of a nude womanmurder spreeknife murderextreme violencedisturbed individualmeat cleaverserial murderslashinghuman monsterbad guyrampagevictim β€¦maniacstalkingsubjective camerablood splatterviolencebloodone word titlethreesomeflashbackfemale rear nudityphotographknifecell phonecorpseurinationremakecomputercameravomitingcar crashbathroomneighborhallucinationvoyeurfoot chasebound and gaggedwinestrangulationcocainestabbed to deathstabbed in the chestsubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguestabbed in the backkicked in the facetragic eventthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theaterart galleryschizophreniaapartment buildingpillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetnervous breakdownsevered legdead woman with eyes openmisogynymannequinwoman in bathtubvillain played by lead actorsuffocationconfusionstabbed in the handhiding in a closetsubway stationsexual perversionbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womantied up while barefootstrangled to deathschizophrenicbreaking through a dooronline datingbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β€¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
american horrorcult filmindependent filmsadistic horror
Themes:
evilsadisminsanitybrutalitypsychopathdeathrevengemurdersuicidekidnappingrapetortureescapeinvestigationvoyeurism β€¦seductionhumiliationabductioncrueltyvengeancemadnessrape and revengerape and murder (See All)
Mood:
slashernightnightmaregorehigh school
Locations:
cemeteryswimming poolforestlakerunning through the woods
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicefamily relationshipsfather son relationshipteenage girlreference to godself justice
Period:
1970s
Story:
serial teen murdererhomicidal maniacserial teen killerpsychopathic killerevil mansadistic psychopathdrive in classicbloody violencegraphic violencedisturbed individualserial murderhuman monsterbad guymadmanvictim β€¦grindhousemutilationmachetechainsawmaniacmurdererthroat slittingblood splatterpantiesfemale frontal nudityfemale nuditybloodviolencedoggunfemale rear nudityfightfemale full frontal nudityknifeshowershot to deathurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertstabbingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionringconvertiblefemale removes her clotheschickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralessnipples visible through clothingbeer drinkingsexual abuseice creamrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertprayingcannabisforced to striprunning awayspit in the facemisogynistphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthreading a newspaperchild molesterbakingstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellyhands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

The Fog (1980) is one of the best movies like Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (1980)

As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β€¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)

Subgenre:
american horrorcult filmindependent filmparanormalcreature feature
Themes:
evilfearrevengemurderdeathghostescapemonstersupernatural power
Mood:
darkness
Locations:
small townbarbeachchurchwaterrural settingseashipcampfirefishing boatghost ship
Characters:
mysterious villainterrorsheriffvillainmother son relationshipchildrenboyzombiepriestsingle motherlittle boyemployer employee relationshipcatholic priest
Period:
1980s1970syear 1979
Story:
grindhouse filmevil mandrive in classicbutcheryslashingmysterious manbad guyeye gougingslaughterpsychotronicbutchervictimgrindhousestabbed in the stomachlifting someone into the air β€¦mutilationchild in perilimpalementdecapitationdead bodysurprise endingchaseviolencebloodtwo word titleknifecorpsesworddemoncaliforniastabbingwomanstabbed to deathcursemicrophonestorytellingspeechcrosscult directorkillingundeadrecord playerpirategoldelectronic music scoremass murdergothictape recordercrucifixtreasurehitchhikercelebrationwoman in jeopardyreverse footagepower outageautopsyfogpierdark pastkilling spreelighthousedjliving deadspiral staircasejournalevil spiritblackoutradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulhookradio broadcasttragic villainmistphonograph recorddockscreepydisturbingmusic score composed by directorstained glass windowdemonicremadebayhorror movie remadefemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All)

The Texas Chainsaw Massacre (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chainsaw Massacre (2003)

Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t β€¦he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)

Subgenre:
independent filmsadistic horror
Themes:
sadisminsanitybrutalitypsychopathdeathmurdersuicidekidnappingtorturepolice brutality
Mood:
slashergorehorror movie remake
Locations:
backwoodsbarbathtubwheelchairpolice carroad tripgas station
Characters:
serial killermother son relationshippoliceboyfriend girlfriend relationshippolice officercrying babyevil sheriff
Period:
1970s
Story:
small town sheriffmasked villainmasked killerevil manmeat cleaverhillbillyhuman monstercar troublebody countlifting someone into the airmutilationchainsawmaniacobscene finger gestureimpalement β€¦massacreaxeblood splattersurprise endingviolencebloodknifevoice over narrationremakeshot in the headinterrogationpianotelephonesevered headno opening creditshit by a carpolice officer killedlocker roompigbasementchickendirectorial debutsevered armcowdismembermentmoonfalling down stairspot smokingnipples visible through clothingheavy raingroup of friendscowboy hathomicidefull moonsevered fingerthrown through a windowdisfigurementalienationtank topnewspaper clippingbarbed wirecrucifixionsexual perversionterritory name in titletrailer homemercy killingwhite trashsewing machineshot through the mouthwet t shirtslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linebodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Friday The 13th: A New Beginning?
<< FIND THEM HERE! >>