Please wait - finding best movies...
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorparanormal phenomenacult filmindependent film |
Themes: | murder of a police officerdrug addictionevilsupernatural powerpsychopathmonsterrevengedeathmurder |
Mood: | slasherhigh schoolraingore |
Locations: | new york cityseweramericacityseawoodsboat |
Characters: | slasher killermysterious villainserial killerserial murdererterrorteacher student relationshipvillainkillerpolice officerzombieteenage boyteenage girl |
Period: | 1980s |
Story: | psycho terrorpsycho killerwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainstatue of liberty new york citypsychopathic killerhit with a guitarmasked killerevil mansadistic psychopathmanhattan new york cityblack panties β¦white pantiesgirl stranglingserial teen murdererbig applekilled with a forkfriday the thirteenthjerseymutilated bodytrailer narrated by percy rodriguezjason voorheeslifting a female into the aireast coastspear gunpolice officer knocked unconsciousmurder of a nude womanlifeboattwin towersdead teenagerhockey maskstruck by lightningoff screen murdermurder spreeeighth partharpoonknife murderblond boybody paintmass murdererbutcheryghoulmetrotoxic wastelunaticdeformitydisembodied headcruise shipcrushed headaccidental shootingserial murdersummer campsequel to cult favoritebad guymadmanbeheadingcharacters killed one by onebody countstabbed in the eyeslaughterdead childdisembowelmentblack brabutchermale underwearback from the deadrampagemasked manpsycholifting someone into the airmutilationhypodermic needlemaniacundeadunderwaterattempted rapecharacter's point of view camera shotelectrocutionon the rundrowningnecklaceexploding carsubwaystabbed to deaththroat slittingimpalementvideo camerastabbingaxestrangulationnew yorkgangflashlightdecapitationguitarnumbered sequelhallucinationdemonmirrorblood splatterpantiesexplosioncharacter name in titlebare chested malenumber in titlefemale nudityviolencebloodsequel (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorparanormal phenomenacult filmsupernatural |
Themes: | murder of a police officerevilsupernatural powerpsychopathmonsterdeathmurderprisoninsanity |
Mood: | slashergorecar chasedarknessbreaking the fourth wall |
Locations: | americawoodsboatforestcemeterysmall townlake |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerzombiepoliceteenagersheriff |
Period: | 1980s |
Story: | psycho terrorpsycho killercrystal lake new jerseywessex county new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthmutilated bodyjason voorhees β¦lifting a female into the aireast coaststruck by lightninghockey maskdead teenageroff screen murdermurder spreeknife murderbutcheryghoulserial murdersummer campsequel to cult favoritebad guymadmanbeheadingbody countslaughterbutcherback from the deadrampagemasked manpsycholifting someone into the airmutilationmaniacundeadunderwaterelectrocutiondrowningstabbed to deathstabbingflashlightdecapitationnumbered sequeldemonblood splattercharacter name in titlenumber in titleviolencesequelsexflashbacksurprise endingmaskmassacreambulancesevered headchildlooking at the camerastalkingneck breakingmurderersevered armdismembermentkillingblood spattersplattermass murdergothicmachetevictimshovelstabbed in the headsevered legkilling spreebloodbathkillslashingactual animal killedsixth partstabbed in the facerecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimvillain not really dead clichepaintballhead ripped offreturning character with different actorreanimationdemonicdark and stormy nightdrive in classicgrave robbinggory violenceunderwater fightdouble impalementstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkcut to piecespolice officer crushedstabbing a police officerkilled by machete (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror |
Themes: | evilsupernatural powerpsychopathmurderdeathtorturebrutalityinsanitysadism |
Mood: | slashergorebreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerteenage boyteenage girlbrother sister relationshipmysterious killer |
Period: | 1980s |
Story: | psycho terrorpsycho killerwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthmutilated bodyjason voorhees β¦lifting a female into the aireast coastmurder of a nude womanhockey maskmurder spreeknife murderbutcherylunaticdeformityserial murdersummer campbad guymadmancharacters killed one by onebody countslaughterdisembowelmentbutcherback from the deadrampagemasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotstabbed to deathimpalementstrangulationdecapitationblood splatterpantiesnumber in titlefemale nuditysequelbloodviolencesexmale nuditybare breastsfemale frontal nuditymasturbationmale rear nudityfemale rear nuditysurprise endingcorpseunderwearmasklow budget filmsubjective camerasevered headchild in perillooking at the cameraskinny dippingstabbed in the backstalkingpremarital sexmurderercabinloss of motherobscene finger gesturekillingsexual attractionragemorguefourth partgrindhousetowelredneckhit in the crotchstabbed in the neckstabbed in the headdisfigurementbody landing on a carkilling spreecar troublemysterious manstabbed in the handkillhuman monsterslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facebloody violencevillain not really dead clichedisturbed individualgrindhouse filmcrime spreedeeply disturbed persondisturbingruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violencegruesomehead shavingcorkscrewaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sistersnose pushed into brainslaughteredmurder in a shower (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilpsychopathdeathmurderrevengefearbrutalityinsanitysadismexploitationpolice investigation |
Mood: | slasherraingorenightmarenightdarkness |
Locations: | americawoodscemeterysmall townbackwoods |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerpolicemother son relationshipteenagerbrother brother relationshipsheriffmysterious killercountry boy |
Period: | 1980s |
Story: | psycho terrorpsycho killerwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthjason voorheeseast coast β¦murder of a nude womanhockey maskmurder spreeknife murderbutcherylunaticcrushed headserial murdersummer campsequel to cult favoritebad guymadmancharacters killed one by onebody countstabbed in the eyeslaughterbutcherrampagemasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotthroat slittingimpalementaxedecapitationnumbered sequelblood splatterpantiesnumber in titlefemale nuditysequelviolencebloodsexbare breastsfemale frontal nuditykissdancingchasesurprise endingdigit in titledead bodylow budget filmsubjective camerasword fightmassacrechild in perilgravestalkerdeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexchainsawmachetebarnstabbed in the stomachgrindhousevictimmental institutionredneckitalian americanpsychotroniceye gougingaxe murderfifth partpsychoticcar troublemysterious manlaundrydefecationhuman monstercomic relieftombstoneslashinghillbillyeyeballmeat cleaverextreme violencegraphic violenceorchestral music scorestabbed in the facecut into piecesbloody violencefemale victimpsychotronic filmdisturbed individualgrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicideweirdosmall town sheriffbreakdancingdate in titlesequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musicgarden shearsimposterjumpsuitpopular musicgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimcopycat killervertigo shotlifting a woman into the airspike in the head (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorparanormal phenomenacult filmindependent filmsuspensesupernaturalcanadian horror |
Themes: | evilsupernatural powerpsychopathdeathrevengemurdersuicidekidnappingghostfeartorturedrunkennessdeath of fatherbrutalitydeath of mother β¦insanityabductiontraumafear of water (See All) |
Mood: | slasherhigh schoolraingorenightmarebreaking the fourth wallblood and gore |
Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerzombieteenage boyteenage girlfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshiplittle girl β¦sheriff (See All) |
Period: | 2000s |
Story: | psycho terrorpsycho killerwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthjason voorheeseast coast β¦hockey maskdead teenagermurder spreeeighth partmass murdererbutcheryghouldeformityserial murdersummer campbad guymadmanbeheadingcharacters killed one by onebody countslaughterbutcherrampagemasked manpsycholifting someone into the airmutilationmaniacundeadcharacter's point of view camera shotelectrocutiondrowningimpalementstabbingdecapitationdemonblood splatterexplosioncharacter name in titleviolencesequelbloodflashbackphotographpartysurprise endingpistolshowerfirevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashfoot chasesevered headdream sequencechild in perilunderwater scenevanskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on firecover updeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingsplatterchild murderburned aliveheroinemass murdermachetecomaragesevered handvictimgoatcrushed to deathsevered fingermisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingdemonic possessionkilling spreegeekburned to deathnewspaper clippingtorso cut in halfblood on camera lensmysterious manfinal showdownnecrophiliakilldockohiolockerevil spiritsexual violencestonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawbloody violencefemale victimpsychotronic filmbreaking through a doorvillain not really dead clichechild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twomidwestchild killerobituarychild murdererhand through chesttorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violencelucid dreamsataniccamp counselorgruesomedouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegermonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererevil versus evilkilled with machetekiller vs killerdreams vs realitykilled by machete (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | slasher flickamerican horrorcult film |
Themes: | psychopathdeathmurderrevengeabductionexploitation |
Mood: | slashergoredarkness |
Locations: | woodslake |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenage boyteenage girlteenagerboyfriend girlfriend relationshiplow self esteemmysterious killer |
Period: | 1980s |
Story: | psycho killercrystal lake new jerseywessex county new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathfriday the thirteenthjason voorheeseast coasthockey maskmurder spree β¦mass murdererdeformityserial murdersequel to cult favoritebad guymadmancharacters killed one by onestabbed in the eyeslaughterrampagemasked manpsycholifting someone into the airmaniaccharacter's point of view camera shotimpalementaxenumbered sequelnumber in titlesequelbloodsexnudityshowerdigit in titlebikinimasksubjective camerathird partmurderercabinsevered armdismembermentsplattermass murdermacheteragebarnroman numeral in titlesevered handgrindhousestupiditystabbed in the throat3 dimensionalconvenience storepsychotronickilling spreetorso cut in halfcar troubledefecationhuman monstersexual violenceslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoreknittingpitchforksole survivorpsychotronic filmbiker gangdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinggiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violencegruesomedorkcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainekilled with machetesack maskpopcorn making (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmsuspenseb horrorindependent horror |
Themes: | evilpsychopathmurderdeathfearbrutalityinsanityexploitation |
Mood: | slashergoredarkness |
Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerteenagerboyfriend girlfriend relationshipmysterious killer |
Period: | 1980ssummeryear 1984 |
Story: | psycho terrorpsycho killercrystal lake new jerseywessex county new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthjason voorheeslifting a female into the air β¦east coastmurder of a nude womanmurder spreeknife murderbutcherylunaticserial murdersummer campbad guymadmancharacters killed one by onebody countslaughterbutcherrampagemasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotthroat slittingimpalementstrangulationdecapitationnumbered sequelblood splatterpantiesnumber in titlefemale nudityviolencebloodsequelsexfemale frontal nudityflashbackkissfightnipplessurprise endingtelephone callcorpsedigit in titleblondeslow motion scenecatbikinimasksecond partdead bodysubjective cameraswimmingbramassacrejokesevered headcontroversyskinny dippingstalkerprologueopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexkillingsplatterchesschainsawfireplacespearnipples visible through clothingmass murdergothicmacheteragevillainessphone boothgrindhousevictimredneckbra and pantieshit in the crotchpsychotronicstabbed in the headbetrefrigeratorlens flarekilling spreepsychoticnude swimmingcar troublemysterious manreturning character killed offhuman monsterfreakskirtsexual violenceslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murderpitchforkbloody violencesole survivorpsychotronic filmdying during sexvillain not really dead clichegrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicideweirdodisturbingtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classichorror movie remadesickolost dogice pickcampfire storygruesomedouble impalementbad jokeatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorechild psychologyfade to whitesack maskscare involving catkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmindependent horror |
Themes: | evilpsychopathmurderdeathdrugsrapetortureincestbrutalityinsanityexploitationmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerbrother sister relationshipprostitutemurder of a prostitute |
Period: | 1980s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmutilated bodymurder of a nude womanoff screen murdermurder spreeknife murderbutcheryserial murderbad guymadman β¦body countstabbed in the eyeslaughterbutcherrampagepsychomutilationmaniacattempted rapestabbed to deathvideo camerastabbingstrangulationdecapitationblood splattercharacter name in titlefemale nuditybloodviolencenuditybare breastsgunsurprise endingshot to deathshot in the chestlow budget filmmarijuanacriminalbisexualdrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerstalkingneck breakingdismembermentkillingsplatterfemale stockinged legsragestabbed in the stomachrapistlow budgetdark humorpsychotronicperversionmurder of a childabusive fatherkilling spreepervertvillain played by lead actormysterious mankillhuman monstersexual violenceslashingnaked dead womanextreme violencevideo footagematricidecut into pieceschild rapebroken neckdisturbed individualgrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersgraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent filmsuspenseteen moviemurder mystery |
Themes: | evilpsychopathmurderrevengedeathfearvoyeurismcorruptionbrutalityinsanityhumiliationsadismcrueltytraumamysterious death |
Mood: | slashergorenightdarknessblood and gore |
Locations: | woodsboatcarmotorcyclewaterrural settingpolice carlaketruck |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerpolice officerteenage boypoliceteenagerfriendpolicemanartistmother β¦sherifftruck driver (See All) |
Period: | 1970s1950ssummer |
Story: | psycho terrorpsycho killercrystal lake new jerseywessex county new jerseynew jerseyhomicidal maniacpsychopathic killersadistic psychopathfriday the thirteenthjerseyjason voorheeseast coastdead teenageroff screen murdermurder spree β¦knife murderblond boybutcheryserial murdersummer campbeheadingcharacters killed one by onebody countslaughterdisembowelmentbutcherrampagepsychomaniacstabbed to deaththroat slittingstabbingaxedecapitationguitarhallucinationblood splatterpantiesbare chested malenumber in titlefemale nudityviolencesexmale nuditybare breastsmale rear nuditykissfemale rear nuditynipplesthree word titlesurprise endingbeatingcorpsedigit in titlefistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanavoyeursubjective camerabedroombracandleold manmassacrewomandineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitgrindhousevictimdead womanfull moonbra and pantieslow budgetstabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingsurpriseatticperversiondead manlens flareaxe murderroomkilling spreearrowdeath of loved onetank toppsychoticphysical abuset shirtjoysexual awakeningcar troublemysterious manshortsdead animalhuman monstercanoeadolescencerepressionsexual perversionrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gamepillowbloody violencesole survivortraumatic experiencefemale victimwet clothesgrudgevillain not really dead clichegrindhouse filmmurder victimcrime spreecurtaintroubled teenbitingmystery killersweateraxe in the headmultiple homicidemistreatmentfemale serial killerweirdoawakeningdate in titledisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementaxe murdererbad girlcamp counselorcampfire storygruesomeunknown killerbody mutilationatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | evilpsychopathdeathmurderdrugsparanoiainsanityabductionalcoholism |
Mood: | slasherhigh schoolnightmare |
Locations: | schoolsmall townelevatorkitchentruck |
Characters: | slasher killermysterious villainserial killerterrorvillainteenage boyteenage girlfamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipgirlnurse β¦policemansecurity guardalcoholicsecretary (See All) |
Period: | 1990syear 1998 |
Story: | psycho terrorpsycho killerhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathdead teenagermurder spreeknife murderserial murderbad guymadmanbeheading β¦characters killed one by onebody countrampagemasked manpsycholifting someone into the airmaniaccharacter's point of view camera shotstabbed to deaththroat slittingstabbingaxeflashlightdecapitationhallucinationnumber in titleviolencebloodsequelknifechasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighbortelephonesubjective cameragood versus evilhalloweenwinecandlecaliforniaambulancedeath of friendtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformmistaken identityactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorrageloss of friendhidingvictimfaked deathtrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinnewspaper clippinghockeyreflectionstolen caranniversarycar troublemysterious manfire extinguisherreturning character killed offhiding in a closetgateslashingbody baggraphic violencestabbed in the facehiding placebloody violencebutcher knifefemale victimvillain not really dead clichesittingseventh partmichael myersdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent film |
Themes: | murder of a police officerevilpsychopathdeathmurderrevengefeardeceptionsurveillance |
Mood: | slashergoresatire |
Locations: | woodsforestkitchenwheelchairrooftopfire truck |
Characters: | slasher killerserial killervillainkillerteenage boyteenage girlnursesecurity guardpsychiatristcoroner |
Period: | 2000s |
Story: | homicidal maniacpsychopathic killermasked killerevil mansadistic psychopathlifting a female into the airdead teenagereighth partserial murdersequel to cult favoritebad guycharacters killed one by onebody countblack brarampage β¦masked manlifting someone into the airmaniaccharacter's point of view camera shotelectrocutionstabbed to deaththroat slittingimpalementaxestrangulationflashlightdecapitationmirrorblood splatterfemale nudityviolencesequelbloodflashbacktwo word titlefightknifechasesurprise endingfirecell phonecorpsefistfightwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseambulancemontagestabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backproduct placementkicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingchainsawheavy rainsecurity cameraloss of loved onemorgueskullfatebroken legmental institutionstabbed in the throatstabbed in the heade mailrainstormraised middle fingergasolineaxe murdercasual sexkilling spreenewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatormichael myersboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | psycho thrillerslasher flickamerican horrorcult filmsuspenseholiday horror |
Themes: | murder of a police officerpsychopathmurderdeathjealousyfeartorturevoyeurismmemoryseductionbrutalityobsessionparanoiainsanityblindness β¦traumamadnessmurder investigationpsychological trauma (See All) |
Mood: | slashergorenightdarkness |
Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerpolice officerteenage girlpoliceteenagerboyfriend girlfriend relationshipnursedetectivepolicemansheriff |
Period: | 1970syear 1978 |
Story: | psycho terrorpsycho killerhomicidal maniacmasked villainpsychopathic killermasked killersadistic psychopathserial teen murderermurder spreeknife murderbutcheryserial murderbad guymadmancharacters killed one by one β¦body countstabbed in the eyeslaughterbutcherback from the deadrampagemasked manpsycholifting someone into the airmutilationhypodermic needlemaniaccharacter's point of view camera shotnecklacestabbed to deaththroat slittingstabbingstrangulationflashlightblood splatterexplosionnumber in titlefemale nudityviolencebloodsequelsexnuditymale nuditybare breastsmale rear nuditytwo word titlekissfemale rear nuditycigarette smokingnipplesknifechasetelephone callfirecryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenold manambulanceaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womanattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisonproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapmurderersplattertv newssyringedestructionelectronic music scoresexual attractioncowboy hatwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolgrindhousepsychologistbuttdriving a cardead womantowelhomicidepresumed deadcamera shot of feetstabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingdisfigurementdark pastdead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokeflat tirefemale stockinged feetdead girlconfusioncar troublemysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonesuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murderroman numbered sequelbloody violencebutcher knifeman on firepool of bloodfemale victimscarenude bathingsilhouettevillain not really dead clichegrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidemidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanvulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | psycho thrillerslasher flick |
Themes: | murder of a police officerevilpsychopathmurderrevengedeathtorturedrunkennessbrutalitydeath of mother |
Mood: | slashergoredarknesshorror movie remake |
Locations: | woodsboatforestmotorcyclebathtubbicyclewaterpolice carlakecampfiretunnelschool busbackwoodssex in a tent |
Characters: | mysterious villainserial murdererterrorvillainkillerteenage girlafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipsheriffasian americanblonde girlgirl nudity |
Period: | 1980s |
Story: | psycho terrorpsycho killerwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathserial teen murdererfriday the thirteenthmutilated bodyhockey mask β¦knife murderdeformityserial murdersummer campbad guybeheadingcharacters killed one by onebody countstabbed in the eyerampagemasked manpsychomutilationmaniacdrowningstabbed to deaththroat slittingimpalementvideo camerastabbingaxestrangulationflashlightdecapitationhallucinationblood splatterbare chested malenumber in titlefemale nudityviolencebloodnuditybare breastsfemale frontal nuditymasturbationdogsex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topcorpsedigit in titleurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanaalcoholswimmingbracandletoplessmassacredeath of friendstabbed in the chestsevered headcultscantily clad femalebreast fondlingskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditscaptivewalkie talkiebuttockscampcovered in bloodrear entry sexgrocery storebackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a caraxe murdersevered legarrowburned to deathpsychoticmannequinplantvillain played by lead actorporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessspitting bloodtelevision setpool of bloodfemale victimold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesskitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrortragedy |
Themes: | murder of a police officerevilpsychopathdeathmurdersuicidekidnappingrapetorturebrutalitydysfunctional familyinsanitysadismhome invasionpolice investigation β¦mysterious death (See All) |
Mood: | slashergoredarknessblood and gore |
Locations: | small townstrip club |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenagerafrican americanboyfriend girlfriend relationshipboyhostagepsychiatristsheriff |
Period: | 1970s |
Story: | psycho terrorpsycho killermasked villainpsychopathic killermasked killerevil mansadistic psychopathkilled with a forkmutilated bodylifting a female into the airmurder spreeknife murdermass murdererbutcheryserial murder β¦bad guymadmancharacters killed one by onebody countbutcherrampagemasked manpsycholifting someone into the airmaniaccharacter's point of view camera shotdrowningstabbed to deaththroat slittingimpalementstabbingstrangulationblood splatterfemale nuditybloodviolencesexmale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifechasepistolwoman on topbeatingcorpseremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective cameramassacrestabbed in the chestjokechild in perilcontroversygraveyardauthorbeaten to deathstabbed in the backattackuniformbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderrageloss of friendpsychologistvictimhome moviebroken legcrime scenetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childdark pastbroken armduct tapekilling spreepumpkinbloodbathpsychoticswearinghit with a baseball batpervertmexican americanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermatricidebloody violencebutcher knifeloss of familyfemale victimdying during sexanimal killingvillain not really dead clichejack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidemidwestweirdocreepymichael myersdisturbingdeath of petloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manchoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanemonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent filmteen movieholiday horror |
Themes: | evilpsychopathdeathmurderfearcorruptionparanoiamurder of family |
Mood: | slasherhigh schoolnight |
Locations: | carsmall towncar theftkitchen knife |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenage boyteenage girlhusband wife relationshipteenagerboyfemale protagonistgirllittle girllittle boy β¦psychiatristdoctor patient relationship (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | psycho terrorpsycho killerhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathdead teenageroff screen murdermurder spreeknife murderserial murderbad guymadman β¦body countmasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotstabbed to deaththroat slittingstabbingstrangulationblood splatterfemale nudityviolencenudityone word titledogguncigarette smokingtitle spoken by characterknifesurprise endingshot to deathshot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenchildgunshotattempted murderprologuesuburbfirst of seriespay phonehalloween costumelong takestalkingmurdererfirst parthandgunkillingpot smokingteen angstbulletelectronic music scorebabysitterstabbed in the stomachblockbustergrindhousedead womanwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonedead doggothmental patientyellingclosethiding in a closetkillhuman monstersuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpenterknittingbutcher knifefemale victimwetnessvillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbmidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phoneheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | slasher flickamerican horrorteen horrorcult filmindependent filmteen movieindependent horror |
Themes: | evilsupernatural powerpsychopathrevengemurdersurrealismfuneral |
Mood: | slasherhigh schoolgorenightmareavant garde |
Locations: | cemeterybathtubpolice station |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerteenage girlhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipalcoholicpolice chase β¦self mutilationpolice lieutenant (See All) |
Period: | 1980s |
Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathdead teenagerbutcheryserial murderbad guymadmancharacters killed one by onebody countbutcherpsycholifting someone into the air β¦maniaccharacter's point of view camera shotstrangulationdemonmirrorblood splatterbare chested maleviolencebloodcigarette smokingsurprise endingdreamcorpseface slapslow motion scenearrestfalling from heightbedjailclassroomtelephonesubjective cameragood versus evilfoot chasedeath of friendstabbed in the chesthousecoffeeperson on firefirst of serieshangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothichatcrucifixgrindhousevictimstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementcellaralarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clichegrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormalindependent horror |
Themes: | evilsupernatural powerpsychopathmonsterdeathmurdersurrealismdrugsghosttorturedeath of motherinsanitysadismamnesia |
Mood: | slasherhigh schoolraingorenightmaredarkness |
Locations: | small townairplaneroad trip |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherself mutilationyounger version of characterdeafnessgerman american β¦evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreebutcheryghoullunaticserial murderbad guymadmanbody countslaughter β¦butcherback from the deadrampagepsychomutilationmaniacundeadimpalementstrangulationdemonblood splattercharacter name in titlebare chested maleviolencebloodsequelf ratedflashbacktitle spoken by characterknifefirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titlecriminalsubjective cameragood versus evilstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueknocked outkicked in the facescene during end creditsexploding bodymurdererkillingchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothvictimorphanagerapistcameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actorstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violenceanimal killinghusband murders wifefairsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks β¦the colonists in a whole new environment. (Read More)
Subgenre: | teen horrorindependent filmmartial artsblack comedysuspensedark comedyb movieabsurdismfish out of water |
Themes: | supernatural powerpsychopathmonsterdeathmurderfearescapemilitarybrutalityparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
Mood: | slashergoreambiguous ending |
Locations: | woodslakeouter spacelaboratoryspace stationresearch stationship explosion |
Characters: | terrorteacher student relationshipvillainteenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyprofessorengineerbabe scientist |
Period: | 2000s |
Story: | crystal lake new jerseywessex county new jerseynew jerseymasked villainpsychopathic killermasked killerevil manfriday the thirteenthmutilated bodyjason voorheesmurder of a nude womanhockey maskmass murdererdisembodied headcrushed head β¦summer campmadmancharacters killed one by oneslaughterback from the deadrampagemasked manmutilationhypodermic needleundeadelectrocutionstabbed to deaththroat slittingimpalementstrangulationflashlightdecapitationnumbered sequelblood splatterexplosioncharacter name in titlebare chested malenumber in titlefemale nudityviolencebloodsequelfemale frontal nudityflashbacksex scenekissfightnipplesknifechasesurprise endingpistolfirebeatingcorpseshot to deathfistfightmachine gunshot in the chestface slapshot in the headshotgunrescuepunched in the facecomputerfalling from heightmaskshowdownrifleheld at gunpointhand to hand combatrobotkung fuscientistshot in the backsurvivalambushmassacremixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotstalkerbeaten to deathdangerstabbed in the backprologuekaraterace against timekicked in the facetough girlinjectionstalkingexploding bodyneck breakingthreatened with a knifemercenarysevered armlove interestkissing while having sexdismembermentsurgerysabotageelectronic music scoremass murdermachetecowboy hatroman numeral in titlestabbed in the stomachspacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityandroidpresumed deadcyborgdual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramdisfigurementknife throwingfemale doctorsevered legtank topgatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierface maskfemale fighterhuman monsterslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingmedical studentbody bagdeath of boyfriendstabbed in the shoulderextreme violencemicroscopewoman fights a manroman numbered sequelman wearing glassesmorphinearm cut offfemale victimarmy basestupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airsuspended animationliquid nitrogenrobot as pathosspaceship crashleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestkilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | murder of a police officerevilpsychopathmurderdeathkidnappingrapetorturetheftinsanitysadismphotographywritingrape and murder |
Mood: | slashergoreneo noir |
Locations: | barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car |
Characters: | slasher killerserial murdererterrorvillainkillerpoliceboyfriend girlfriend relationshipwriterhostagewaitresschinese foodshooting a police officer |
Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathblack pantiesmass murdererbutcherylunaticserial murderbad guymadmanbody countblack brabutcher β¦male underwearrampagepsychomutilationmaniacstabbed to deathblood splatterbare chested malefemale nuditybloodviolencesexnuditymale nudityone word titlemale rear nuditygunfightcigarette smokingphotographtitle spoken by characterpistolshot to deathcar accidentshot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upgay slurjournalistcalifornianarrationjourneystabbed in the backon the roadautomobilemurdererkillingarsontape recorderragestabbed in the stomachvictimrape victimrapistrednecktensionstabbed in the throatgash in the facedark humorbilliardsperversionrainstormsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertkillpistol whiphuman monsterpolice officer shot in the chestsexual violenceknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendbreaking a bottle over someone's headcrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | psycho thrilleramerican horrorblack comedysupernatural |
Themes: | evilsupernatural powerpsychopathdeath |
Mood: | slasherraingorecar chase |
Locations: | chicago illinoisschool buswater gun |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerhusband wife relationshippoliceboyteachernew student |
Period: | 1990s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcherysequel to cult favoritebad guymadmanbody countstabbed in the eyebutcherpsycholifting someone into the air β¦maniacelectrocutionstabbed to deaththroat slittingstrangulationsequelbloodcigarette smokingsingingpunctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedambulancestabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathpossessiondolllightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturefalling down stairsburned alivegothictied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingersocial workersevered legvoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravelocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation |
Themes: | evilsupernatural powerpsychopathmonstermurderdeathghostfuneralinsanitysadism |
Mood: | slashergorenightmare |
Locations: | barchurchcemeteryschool boy |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle motherself mutilation β¦alcoholic fatherevil nurse (See All) |
Period: | 1980s |
Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathlifting a female into the airdead teenagermurder spreebutcheryghouldisembodied headserial murderbad guymadmancharacters killed one by one β¦body countstabbed in the eyedead childbutcherback from the deadrampagelifting someone into the airmaniacundeadstabbed to deathimpalementstabbingdecapitationnumbered sequeldemonblood splatterbare chested malenumber in titlefemale nudityviolencesequelbondagecigarette smokingsurprise endingfiredreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicbathroomfoot chasenewspaperdeath of friendsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollskeletonisolationbasementmurderercharacter says i love youkillingsplatterfalling down stairsteen angstelectronic music scorecomaragetied to a bedcrucifixvictimclockdrug overdoseswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformjumping through a windowknife fightfogdisfigurementkilling spreepajamassmokealleyreturning character killed offohioevil spiritabandoned housestabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagewheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattressgymnasticsvillain not really dead clichesolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdisturbingbonesbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β¦are after the backpackers find a way to escape. (Read More)
Subgenre: | slasher flickcult filmindependent filmsuspenseaustralian horrorsadistic horror |
Themes: | evilpsychopathmurderdeathkidnappingrapedrinkingfeartorturedrunkennessescapebrutalityinsanitysadismabduction β¦exploitationcruelty (See All) |
Mood: | slashergorecar chasenightdarknessblood and gore |
Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β¦australian outbackcar on fireshed (See All) |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilationmysterious killer |
Period: | year 1999 |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreeknife murdermass murdererbutcheryserial murderbad guymadmancharacters killed one by onebody count β¦slaughterbutcherrampagepsychomutilationmaniacattempted rapestabbed to deathimpalementvideo camerastabbingflashlightguitarmirrorblood splatterexplosionviolenceblooddogtwo word titlegunkisscigarette smokingphotographtitle spoken by charactersingingpartyknifechasebased on true storysongcorpseshot to deathcar accidentshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurshot in the backf wordswimminggay slurbound and gaggedmassacrefalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentpursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangervictimhome movierapisthomiciderednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultkilling spreebloodbathdrugged drinkreflectionpervertbarking dogcar troublemysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootwaking upbloody violencesole survivorfemale victimkangaroocar rolloverdriving at nightvillain not really dead clichedisturbed individualgrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | slasher flickamerican horrorteen horrorparanormal phenomenacult filmsupernaturalparanormalbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | evilsupernatural powerpsychopathmonstermurderrevengedeathfriendshipsurrealismkidnappingghostfearescapevoyeurismbrutality β¦paranoiasadismpanicmysterious deathshower murder (See All) |
Mood: | slasherhigh schoolraingorenightmaredarknesspoetic justice |
Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenage boyteenage girlfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationship β¦teenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteachergirlstudentpolicemanlittle girlself mutilationdrivergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathserial teen murderermurder spreebutcheryserial murderbad guymadmanbody countbutchermale underwear β¦back from the deadrampagepsycholifting someone into the airmutilationmaniacundeadcharacter's point of view camera shotstabbed to deathimpalementstabbingnumbered sequelhallucinationdemonblood splattercharacter name in titlebare chested malenumber in titlesequelbloodviolencenuditymale nuditymale rear nuditybondagedogfightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighborvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrebasketballfootballstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firepossessionkicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musicjoggingmousestabbed in the stomachbarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mfull moondamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorgrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | american horrorindependent filmsuspenseindependent horrorsadistic horrorslasher horrorhorror b movie |
Themes: | murder of a police officerevilpsychopathmurderdeathtortureescapebrutalityinsanitysadismhome invasionexploitationcruelty |
Mood: | slashergorenightblood and gore |
Locations: | strip clubtrying to escape |
Characters: | mysterious villainserial killerterrorvillainkillerteenage girlhusband wife relationshipfather daughter relationshipteenagermother daughter relationshiphostagethiefself mutilationtalking to oneself in a mirrorthe family β¦mysterious killerkiller dogdirector of photography (See All) |
Story: | psycho killerhomicidal maniacmasked villainpsychopathic killermasked killerevil mansadistic psychopathmutilated bodymurder spreebutcheryserial murderbad guycharacters killed one by onebody countstabbed in the eye β¦slaughterdisembowelmentbutcherrampagemasked manpsychomutilationmaniacelectrocutionstabbed to deathimpalementstabbingflashlightmirrorblood splattercharacter name in titlefemale nudityviolencebloodbare breastsfemale frontal nudityflashbacktwo word titlefightcigarette smokingnipplesknifelesbian kisssurprise endingpistolbeatingcorpseshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingdebtscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackhomicideeaten alivewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facepsychotronicescape attemptscissorsscene after end creditsperversiontitle at the endknife throwinggasolineboxbloodbathpsychoticdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wiremysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodsheddead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firedragging a bodyviolent deathgrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiredead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | american horrorcult filmindependent filmmartial artsblack comedysuspensesupernaturalparanormal |
Themes: | evilsupernatural powerpsychopathmurderrevengefuneral |
Mood: | slasherhigh schoolraingorenightmare |
Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress |
Period: | 1980s |
Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreebutcheryserial murderbad guybutcherback from the deadrampagelifting someone into the airmutilationmaniac β¦undeadunderwaterstabbed to deathnumbered sequeldemonblood splatterbare chested malenumber in titlebloodsequelfemale frontal nuditydogcigarette smokingphotographsurprise endingfiredreamcorpsedigit in titleurinationface slappunched in the faceplace name in titlerock musiccar crashneighborambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phonekicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurderersevered armsleepingkillingpizzasurgeryteen angstelectronic music scoreslow motionwoman with glassesstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | evilpsychopathdeathmurderfriendshipsurrealismkidnappingrapefeartorturedeath of fatherbrutalitydeath of motherinsanitysadism β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | slashergorenightmarecar chasenightdarknessblood and gore |
Locations: | woodshospitalforestbathtubrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerteenage girlfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationship β¦friendboybrother sister relationshipfemale protagoniststudentbest friendfrenchbest friendsmysterious killerdeath of boy (See All) |
Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreebutcheryserial murderbad guymadmancharacters killed one by onebody countslaughterbutcherrampage β¦psychomutilationmaniacon the runthroat slittingimpalementstabbingaxeflashlightdecapitationmirrorblood splatterfemale nudityviolencebloodf ratedbare breastsfemale frontal nudityflashbackmasturbationdogguncigarette smokingphotographknifelesbian kisschasesurprise endingshowertelephone calldreamcorpsecar accidenturinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective camerasurvivalbound and gaggedmassacrestabbed in the chesthousesevered headscantily clad femalevandolldeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachsevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistperversionmurder of a childswingclassmateaxe murdersexual assaultkilling spreeparrotdead dogbeing followedpervertblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a doghuman monsterfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimvineyardchainsdriving at nightdisturbed individualgrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)
Subgenre: | slasher flickamerican horrorcult filmindependent filmholiday horror |
Themes: | evilpsychopathmurderpanic |
Mood: | slashergore |
Locations: | schoolcarsmall townpolice stationrooftop |
Characters: | slasher killermysterious villainserial killerteenage girlteenagergirlsister sister relationshipcrying girl |
Period: | 1980syear 1988 |
Story: | psycho killerhomicidal maniacmasked villainpsychopathic killermasked killerevil manoff screen murdermurder spreeknife murderserial murdermadmancharacters killed one by onebody countrampagelifting someone into the air β¦maniaccharacter's point of view camera shotelectrocutionthroat slittingimpalementflashlightnumbered sequelcharacter name in titlenumber in titlebloodsequeldoggunknifesurprise endingdigit in titleshot in the chestfalling from heightmasksubjective cameragood versus evilhalloweenambulanceanimalpart of serieshit by a carpolice officer killedhalloween costumepickup truckfalling down stairsfourth parthitchhikingpump action shotgunchild's point of viewseven word titlemanhuntpower outageattickilling spreedead dogreturning character killed offhuman monstertrick or treatingalarmelementary schoolteasingkiss on the lipsmatchillinoisvillain not really dead clichecrime spreeescaped mental patientlifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecesmall town sheriffmichael myerschild murdererlifting male in airscarred facehalloween prankboogeymandeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldjumpsuitthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowoctoberkilling the wrong personteenager in dangersanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psycho thrilleramerican horrorteen horrorblack comedysuspensesuperherotragedysurvival horrorpsychological thriller |
Themes: | psychopathmonstermurderdeathfriendshipsurrealismkidnappingrapebetrayalfearescapefuneraldeceptionvoyeurismdeath of father β¦brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | woodstrainforesttaxikitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerpolice officerteenage girlfather daughter relationshipteenagerafrican americandoctorhostagesecurity guardpsychiatrist β¦uncle niece relationshippolice dog (See All) |
Period: | 2010s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopatheast coastdead teenagerserial murderbad guycharacters killed one by onebody countrampagepsychohypodermic needle β¦maniaccharacter's point of view camera shotnecklaceflashlightpantiesbare chested maleviolencesequelbloodone word titleflashbackdogdancingtitle spoken by characterpartyknifechasesurprise endingcell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womantransformationtrainingattempted murderstalkerdangermissing persontentknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingrevelationheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskpump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastkilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayweirdoflesh eatingdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophagusair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmblack comedydark comedysurvival horror |
Themes: | evilpsychopathdeathmurderkidnappingdeceptionincestinsanitymental illnesssadismhome invasiongreedcannibalismwealthstarvation β¦claustrophobia (See All) |
Mood: | slashergoresatiredarknesssocial satire |
Locations: | los angeles californiaslum |
Characters: | terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
Period: | 1990s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmutilated bodymurder spreedeformityserial murderbad guymadmanbody countrampagemasked man β¦psychomutilationmaniacelectrocutionimpalementflashlightblood splatterviolenceblooddogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathshot in the chestface slapshotgunbirthdaymansionhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbdolldeath of childskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragestabbed in the stomachspidersevered handgrindhouseskullsadomasochismsevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordgothperverthiding in a closetold dark houseschemeevictionhuman monsterlighterfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbartrapdoorwhite dresswoman slaps a mandisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | slasher flickamerican horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationbody horrorurban fantasy |
Themes: | evilsupernatural powerpsychopathmonstermurderdeathfriendshiprapeghostpregnancyfearinvestigationbrutalitydepressioninsanity β¦sadismtrauma (See All) |
Mood: | slashergorenightmare |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctor β¦boyfemale protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmutilated bodylifting a female into the airmurder spreeghoulserial murderbad guymadmancharacters killed one by onebody count β¦slaughterback from the deadrampagelifting someone into the airmutilationmaniacundeadimpalementstabbingflashlighthallucinationdemonblood splatterbare chested malefemale nuditybloodsequelviolencesexf ratednuditybare breastsflashbackgunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashgood versus evilfoot chasedisguiseambulancedeath of frienddinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicniccelebrationmental institutiondamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childdisfigurementdark pastbarefoot femalegay stereotypeasylumfifth partkilling spreepsychoticnewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthmental patientmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencepsychotronic filmwet clothescut handfetusbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someoneplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketcharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A β¦t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
Subgenre: | psycho thrilleramerican horrormartial artssuspense |
Themes: | evilpsychopathdeathmurderescapelonelinesshunting |
Mood: | slashergorenightmarecar chaseblood and gore |
Locations: | sewerwoodsbarforesthelicoptersnowbicycle |
Characters: | slasher killerserial killerserial murdererterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship |
Period: | 1990s2000s |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmurder spreeknife murderbutcheryserial murderbad guymadmancharacters killed one by onebody countslaughter β¦butcherpsychomutilationmaniacthroat slittingimpalementstabbingstrangulationblood splatterviolencebloodflashbackknifechasepistolshootoutcorpseshot to deathfistfightmachine guncar accidentshot in the headcatgunfightbrawlfalling from heightvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingmassacredeath of friendbridgestabbed in the chestone man armypolice officer killedshot in the foreheadduelkaratefbifugitivemurderercabinwaterfallsevered armobscene finger gesturedismembermentsubtitled scenekillingwolfstabbed in the stomachhunterswat teamvictimhonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandocaptureknife throwingdark pastwar veteransevered legkilling spreefountainpostcardhuman monsterstabbed in the armslashingyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the facemilitary trainingbloody violencemass graveportland oregonsevered footdisturbed individualhoodcrime spreedeeply disturbed personauto theftjumping off a bridgebritish columbiapacific northwestdisturbingkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraygruesomebasic trainingbody partsethnic cleansingpsycho filmdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to β¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmsuspensepsychological horror |
Themes: | psychopathdeathmurdermarriagemoneyfearfuneraldeceptionvoyeurismdivorcetheftguiltinsanitydatingmental illness β¦unrequited lovemadness (See All) |
Mood: | slasherraindarknessbreaking the fourth wall |
Locations: | churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfamily relationshipsmother son relationshipfriendpolicemansister sister relationshipthiefpsychiatristsecretarysheriff |
Period: | 1960syear 1960 |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killersadistic psychopathmutilated bodylifting a female into the airmurder of a nude womanmurder spreeknife murderbutcheryserial murderbad guymadmancharacters killed one by one β¦body countblack brabutcherpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotstabbed to deathstabbinghallucinationbare chested maleviolencebloodbased on novelone word titleinterviewflashbackphotographsurprise endingshowertelephone callvoice over narrationcorpseunderweararrestundressingsecretbathroomjailvoyeursubjective cameragood versus evilnewspaperbracaliforniadisguisewomanwidowtoiletstabbed in the chestbirdbathold womanstalkerwidowerfirst of seriesmistaken identitymissing personscreamlong takefemale removes her clothescountrysidewitnessbasementtrapmurdererfirst partthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintingblockbusterimpersonationphone boothgrindhousevictimskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatswamparizonarainstormextortionnervous breakdowncellardead woman with eyes openmeetingdead motherphonefemale in showerbloodbathpsychoticfemale stockinged feetimpotencevillain played by lead actormysterious mandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodyslashingdomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricidebloody violencefemale victimreclusesilhouettefade to blackpeep holedisturbed individualgrindhouse filmcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All) |
Determined to finish off the infamous killer Jason Voorhees once and for all, Tommy Jarvis and a friend exhume Jasonβs corpse in order to cremate him. Things go awry when Jason is instead resurrected, sparking a new chain of ruthlessly brutal murders. Now itβs up to Tommy to stop the dark, devio β¦us and demented deaths that he unwittingly brought about. (Read More)
Subgenre: | slasher flickamerican horrorteen horrorcult filmsuspensesupernatural horror |
Themes: | evilsupernatural powerpsychopathmonstermurderdeathprisonfearbrutalityinsanitysadism |
Mood: | slashergorecar chasedarknessbreaking the fourth wall |
Locations: | americawoodsboatforestcemeterysmall townpolice stationlakeschool bus |
Characters: | slasher killermysterious villainterrorvillainkillerzombiepolicefather daughter relationshipteenagerfriendsheriff |
Period: | 1980s |
Story: | psycho terrorwessex county new jerseycrystal lake new jerseynew jerseyhomicidal maniacmasked villainmasked killerevil mansadistic psychopathfriday the thirteenthmutilated bodyjason voorheeseast coastlifting a female into the airdead teenager β¦struck by lightninghockey maskoff screen murdermurder spreeknife murderserial murdersummer campsequel to cult favoritebad guybody countslaughterbutcherback from the deadrampagemasked manlifting someone into the airmutilationmaniacundeadelectrocutiondrowningstabbed to deathstabbingflashlightdecapitationnumbered sequeldemoncharacter name in titlenumber in titleviolencebloodsequelsexflashbacksurprise endingcorpsedigit in titlewritten by directormaskrevolvermassacreambulancesevered headunderwater scenelooking at the camerachampagnelightningstalkingdarkneck breakingsevered armdismembermentblood spattermass murdergothicmachetejail cellroman numeral in titleoverallsvictimstabbed in the neckresurrectionshovelstabbed in the headsevered legchainbloodbathengagement ringmysterious manmale name in titleactual animal killedday in titlesixth partstabbed in the facemultiple murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimgrindhouse filmhead ripped offreturning character with different actorvolkswagen beetledate in titledark and stormy nightdrive in classichorror icongrave robbingdeath by impalementunderwater fightcamp counselordouble impalementmachete mutilationserial teen killerchevrolet camarocomic drunkpolice officer crushedstabbing a police officerlightning roddigging up a gravestabbed with broken bottle (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | evilpsychopathrevengedeathmurdersuiciderapetortureinsanitycannibalismrape and revenge |
Mood: | slashergore |
Locations: | desertwaternew mexico |
Characters: | slasher killerserial killerterrorvillain |
Period: | year 2007 |
Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathmutilated bodydeformityserial murderbad guymadmanbody countrampagepsychomaniacstabbed to death β¦impalementstabbingnumbered sequelblood splatterexplosionfemale nuditysequelnuditybare breastsfightsurprise endingpistolfirelickingcorpseshot to deathshot in the chestremakeshot in the headfalling from heightriflef wordgood versus evilsurvivalgay slurarmystabbed in the chesttrainingbeaten to deathstabbed in the backkicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathbroken legguardsevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murderkilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthhuman monsterstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencepsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monsterumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath β¦ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmtragedy |
Themes: | evilpsychopathmurderdeathrevengerapereligionjealousytortureinvestigationangerinsanitygreedmurder investigation |
Mood: | slasherraingoreneo noir |
Locations: | hospitalbarhelicopternightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerhusband wife relationshippoliceprostituteteacherdetectivephotographerlawyerinterracial relationshiplust β¦security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All) |
Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathwhite pantiesmurder spreemass murdererserial murderbad guymadmanbody countpsychomutilationmaniac β¦subwayflashlightdecapitationblood splatterpantiesbare chested malenumber in titleviolencebloodone word titleinterviewdogphotographtitle spoken by characterchasesurprise endingpistolshootoutcorpsedigit in titleshot to deathcar accidentshot in the headshotgunarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminalfoot chasegay slurambulancedinersevered headscantily clad femalehit by a carnews reportshot in the foreheadattempted murderlibrarysadnessmurderertied uptypewriterkillingfreeze framegirl in pantiestv newscard gamepokergothictape recordersociopathtied to a bedfbi agentcrucifixloss of wifeblockbusterswat teamsevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingboxkilling spreeage differencedead dogalleycartoon on tvkillhuman monsterspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettibarbershopinnocent person killedcrime spreestairwellpolice partnerjumping from a rooftopwriting in bloodel trainswatpolice protagonistbreaking down a doorcreepysleeping pillsreference to ernest hemingwaydisturbingfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent filmconspiracyb horrorpolitical thrillerpolitical conspiracy |
Themes: | evilpsychopathmurderdeathpoliticstorturefilmmakinginvestigationparanoiaguiltsadismsurveillanceexploitationtechnologyclaustrophobia |
Mood: | slasherneo noirnight |
Locations: | cityhospitaltrainsnowrooftoptrain stationpennsylvaniacar in water |
Characters: | slasher killerserial killerserial murderervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute |
Period: | 1980swinter |
Story: | psycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopatheast coastmurder spreeserial murderbad guymadmancharacters killed one by onebody countslaughtermale underwearrampage β¦psychomutilationmaniacattempted rapesubwaystabbed to deathbare chested malefemale nuditynuditybare breastsfemale frontal nudityflashbacktwo word titleguntitle spoken by characterknifechasesurprise endingshowerwoman on topcar accidenturinationrescuewatching tvlingerievoyeuralcoholtelephonereportercleavageassassindisguisebridgepoliticianassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover uphairy chesttragic eventsplit screenfilm within a filmwitnessmurdererfireworkscult directorgraffititrustkillingtape recorderrecordingcaught having sexcrying womanmovie theaterphone boothfroggrindhousevictimparadedead womanwatching televisionwoman in jeopardydamsel in distressveteranmustachephiladelphia pennsylvanialonerbriefsdead woman with eyes openkilling spreereckless drivingpsychoticpolitical corruptionfilm industryinterrupted sextruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterslashingwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmafemale victimstrangled to deathtapepsychotronic filmtelevision reporterdisturbed individualbroken bottlegrindhouse filmwiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepydisturbingred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingdrive in classicwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexpsycho filmincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off β¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | murder of a police officerevilpsychopathdeathsuicideghostdrunkennessbrutalityinsanityexploitationhomelessnessdeath of daughter |
Mood: | slasherraingorenightmaredarkness |
Locations: | hospitalhelicopterstrip club |
Characters: | serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner |
Story: | homicidal maniacpsychopathic killerevil mansadistic psychopathmurder of a nude womanmass murdererserial murderbad guybeheadingcharacters killed one by onebody countrampagemaniacexploding carstabbed to death β¦throat slittingimpalementstabbingstrangulationflashlightdecapitationhallucinationblood splatternumber in titlefemale nuditysequelbloodviolencefemale frontal nudityinterviewflashbackfemale rear nuditysingingpartychasepistolbeatingdreamcorpsecar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafestripperf wordhalloweenbanddeath of friendstabbed in the chesthit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzasurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthcorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murderkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexgroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violenceslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimpentagramschizophrenicbreaking through a doorbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation β¦at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)
Subgenre: | slasher flickamerican horrorindependent film |
Themes: | evildeathmurderfriendshipfearescapeself sacrifice |
Mood: | slasherdarkness |
Locations: | forestcarbathtubbuspolice stationpolice carrunning in the forest |
Characters: | slasher killerserial killervillainpolice officerpolicefrienddoctorgirlnursepsychiatristuncle niece relationship |
Period: | 1980s20th century |
Story: | masked villainmasked killerkilled with a forklifting a female into the airpolice officer knocked unconsciousmass murdererserial murdersequel to cult favoritebad guybody countmasked manlifting someone into the aircharacter's point of view camera shotexploding carstabbing β¦mirrorexplosioncharacter name in titlenumber in titleviolencebloodsequeldoggunkissphotographpartyknifechasesurprise endingcryingcatfalling from heightmaskrunningsubjective cameragood versus evilhalloweencandleambulancedeath of friendweaponchildanimalcoffinchild in perilpolice officer killedattempted murdertreedangercostumescreamingscreambracelethangingautomobilethreatneck breakingtrapratmurderersplatterhateholidayropehuggingheroinelooking at oneself in a mirrorslow motionbarnloss of friendhidingpresumed deaddeath threatpsychotronicscissorsstairsdead manfieldlaughingfifth partkilling spreepumpkinlightsirendead dogreflectionpetpresentyellingtablereturning character killed offlaundrydead animalold dark househuman monsterdiscoveryclimbingkittenglasslocked doorhanged mancapepitchforkscytheliquidstabbed with scissorssittingemergencydustlight bulbmichael myerscarrying someonecrawlingboogeymanpleadingcrying childjumpsuitunmaskingopening a windowstringcult film referencestrawpink dressserial teen killertrailer narrated by don lafontaineattempted child murderpolice officer strangulatedteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | psycho thrillerslasher flickamerican horrorteen horrorcult filmindependent filmblack comedysuspensetragedysurvival horrorindependent horror |
Themes: | evilpsychopathdeathmurderfriendshipkidnappingfeartortureescapebrutalityparanoiadysfunctional familyinsanitysadismexploitation β¦paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | slasheravant gardedarknessambiguous ending |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenage boyteenage girlfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshiphostageself mutilation β¦truck driverself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | homicidal maniacmasked villainpsychopathic killermasked killerevil manlifting a female into the airdead teenagermurder spreebutcheryserial murderbad guymadmancharacters killed one by onebody countbutcher β¦rampagemasked manpsycholifting someone into the airmutilationmaniacimpalementflashlightdecapitationblood splatterviolencebloodphotographknifechasesurprise endingvoice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegesurvivalfoot chasebound and gaggedambushmassacredeath of friendstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckchainsawropegothicgroup of friendsbarnloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingfull moonredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathsouthern accentclose up of eyescar troublehysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned housefarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airgrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdisturbinggeneratorstate in titlebonesruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | psycho thrillersuspensesupernaturalparanormal |
Themes: | evilsupernatural powerpsychopathmurderdeathsuicidekidnappingmarriagerapeghostprisonfeartortureescapememory β¦paranoiadrug useinsanitymental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | slasherraingoreneo noirnightmaredarkness |
Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonist β¦nursepolicemanlawyerreference to godsecurity guardpsychiatristsheriffself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | psycho terrorpsycho killerhomicidal maniacpsychopathic killerevil mansadistic psychopathserial murderbad guymadmanpsychohypodermic needlemaniacattempted rapethroat slittingvideo camera β¦axeflashlighthallucinationmirrorblood splatterexplosionbare chested malefemale nuditybloodviolencesexf ratedfemale frontal nudityinterviewflashbackgunkissfightphotographknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcorpsecar accidentshotgunwatching tvcomputershootingrifletearsrunningcar crashreportersubjective cameraswimmingsurvivalfoot chasewomanbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionlightninginjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzasyringegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | psycho thrillercult filmindependent filmblack comedysadistic horror |
Themes: | murder of a police officerevilpsychopathdeathmurderrevengefriendshipsuicidekidnappingrapebetrayalfeartortureescapedeception β¦seductionangerdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All) |
Mood: | gorenightmareambiguous ending |
Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | serial killerterrorvillainpolice officerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationship β¦prostitutenursehostagetough guymaidsheriffpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | homicidal maniacpsychopathic killerevil manwhite pantiesmutilated bodymurder spreeknife murdermass murdererbutcheryserial murderbad guymadmanbody countslaughterbutcher β¦rampagemasked manmaniacattempted rapeelectrocutionon the runstabbed to deaththroat slittingimpalementaxestrangulationblood splatterpantiesexplosionbare chested malesequelviolencebloodflashbackmale rear nuditydogsex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterknifechasepistolshowerfireshootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushdeath of frienddrug dealercocainestabbed in the chestfemale pubic hairtied to a chaircultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial slurbeaten to deathstabbed in the backscreamingclownpay phonefugitiveknocked outopening action scenefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipgas maskwatching televisionredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firegrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodnecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in β¦ the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
Subgenre: | psycho thrilleramerican horrorsuspensesurvival horror |
Themes: | murder of a police officerevilpsychopathdeathrevengemurderkidnappingtortureescapeinvestigationangerlonelinessobsessioninsanitymental illness β¦sadismabductionwritingmadnessclaustrophobia (See All) |
Mood: | neo noirdarkness |
Locations: | woodshelicoptersnowsmall townwheelchairsnow storm |
Characters: | slasher killerserial killerserial murdererterrorvillainkillernursewriterhostageshooting a police officermysterious killerbaby killer |
Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathbutcheryserial murderbutcherrampagepsychomutilationmaniaccharacter's point of view camera shotstabbingviolenceblood β¦based on novelone word titlegunfighttitle spoken by characterknifesurprise endingbeatingshot to deathcar accidentshot in the chestshotgunrescueslow motion scenecar crashsubjective camerawomansearchduelattempted murderauthorisolationpigbasementmurdererobscene finger gesturetypewriterkillingsociopathragecaptivevillainesspsychologydesperationvictimfemale killerbroken legtensionthunderfanfight to the deathmedicationmurder of a childhighwaydark pastpsychoticnewspaper clippingphysical abuseintimidationnovelold dark househuman monsterfemale psychopathslashingblizzardfemale villainevil womanmatchidolmurderesspsychological torturebloody violencereclusepsychotronic filmsledgehammervillain not really dead clichecreepmysterious strangerscrapbooktauntingdeeply disturbed personbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killerweirdocreepychild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backdark and stormy nightdrive in classicbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolmale victimserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
Subgenre: | slasher flickamerican horrorsuspensebody horrorsadistic horrorspanish horrorcanadian horror |
Themes: | murdersuicidefeartorturedeceptioncannibalism |
Mood: | slasherraingorenightmareblood and gore |
Locations: | new york cityamericaboatvillagejunglerain forest |
Characters: | slasher killerterrorvillainfather daughter relationshiptattoolawyeramerican abroad |
Story: | sadistic psychopatheast coastbad guycharacters killed one by onebody countstabbed in the eyeslaughtermasked manmutilationnecklacethroat slittingimpalementdecapitationblood splatterbare chested male β¦female nudityviolencemale frontal nuditymale rear nuditylesbian kissthree word titlepistolcell phoneshot to deathshot in the chesturinationwritten by directorvomitingmarijuanacollegeislandmale pubic haircolor in titlerivershot in the backcookingsevered headdream sequenceritualroommateshot in the foreheadcharacter repeating someone else's dialogueprotestcollege studentscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplattermachetespidercovered in bloodvictimbroken legeaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endeye gougingbroken armsevered legenvironmentalismcapitalismactivisttorso cut in halfsatellitemarijuana jointkillshot in the neckunited nationshomagehuman monsterflutenaivetyamazonslashingveganantbleeding to deathkiller childextreme violencemiddle classperugraphic violencereference to twittertied up while barefootcamera phonebloody violencedeforestationignoranceenvironmentalistpsychotronic filmbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeating human fleshfemale genital mutilationman eaterbody partshead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
Subgenre: | american horrorcult filmindependent filmsadistic horror |
Themes: | evilpsychopathdeathmurderrevengesuicidekidnappingrapetortureescapeinvestigationvoyeurismseductionbrutalityinsanity β¦humiliationsadismabductioncrueltyvengeancemadnessrape and revengerape and murder (See All) |
Mood: | slasherhigh schoolgorenightmare |
Locations: | cityswimming poolforestcemeterylakerunning through the woods |
Characters: | slasher killerserial killerserial murdererterrorvillainkillerteenage girlfamily relationshipsfather son relationshippolicereference to godsheriffself justice |
Period: | 1970s |
Story: | homicidal maniacpsychopathic killerevil mansadistic psychopathwhite pantiesserial teen murdererserial murderbad guymadmandisembowelmentmutilationmaniacelectrocutionnecklacestabbed to death β¦throat slittingstabbinggangblood splatterpantiesfemale nudityviolencebloodfemale frontal nuditydoggunfemale rear nudityfightfemale full frontal nudityknifeshowershot to deathurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedconcerttoiletfemale pubic hairscantily clad femalebathcontroversycigar smokinglatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbringconvertiblefemale removes her clothesmurdererchickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamgrindhousevictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophileperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertprayingcannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbloody violencebakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession β¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
Themes: | psychopathdeathmurderfeartorturelonelinessbrutalityobsessiondepressiondrug useinsanitysadismunrequited lovephotographychildhood trauma β¦psychological trauma (See All) |
Mood: | slashergoreneo noir |
Locations: | restaurantlos angeles californiasex in public |
Characters: | mysterious villainserial killerterrorvillainkillerhomosexualmother son relationshiptattooprostitutephotographer |
Period: | 1980s2010s |
Story: | psychopathic killerevil manmurder of a nude womanmurder spreeknife murderserial murderbad guydisembowelmentrampagemaniacnecklacesubwaystabbed to deathstrangulationhallucination β¦blood splatterbloodviolenceone word titlethreesomeflashbackfemale rear nudityphotographknifecell phonecorpseurinationremakecomputercameravomitingcar crashbathroomneighborvoyeursubjective camerafoot chasebound and gaggedwinecocainestabbed in the chestchild abusehit by a carbreast fondlingvannews reportlooking at the cameratalking to the cameracharacter repeating someone else's dialoguestabbed in the backkicked in the facetragic eventstalkingthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingpillsrejectiondeath of protagonistwedding dressdark pasttied feetnervous breakdownsevered legdead woman with eyes openmisogynymannequinwoman in bathtubvillain played by lead actorsuffocationconfusionstabbed in the handhiding in a closethuman monstersubway stationsexual perversionslashingbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootfemale victimstrangled to deathschizophrenicbreaking through a dooronline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | paranormal phenomenacult filmsuspenseitalian horrorchristmas horrorpsychological horrorcult classic |
Themes: | psychopathmurderdeathsurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessfuneralinvestigationangercorruption β¦death of fatherbrutalityparanoiablackmailinsanityillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
Mood: | slashergorenightdarkness |
Locations: | cityhospitalbarrestaurantschoolcarcemeterybathtubbicyclewaterelevatorkitchenwheelchairaustraliapolice station β¦police caritalytruck (See All) |
Characters: | slasher killermysterious villainserial killerserial murdererterrorvillainkillerhomosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctor β¦singerboygirlpolicemanmusicianactresspsychiatristmaidprofessorjewgermangay friendself pity (See All) |
Period: | 1970s |
Story: | homicidal maniacpsychopathic killersadistic psychopathmutilated bodymurder spreebutcherycrushed headserial murdercharacters killed one by onebody countslaughterbutcherrampagemaniacdrowning β¦necklacestabbed to deathimpalementstabbingaxestrangulationflashlightdecapitationhallucinationmirrorblood splatterviolencebloodflashbacktwo word titlegunkisscigarette smokingphotographsingingknifechasesurprise endingtelephone callfiresongshootoutbeatingcorpseface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianocolor in titlerevolvertelevisiontelephonereportersubjective camerasurvivalgay slurnewspaperbedroomjournalistbandold mandinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womanpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionwhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingdisfigurementdark pastfemale reportergay stereotypeliving roomdead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsmysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleaverfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimpsychotronic filmhouse firehouse on fireclose up of eyefingerprintsilhouettegrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killerattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)
Subgenre: | american horrorcult filmindependent filmparanormalcreature feature |
Themes: | evilsupernatural powermonsterdeathmurderrevengeghostfearescape |
Mood: | darkness |
Locations: | seabarbeachchurchsmall townwaterrural settingshipcampfirefishing boatghost ship |
Characters: | mysterious villainterrorvillainzombiemother son relationshipchildrenboypriestsingle motherlittle boysheriffemployer employee relationshipcatholic priest |
Period: | 1980s1970syear 1979 |
Story: | evil manmutilated bodybutcheryghoulbad guyslaughterbutcherlifting someone into the airmutilationundeadstabbed to deathimpalementstabbingdecapitationdemon β¦violencebloodtwo word titleknifechasesurprise endingcorpsesworddead bodycaliforniawomanchild in perilcursemicrophonestorytellingspeechcrosscult directorkillingrecord playerpirategoldelectronic music scoremass murdergothictape recorderstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagepsychotronicautopsyfogeye gougingpierdark pastkilling spreelighthousedjmysterious manliving deadspiral staircasejournalevil spiritblackoutslashingradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotgrindhouse filmhookradio broadcasttragic villainmistphonograph recorddockscreepydisturbingmusic score composed by directorstained glass windowdemonicremadedrive in classicbayhorror movie remadefemale hitchhikercampfire storyhell on earthleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | american horrorcult filmindependent filmb movievideosadistic horrorhorror b movie |
Themes: | evilpsychopathdeathmurderrevengekidnappingrapefeartorturevoyeurismseductionangerbrutalityhumiliationsadism β¦exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
Mood: | slashergore |
Locations: | new york citycitychurchforestcarsmall townbathtubbicyclewaterlakegas stationcountry |
Characters: | serial killerserial murderervillainkillerfemale protagonistgirlwriterlustself justicesex with a stranger |
Period: | 1970s |
Story: | psycho killerpsychopathic killerevil mansadistic psychopathwhite pantieseast coastmurder spreeserial murdercharacters killed one by onebody countmutilationdrowningaxenew yorkgang β¦mirrorpantiesbare chested malefemale nudityviolencebloodmale nuditybare breastsfemale frontal nuditymale frontal nuditygunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingfondlingcryingbeatingbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspaperfemale pubic hairdrivingman with glassesscantily clad femalecontroversyjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmhangingfemale removes her clothesglassesthreatmurderercabinhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragedesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationaxe murderbruisekilling spreemisogynywoman in bathtubpervertkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathone woman armyviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violencemisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | psycho thrillertragedy |
Themes: | evilpsychopathdeathmurderrevengesuicidekidnappingrapetorturedeath of fatherbrutalitydeath of mothersadismdeath of wifecannibalism β¦self sacrificemadnessmurder of familyghost town (See All) |
Mood: | slashergorehorror movie remake |
Locations: | desertcavegas stationsuv |
Characters: | serial killerterrorvillainkillerteenage boyteenage girlfamily relationshipsbrother sister relationshipbaby |
Period: | year 2006 |
Story: | homicidal maniacpsychopathic killerevil mandeformityserial murderbad guymadmanbody countrampagemutilationmaniacexploding carimpalementaxeblood splatter β¦violenceblooddogsurprise endingpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolverfoot chasestabbed in the chestsevered headcontroversyshot in the foreheadstabbed in the backperson on firevacationbaseball batamerican flagglassesmurdererfirst partsevered armdismembermentkillingsplatterclaim in titleburned alivekilling an animalmutantragewalkie talkievictimrapisthomicidesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailermineaxe murdermutationsevered legkilling spreedeath of loved onemannequinhysteriacrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencestupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | psycho thrillerslasher flickindependent filmblack comedysuspensepsychological thrillerholiday horrorchristmas horror |
Themes: | psychopathmurderrevengedeathkidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinessobsession β¦paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
Mood: | slashergoreneo noircar chasedarknessone night |
Locations: | new york citycitycarsnowwatertaxielevatorurban settingpolice caroffice |
Characters: | slasher killermysterious villainpolice officerpolicefemale protagonistpolicemanhostagesecurity guardpolice detective |
Period: | winter |
Story: | manhattan new york citycharacters killed one by onebody countstabbed in the eyedisembowelmentmaniacattempted rapecharacter's point of view camera shotelectrocutionexploding carvideo camerastabbingaxestrangulationflashlight β¦mirrorblood splatterexplosionnumber in titleviolencebloodone word titledogfightpartyknifechasesurprise endingtelephone callfirecryingcell phonehigh heelsbeatingcorpsedigit in titlefistfightcar accidentpunched in the facebrawlplace name in titlerunningcar crashhandcuffsvoyeurf wordsubjective cameracleavagesurvivalfoot chasenewspaperbound and gaggedwineambulancewomantied to a chairnonlinear timelinefalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireattackproduct placementknocked outkicked in the facechristmas treebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playerholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentaerial shotblood on shirtdead manone daybuildinggasolinelonerduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |