Best popular movies like Grave Encounters:

Do you need specific genre & keyword selection to find films similar to Grave Encounters?
<< FIND THEM HERE! >>

Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grave Encounters (2011)

Lance Preston and the crew of "Grave Encounters", a ghost-hunting reality television show, are shooting an episode inside the abandoned Collingwood Psychiatric Hospital, where unexplained phenomena have been reported for years. All in the name of good television, they voluntarily lock themselves ins β€¦ide the building for the night and begin a paranormal investigation, capturing everything on camera. They quickly realize that the building is more than just haunted - it is alive - and it has no intention of ever letting them leave. They find themselves lost in a labyrinth maze of endless hallways and corridors, terrorized by the ghosts of the former patients. They soon begin to question their own sanity, slipping deeper and deeper into the depths of madness, ultimately discovering the truth behind the hospital's dark past...and taping what turns out to be their final episode. (Read More)

Subgenre:
paranormal investigationparanormal phenomenaghost huntingparanormalfake documentaryfound footagemockumentarycult film
Themes:
insanitysupernatural powerghost
Locations:
tunnelwheelchairbathtub
Story:
demonic spiritwhite briefsparanormal investigation teamparanormal investigatorscreaming in horrorscreaming in fearghost hunterblood vomitingvomiting bloodhospital braceletelectronic voice phenomenafalling down an elevator shaftbloody scratchgoing in circlesevp β€¦abandoned hospitalmanic laughtersevered tonguebreaking down a doorhospital gowndemonictv hostlabyrinthelevator shaftfictional reality showblood on camera lensreality shownight visionwoman cryingabandoned buildingman cryingcharacters killed one by onebriefshandheld cameradead manblood on facefogmental hospitalmale underwearladderhaunted housefirst partratcharacter's point of view camera shotscreamingtalking to the cameralooking at the cameravideo cameraflashlightsubjective camerademonblood (See All)

Paranormal Activity (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Paranormal Activity (2007)

After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.

Subgenre:
paranormalfake documentaryfound footagemockumentaryindependent film
Themes:
supernatural powermurderfearpanic
Mood:
nightmarenightdarkness
Locations:
swimming poolkitchen
Characters:
boyfriend girlfriend relationshipself mutilationself absorption
Period:
2000syear 2006
Story:
demonichandheld cameramale underwearladderhaunted housefirst partscreamingtalking to the cameralooking at the cameravideo camerasubjective camerademonbloodinterviewtwo word title β€¦bare chested malephotographknifesurprise endingfirecomputercamerawritten by directorlow budget filmguitarf wordbedroomhouseno opening creditsargumentcharacter repeating someone else's dialoguemicrophonesuburbfirst of seriescollege studentscreamactor shares first name with characterdarkhauntingpremarital sexcharacter says i love yousevered armobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterbarefoottime lapse photographyattictitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Blair Witch Project (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Blair Witch Project (1999)

Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and β€¦ made into a movie. The Blair Witch Project. (Read More)

Subgenre:
fake documentaryfound footagemockumentarycult filmindependent filmblack comedysuspensetragedyghost storysupernatural horrorfamily tragedyfolk horror
Themes:
supernatural powerfearpanicwildernessstarvationcamping in the wilderness
Mood:
student filmdarknessmyth
Locations:
forest
Characters:
boyfriend girlfriend relationshipfilmmakercrying babyevil witch
Period:
1990syear 1994
Story:
screaming in horrorscreaming in fearsevered tonguehandheld camerascreamingtalking to the cameralooking at the cameravideo cameraflashlightsubjective cameracigarette smokingchasesurprise endingcryingcorpse β€¦bookrunninglow budget filmriveralcoholhalloweenfour word titlemaplatex glovespainlegendmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationvoodoohysteriafolklorehikingabandoned housemessageautumnfrightgrassscareno endingno survivorsmarylandpaganviral videobased on supposedly true storylost in the woodsloss of boyfriendthree friendsdocumentarianobscuritychild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All)

Rec (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rec (2007)

'REC' turns on a young TV reporter and her cameraman who cover the night shift at the local fire station. Receiving a call from an old lady trapped in her house, they reach her building to hear horrifying screams -- which begin a long nightmare and a uniquely dramatic TV report.

Subgenre:
found footagemockumentarycult filmb moviemock documentaryspanish horror
Themes:
murderdeathfearracismparanoiapaniccannibalismtraumaself sacrificemurder of a police officer
Mood:
goredarknessambiguous endingone night
Locations:
helicopterpolice carspainfire truckfire station
Characters:
policemother daughter relationshipzombiepolice officerreligious icon
Story:
screaming in horrorblood on camera lensnight visionhandheld cameraladderfirst partcharacter's point of view camera shotscreamingtalking to the cameralooking at the cameravideo camerasubjective camerabloodviolenceone word title β€¦interviewchasesurprise endingpantiespistolcorpseshot to deathblood splattershot in the chestface slapwatching tvfalling from heightshootingheld at gunpointhandcuffsreporterambulancebasketballthroat slittingno opening creditslatex glovesgunshotmicrophonebeaten to deathdangerscreamactor shares first name with characterdarkisolationneck breakinghandgunfalling down stairsrevelationhypodermic needletape recorderrageloss of friendsalivacovered in bloodapartment buildingeaten alivegas maskcamera shot of feetspanishgash in the facespecial forcesinfectionfallblood on shirtsiegedemonic possessionsirenfiremanconfusionhysteriahit in the facebandageepidemicspiral staircaseno title at beginningsecurityroadblockbitten in the neckbleedingkiller childshockquarantinegraphic violenceopen endedfrightscarebreaking through a doortelevision reporterbludgeoningloudspeakerstairwellbitetrail of bloodemergencybarricadebasketball courtzombie childemaciationtelevision broadcastfire engineflesh eatingremadeobscuritynight shiftsledge hammeranthropophagusfire hosemallethorror movie remadehandcuffed to a pipebitten in the facefire departmentpossessed girlflesh eating zombiesinfectious diseasebiting someonerewindpolice tapespeaker phonecontamination suithealth inspectorno background scorevideographerill childmedical internsick animaltv news crewlocked in an attichand over camera lens (See All)

The Innkeepers (2011) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Innkeepers (2011)

Subgenre:
paranormal investigationparanormal phenomenaparanormalghost storyparanormal activity
Themes:
ghostsuicidedrinkingfear
Mood:
rain
Locations:
bathtubhotelbathtub suicide
Characters:
friendactress
Story:
white briefselectronic voice phenomenaevpbriefsblood on facemale underwearhaunted houseflashlightbloodcigarette smokingunderwearbeerpianoold manhotel room β€¦basementlaptoppsychicfalling down stairstowelsketchphonecoffee shopwhisperinginnchapter headingsundershirtentityinnkeeperhotel clerkdead body in a bathtubpendulumdead body in bathtubwoman in towelwork placefalse scare (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

As Above, So Below (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

As Above, So Below (2014)

Miles of twisting catacombs lie beneath the streets of Paris, the eternal home to countless souls. When a team of explorers ventures into the uncharted maze of bones, they uncover the dark secret that lies within this city of the dead. A journey into madness and terror, As Above, So Below reaches de β€¦ep into the human psyche to reveal the personal demons that come back to haunt us all. (Read More)

Subgenre:
found footagesupernaturaltragedy
Themes:
ghostmurderdeathlovefriendshipsuicidefearescapeinvestigationguiltgriefevilpanicclaustrophobia
Mood:
darknessaffection
Locations:
tunnelchurchparis francenightclubcavemuseumcave in
Characters:
friendmysterious being
Story:
screaming in horrorscreaming in fearhandheld camerablood on facescreamingtalking to the cameralooking at the cameravideo cameraflashlightsubjective camerademonbloodviolenceflashbacktitle spoken by character β€¦explosiontelephone callcorpsecamerawritten by directorfalling from heightrunningpianohallucinationtelephonemapvandrowningpoint of viewlegenddangerperson on firescreamskeletondisappearancedarktrapropegoldundergroundburned alivetreasuredesperationcovered in bloodskulliranresearchanxietyhealinglens flarebroken armtourconfusionapparitionremorsepiano playingtombstoneold flamearcheologyfall from heightbitten in the neckhanged mantour guiderunarcheologistfrightgravestoneriskanguishriddleangstscarebonerelicchurch bellhooded figuredigital camerahidden doorshaky camalchemyburning carperilobscurityevil forcemanholewet jeanshealing powerinfernounderground tunnelmysterious noisecatacombevil beingportal to helldark forcespelunkingtemplar knightsoaked clothessupernatural forcearamaicfemale archeologistgate of hellrosetta stone (See All)

V/h/s (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

V/h/s (2012)

A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old  β€¦televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)

Subgenre:
found footagesupernatural
Themes:
supernatural powerghostmurderdeathdrunkennessdeceptionevilhome invasionreligious cult
Mood:
goredarknessone night
Locations:
barforestroad triplakemotel
Characters:
husband wife relationshipzombiealienkillerghost in mirror
Period:
year 1998
Story:
blood on camera lenswoman cryingcharacters killed one by onehandheld camerahaunted housetalking to the cameralooking at the cameravideo cameraflashlightsubjective camerademonbloodfemale nuditymale nudityviolence β€¦female frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudityfemale full frontal nuditytitle spoken by charactermale full frontal nudityknifelesbian kisstopless female nuditycorpserescuetelevisiondecapitationhalloweengangthroat slittingimpalementcocainestabbed to deathsevered headritualanthologyskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love yourevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmentone daytitle at the endknife throwingcastrationlooking at self in mirrorlens flareabbreviation in titlefortune tellermarijuana jointwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All)

The Conjuring 2 (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Conjuring 2 (2016)

In 1977, paranormal investigators Ed and Lorraine Warren travel to London, England, where single mother Peggy Hodgson believes that something evil is in her home. When Peggy's youngest daughter starts showing signs of demonic possession, Ed and Lorraine attempt to help the besieged girl, only to fin β€¦d themselves targeted by the malicious spirits. (Read More)

Subgenre:
paranormal investigationparanormal phenomenaparanormalsupernaturalparanormal activity
Themes:
ghostlovechristmasfeardeception
Locations:
london englandengland
Characters:
husband wife relationshipteenage girlpriestlittle girlsingle mothercatholicterror
Period:
1970syear 2003year 1976
Story:
paranormal investigatorscreaming in fearbreaking down a doordemonichaunted housescreamingdemonsequelinterviewbased on true storyshot to deathpaintingsecond partaxehouse β€¦nunno opening creditschild in periltransformationpossessiontentchristmas treescreamcrossbasementhauntingpsychicrecord playertape recorderrecordingtied to a bedcrucifixnosebleedwatching televisionarchival footagethunderstormchairdemonic possessionteleportationreference to elvis presleynarrated by characterlevitationseancebroken windowcatholicismpremonitionsoccer ballouija boardwoman smokerphonographends with biographical notesstarts with narrationrosaryjumping out a windowsing alongarchival photographfalse teethmale singerjumping ropebased on supposedly true storyvideo recordingstutterconvulsiontalking to the deadspeech impedimentdriving in the rainswing setjump scareskepticdenturespsychokinesisvoice recordingsprayed with watercrucifix pendantbite markfalling out of bedblurry visionhiding under the coverslocked in jailwoman screamingbegins with historical notesrosary beadsspecterhavocstuttering charactertelevision statictoy truckchild shot in the backparanormal experthyperventilatingbrick thrown through a windowdownpourflooded basementupside down crossamityvillesitting on a swingzoetropepulled underwaterspeaking in another voiceupside down crucifixflickering lightstalkshow (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Insidious (2010) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Insidious (2010)

A gripping story of a family in search of help for their son, Dalton, who fell into a coma after a mysterious incident in the attic. Little do they know that there is much more to this endless sleep than meets the eye as they explore the paranormal, and rediscover the past; the key to getting their  β€¦son back once and for all. (Read More)

Subgenre:
paranormal
Themes:
supernatural powerghostsurrealismfearmurder of familymissing child
Mood:
nightmaremoving
Locations:
hospital
Characters:
husband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipboyteacherbabyterrorcrying babymother in law daughter in law relationship
Story:
paranormal investigatorscreaming in fearwoman cryinghaunted housecharacter's point of view camera shotvideo cameraflashlightdemonbloodflashbackphotographtitle spoken by charactersurprise endingshot in the chestcamera β€¦falling from heightbookriflepianostrangulationhousedream sequencedrawingchild in perilsearchflash forwardcharacter repeating someone else's dialoguepossessionfreeze framerevelationlooking at oneself in a mirrorcomagas maskbarefootheadphoneshypnosisscene after end creditsattictitle at the endlanternplaying pianophoto albumapparitionhiding in a closetspiral staircaseevil spiritpiano playingyoung version of charactersecurityheld captivemediumclawhiding under a bedcandlelightnew houseshacklesdigital camerachildhood photosecurity systemmarionetteghost childwoman strangled to deathfurnaceout of body experiencenew homebaby monitoranimate objectsketchbookrocking horsemetronomefireplace pokerastral projectionhouse warmingfalling off a ladderhandprinthiding under the coversbloody hand printdoor handleviewfindernether worldnight terrorscomposing musicfeeding tubewriting a songmurder of an old woman (See All)

Poltergeist (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Poltergeist (2015)

Legendary filmmaker 'Sam Raimi' (qv) and director 'Gil Kenan (I)' (qv) reimagine and contemporize the classic tale about a family whose suburban home is invaded by angry spirits. When the terrifying apparitions escalate their attacks and take the youngest daughter, the family must come together to r β€¦escue her. (Read More)

Subgenre:
paranormal investigationparanormalsupernaturalparanormal activity
Themes:
ghostabductionunemployment
Mood:
movinghorror movie remake
Locations:
cemeterybaseball
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlex husband ex wife relationship
Period:
2010s
Story:
paranormal investigatorghost huntertv hostreality showwoman cryingman cryinghaunted houseone word titletitle spoken by charactersurprise endingcell phonecorpseremakehallucinationtelevision β€¦no opening creditschild in periltreecharacter repeating someone else's dialogueclownsuburbdebtskeletonscene during end creditsuniversityscarhauntingspirit3 dimensionalthunderstormatticcellphonesunsetclosetdinner partystuffed animalportaldronesquirrelaltered version of studio logooverturning carrealtorcar rolloverevil clownpoltergeistfinancial crisiscaged animalnew housepower drillman undressingextreme closeupearthwormparanormal phenomenonanimate treehandprintvideo conferencingstuckpinwheelparapsychologistcredit card declinedhole in a wallstatic electricitysecurity alarmlifelinepsychic investigatorbig screen televisionheat sensorclown dollscared child (See All)

Cloverfield (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cloverfield (2008)

Cloverfield follows five New Yorkers from the perspective of a hand-held video camera. The movie is exactly the length of a DV Tape and a sub-plot is established by showing bits and pieces of video previously recorded on the tape that is being recorded over. The movie starts as a monster of unknown  β€¦origin destroys a building. As they go to investigate, parts of the building and the head of the Statue of Liberty come raining down. The movie follows their adventure trying to escape and save a friend, a love interest of the main character. (Read More)

Subgenre:
found footagecult filmcreature featuresurvival horror
Themes:
deathlovefearescapemonstermilitarypanic
Mood:
one night
Locations:
new york cityhelicopterapartmentrooftopcar firehumveefire escape
Characters:
brother brother relationshipsoldierout of control
Period:
2000s
Story:
blood on camera lensnight visionhandheld cameraratcharacter's point of view camera shottalking to the cameralooking at the cameravideo cameraflashlightsubjective camerabloodviolenceone word titleflashbackphotograph β€¦explosionpartysurprise endingcell phoneblood splatterrescuecamerarunningmanhattan new york citysurvivalaxeambulancedeath of friendarmysubwaynonlinear timelinecultno opening creditsdangerproduct placementtenttankdeath of brotherexploding bodycharacter says i love youdirectorial debuttv newsdestructiongroup of friendsexploding buildingspiderbrooklyn new york cityrocket launchercrushed to deatheaten aliverampageu.s. armychaosconvenience storeevacuationm 16amusement parksurpriseone daycellphonesirenalleycentral park manhattan new york citysubway stationgiant monsterfireballbrooklyn bridgeskyscraperold flamedepartment storehelicopter crashfighter jetferris wheelstatue of liberty new york citychandelierquarantinenewscastfrightparasitecrowbaru.s. marine corpsreference to supermanscaretelevision reporteru.s. air forcesurprise partychrysler building manhattan new york cityfootprintbitelootingloss of controlhorse drawn carriageno survivorspower failureaerial photographybuilding collapserunning for your lifeviral videokaijuair strikeempire state building manhattan new york cityshaky camgeneration ymass destructionconey island brooklyn new york citynational guardpassed out drunkbridge collapsejapanese flagno musicmillennial generationambiguous titlebleeding from eyeslovecraftiandestroyed citycellular phonesubway tunnelstealth fightercrushed caraerial bombardmentout of focusdisaster in new yorkmonster terrorizes citygoing away partyclose encounterelectronic storebiohazard signcatching food in one's mouthrebarshoulder launched missilebell uh 1 iroquois helicopterconey island new york city (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

House On Haunted Hill (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

House On Haunted Hill (1999)

When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β€¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)

Subgenre:
black comedyconspiracysupernaturalsurvival horror
Themes:
insanitysupernatural powerghostmurderdeathrevengesurrealismmarriagemoneybetrayaldrinkingfeardrunkennessescapedeception β€¦seductionparanoiasurveillanceunemploymentcourageself sacrificenear death experience (See All)
Mood:
goreone nighthorror movie remake
Locations:
wheelchairbathtubbarlos angeles californiaelevatorcave
Characters:
husband wife relationshipafrican americandoctornursesecurity guardalcoholic
Period:
1990s1930s
Story:
abandoned hospitalmental hospitalhaunted housecharacter's point of view camera shotscreamingflashlightsubjective camerademonbloodfemale nudityfightphotographtitle spoken by characterparty β€¦knifechasesurprise endingpistolfirecell phonecorpseshot to deathblood splatterfistfightshot in the chestremakerescuepunched in the facewatching tvcomputerdrinkbrawlheld at gunpointsunglassesbirthdayhallucinationf worddecapitationsurvivaljournalistambushaxeimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologueelectrocutionknocked outskeletonbasementhauntingsuspicionriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerskullfaked deathpresumed deadmental institutioncameobraveryguestimpostorstabbed in the neckbroken glassescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinarotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All)

Paranormal Activity 2 (2010) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Paranormal Activity 2 (2010)

Daniel Rey along with his wife, Kristi; daughter, Ali; toddler son, Hunter, and their dog, move to Carlsbad, California. A few days later their residence is broken into, however, nothing appears to be missing. In order to prevent re-occurrences, they install a number of security cameras that will re β€¦cord everything on a DVR. After they hire a Spanish-speaking nanny to look after Hunter, she informs them that there is something wrong in their house and performs prayers, much to the chagrin of Daniel, who lets her go. He will subsequently regret this decision as more inexplicable and strange incidents occur, with Ali concluding, after a research, that their house may be possessed by a demonic entity. (Read More)

Subgenre:
paranormalfound footagemockumentarycult film
Themes:
supernatural powermurderdeathkidnappinghome invasion
Locations:
bathtubswimming poolkitchen
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabysister sister relationshipterroraunt niece relationshipaunt nephew relationshipcrying babybikini girlstepmother stepdaughter relationship
Period:
year 2006
Story:
evpdemonicnight visiontalking to the cameravideo camerasubjective camerademonnumber in titlesequeldogbare chested malefightphotographsurprise endingfire β€¦digit in titlemirrorrescuewatching tvsecond partnumbered sequelbedroomcaliforniahouseno opening creditschild in perilcharacter repeating someone else's dialoguesuburbfired from the jobmissing personactor shares first name with characterbasementneck breakingcharacter says i love youwhat happened to epilogueflyinglifting someone into the airsecurity camerawalkie talkiecrucifixhot tubdemonic possessionliving roomnannyphoto albumlaptop computerpractical jokexboxvideo surveillanceyellinggerman shepherdno title at beginningfilm starts with textactress shares first name with characterunsubtitled foreign languagefilmed killinghome videoouija boardwoman in a bikinidead birdbilingualismdeal with the devilends with textrocking chairnail polishshaky camcribaction figurehdtvbaby monitorno music scorescratchanimate objectburning a photographpool cleanerpainting toenailsbite markhorror movie prequelprequel and sequelolive oilmaking a bedloud noiseno background scorefast forwardjumping into a poollocked out of housedragged down stairsmazda miata (See All)

The Conjuring (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Conjuring (2013)

In 1971, Carolyn and Roger Perron move their family into a dilapidated Rhode Island farm house and soon strange things start happening around it with escalating nightmarish terror. In desperation, Carolyn contacts the noted paranormal investigators, Ed and Lorraine Warren, to examine the house. What β€¦ the Warrens discover is a whole area steeped in a satanic haunting that is now targeting the Perron family wherever they go. To stop this evil, the Warrens will have to call upon all their skills and spiritual strength to defeat this spectral menace at its source that threatens to destroy everyone involved. (Read More)

Subgenre:
paranormal investigationparanormalparanormal activity
Themes:
supernatural powerghostsuicidemarriagenear death experience
Locations:
motelsinging in a car
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlpolice officersister sister relationshiplittle girllittle boymaidwitchcatholic priesttruck driversuicide by hangingghost in mirror
Period:
year 1968year 1971
Story:
paranormal investigatorghost hunterblood vomitinghaunted housecharacter's point of view camera shotvideo cameraflashbacktwo word titlebased on true storyshotguntied to a chairno opening creditschild in perilattempted murdercharacter repeating someone else's dialogue β€¦possessiondollprankblindfoldelectronic music scorecrucifixpump action shotgunvisionscissorsdemonic possessionlaughingbruisepigeonexorcismdead doglevitationapparitionblindfoldedlecturefarmhousenoosestation wagonmusic boxdead birdlocketsleepwalkingclairvoyantflash cameraends with textrocking chaircutting hairpancakefalling through the floornew housesailor suitfilicidewardrobedeath of pethanged womanlaundry drying on clothes lineclotheslinehanged by the neckwind chimerhode islandmatchesvolkswagen busbitten in the facemusic score features pianosideburnsloss of petupside down camera shotchild sacrificeultraviolet lighthand clapping gamespiralanimate dollpsychic visionboat dockslit wristscrawl spacehole in a walllocked in a cellarrevealing the truthdybbuk boxgenuflectingdybbukdriving at night in the rainbumping headends with quotationhiding in cupboardhouse by a lakehung from tree (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Devil Inside (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil Inside (2012)

An American girl, Isabella, sets out to make a documentary to understand what happened to her mother who murdered three clergy people. She was not convicted due to insanity and was sent to a mental hospital in Italy. Isabella meets with some priests in Italy who explain that her mother's condition m β€¦ay not be medical, but could be an extra-human possession. (Read More)

Subgenre:
found footagemockumentary
Themes:
insanitymurderdeathsuicide
Locations:
hospitalchurchairportcatholic church
Characters:
mother daughter relationshippriestprofessoramerican abroadself mutilationcatholic priest
Period:
year 1989year 2009
Story:
blood on camera lensmental hospitaltalking to the cameravideo cameraflashlightsubjective camerabloodthree word titlesurprise endingpistolcorpseblood splattercar accidentcar crashprayer β€¦nunno opening creditschild in perilcharacter repeating someone else's dialoguepossessioncrossbasementsubtitled scenefreeze frameitalianrome italytied to a bedcrucifixmental institutioncrime sceneplanedemonic possessionasylumexorcismvideo surveillancegun in mouthbaptismfilm starts with textpsychiatric hospitalshot through the mouthnewscastvaticanholy waterends with textno endingdocumentary crewexorcistno survivorsthroat rippingmental asylumskepticvatican citymurdered priestattempted drowningcontortionistcrucifix pendantbanging head against walldislocated shoulderrope around neckinjected in neckbroken chairdilated pupil (See All)

The Exorcist (1973)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Exorcist (1973)

A visiting actress in Washington, D.C., notices dramatic and dangerous changes in the behavior and physical make-up of her 12-year-old daughter. Meanwhile, a young priest at nearby Georgetown University begins to doubt his faith while dealing with his mother's terminal sickness. And, book-ending the β€¦ story, a frail, elderly priest recognizes the necessity for a show-down with an old demonic enemy. (Read More)

Subgenre:
paranormal phenomenaparanormalcult filmtragedyamerican horrorsupernatural horrorparanormal activity
Themes:
supernatural powermurderdeathsuicidereligionfeardrunkennessfilmmakingangercorruptionbrutalitydeath of motherparanoiagriefsadism β€¦faithevilcrueltypanicself sacrificedevilmurder investigationclaustrophobiamysterious deathsupernatural being (See All)
Mood:
goredarkness
Locations:
bathtubhospitalbarchurchcardesertkitchencatholic churchslum
Characters:
mother son relationshipmother daughter relationshipdoctorteenage girlgirlpriestchristianactresssingle motherpolice detectivepsychiatristcatholicself mutilationcatholic priestself destruction β€¦out of controlself injuryevil girl (See All)
Story:
screaming in horrorscreaming in feardemonicblood on facefirst partdemonbloodbased on novelviolencepantiesbased on true storyunderwearblood splatterurination β€¦punched in the facevomitingbedbathroompianohalloweenbedroomdeath of friendhouseaccidentman with glassesdream sequenceritualtransformationpainargumentvirgindangerpossessionstatuescreamthreatbasementloss of motherprofanityheart attackwashington d.c.occultfalling down stairssyringedestructionelectronic music scorehypodermic needleinjurytape recorderwoman with glassesjoggingragetied to a bedloss of friendcrucifixwitchcraftdesperationhomemovie directoriraqrampagewhiskeymiddle eastvisioninnocencesufferingdiscussionmovie setpsychotronicdespairhypnosismedical examinationmedicationstairsabsent fatherfilm setastronautatticperversioninsultdemonic possessionliving roomroombruiseswearingexorcismunclelevitationgreekhit in the facecar drivingsubway stationautographstaircaseadvicevulgarityx raysatanisminsomniahearing voicescatholicismconversationautumnteenage daughterpsychiatrypunching bagseizurefamous scorefrightouija boardsuperhuman strengthmenacetormentriterisksleeplessnessanguishreference to the virgin marymedical doctornoiseholy waterblasphemyloss of controlmovie fanexorcistvoicescreenplay adapted by authorexaminationskepticismsatanmovie makingemaciationbloody mouthheart conditionmousetrapcocktail partyconvulsionloss of innocenceouijaperilpaganismadolescent girldiagnosisboxing gymstabbed in the crotchsubliminal messagetrailer narrated by percy rodriguezcrisis of consciencevulgar languagecrisis of faithvirgin mary statueevil forceheresyarcheological diganimate objectfurypsychological tormentskepticsign of the crossbrain scandistorted voicescotchoccupation in titleforces of eviljeopardymysterious noiseneurologistpossessed girlagnosticmedical testdesecrationex boxerinsomniaclast ritesoccultismevil beingjesuitgreek americanfalling from a windowspeaking in tonguessacrilegeritalinslurhead spinmysterious voicevirgin girldiabolicaltroubled teenage girlvirgin blooddirector actor relationshipdemonic voicespinal tapforce of evilgirl in perilnitroglycerineneurological disordersleeplessquestioning beliefsradiographytalking backwardstwisting one's head completely aroundbaffled doctordiabolical possessionpassing through a wallphysical tormentfollow shotgeorgetown washington d.c.sexual insultgeorgetown universityiv linejesuit priestrough neighborhoodrunning trackspinning headagnosticismcrab walkdemonic forcethorazine (See All)

V/h/s/2 (2013) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

V/h/s/2 (2013)

Subgenre:
paranormalfound footage
Themes:
supernatural powerghostmurdersuicideinfidelitypregnancyalien abduction
Mood:
gore
Locations:
hospitalswimming poolforestlakemotelwater gun
Characters:
doctorbrother sister relationshipzombiealienself mutilation
Story:
vomiting bloodblood on camera lenscharacter's point of view camera shotvideo camerasubjective camerademonbloodfemale nuditymale nuditysequelfemale frontal nudityinterviewmale frontal nuditydog β€¦bare chested malesex scenemale full frontal nudityexplosionpistolcell phoneshot to deathblood splattershot in the chestshot in the headshotguncar crashbathroomshot in the backfoot chasegay slurthroat slittingstabbed to deathcultno opening creditschild in perilhit by a carbirthday partybreast fondlingspaceshipunderwater scenecreatureanthologydrowningpoint of viewpoisonmissing persondeath of childcollege studentprankexploding bodylaptopneck breakingcharacter says i love yousubtitled sceneufoundeadprivate detectivekilling an animalbarnnosebleedsevered handcovered in bloodteddy beareaten alivepump action shotgunmale masturbationsurveillance camerasevered fingerstabbed in the throatstabbed in the neckfalling to deathdisembowelmenttitle at the endeye gougingraised middle fingerstabbed in the eyelooking at self in mirrorlens flarehit with a baseball batintestinesvideo tapehead blown offurinehead bashed inrazorplaying a video gamevhsshot through the mouthcrowbarcommunepeep holevcrdocumentary crewsleeping bagthroat rippingmedical experimentstrobe lightnational parkcult leadercyclistfemale vomitingbitten on the armghost childslumber partyvhs tapeburnt handimplantmass suicidesleepoverhit on the head with a rockbitten in the facefinger bitten offbox cuttermountain bikingjaw ripped offcompoundwater balloonbitten on the legsleeping in a bathtubbarbecue grillhelmet camerahollywood hills (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
paranormal phenomenaparanormalcult filmsupernaturalslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
supernatural powerghostmurderdeathfriendshiprevengesurrealismkidnappingfearescapemonstervoyeurismpsychopathbrutalityparanoia β€¦sadismevilpanicmysterious deathshower murder (See All)
Mood:
gorerainhigh schoolnightmareslasherdarknesspoetic justice
Locations:
barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
family relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacher β€¦girlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
white briefsdemonicbriefsblood on facemale underwearhaunted houseratcharacter's point of view camera shotscreamingsubjective camerademonbloodcharacter name in titlenuditynumber in title β€¦male nudityviolencesequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequelhallucinationvoyeurclassroomcriminalf wordfoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backlocker roomperson on firepossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementmurderercharacter says i love youthreatened with a knifeclassobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadfull moonrampagedamsel in distressseriesunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countcellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shouldermoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facestreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Poltergeist (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Poltergeist (1982)

A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.

Subgenre:
paranormal investigationcult film
Themes:
supernatural powerghostvoyeurismdysfunctional familyafterlifemissing childscience versus supernatural
Mood:
moving
Locations:
swimming poolcemeterykitchen
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship β€¦blonde girl (See All)
Period:
1980s
Story:
paranormal investigatorghost hunterhaunted housefirst partvideo cameraone word titleinterviewpantiescorpsemirrorblondewatching tvcameralingeriemarijuana β€¦neighborhallucinationvoyeurtelevisiongood versus evilcleavagehousewhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dolltv setentitygolden retrieverlifting a female into the airsource musicanimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All)

Session 9 (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Session 9 (2001)

An asbestos abatement crew wins the bid for an abandoned insane asylum. What should be a straightforward, if rather rushed, job, is complicated by the personal histories of the crew. In particular, Hank is dating Phil's old girlfriend, and Gordon's new baby seems to be unnerving him more than should β€¦ be expected. Things get more complicated as would-be lawyer Mike plays the tapes from a former patient with multiple personalities, including the mysterious Simon who does not appear until Session 9, and as Hank disappears after finding some old coins. (Read More)

Subgenre:
found footagecult filmindependent filmsupernatural horror
Themes:
murderdeath
Mood:
darkness
Locations:
tunnelwheelchair
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipbabysecurity guarduncle nephew relationshipbaby girl
Story:
abandoned hospitalabandoned buildingmental hospitalmale underwearhaunted houseflashlightnumber in titleflashbackdogtwo word titlebare chested malephotographknifesurprise endingcell phone β€¦digit in titlemarijuanafalse accusationvangraveyardmissing persongraffitipot smokingelectronic music scoretape recorderwalkie talkietensionco workerdelusionstabbed in the eyeasylumcoinearphonesold dark houseimaginary friendtape recordinghearing voicesinsane asylumromantic rivalrywalkmanmultiple personalityfamily photographmarital abusehazmat suitlobotomyglass eyefalse memorymullettherapy sessiongold toothbonusmullet haircutmusic score features pianoupside down camera shotscaldingbody wrapped in plasticphotograph on walldeath of a co workerasbestosnumber 9 in titleplastic sheetgothic architectureshot on locationabandoned asylummedical recordsflipping coindeath of co worker (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cannibal Holocaust (1980) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cannibal Holocaust (1980)

With the intention to venture into the unexplored areas in the deep jungle of the Amazon rainforest at the border between Brazil and Peru, in 1979, a film crew composed of four young Americans attempted to make a documentary about the never seen before indigenous cannibalistic tribes. However, it's  β€¦already been two months since anyone last heard from the crew, so without further delay, the noted anthropologist Professor Harold Monroe and his rescue team of the seasoned guide Chaco Losojos and his assistant, embarked on a mission to locate them in the depths of the Green Inferno. Following the Yakumos, a tribe that no white has ever seen before, soon enough, the Professor's rescue party will encounter the elusive Yanomamos or Tree People and the fearsome Shamataris or the Swamp People. Eventually, as more evidence is found concerning the fate of the film crew, the Professor will try to recover the raw footage that was paid in blood, and return it to New York to the executives of the Pan American Broadcasting System who crave to get the riveting unedited footage. What has really happened to the overambitious documentarists, and above all, what was in the final two reels? (Read More)

Subgenre:
found footagecult filmtragedyitalian horrorsadistic horrorextreme horror
Themes:
insanitymurderdeathrapetorturefilmmakingdeceptionbrutalityhumiliationsadismevilabuseexecutionexploitationcruelty β€¦cannibalismabortion (See All)
Mood:
gorerain
Locations:
new york cityairplaneboatjungleusa
Characters:
boyfriend girlfriend relationshipsoldierwarriorprofessorfilmmaker
Story:
screaming in horrorscreaming in fearhandheld cameradead manblood on facecharacter's point of view camera shotscreamingtalking to the cameralooking at the camerasubjective camerabloodsexfemale nuditynuditymale nudity β€¦violencefemale frontal nuditymale frontal nuditymale rear nuditybare chested malefemale rear nudityfemale full frontal nuditycigarette smokingmale full frontal nudityknifefireshot to deathurinationcamerashootingvomitingriflemale pubic hairrevolverrivertelevisionscientistdecapitationjournalistnew yorkmassacrebridgeimpalementsnakebirdanimalcontroversynews reportshot in the legskinny dippingpublic nuditydangerskeletonhairy chestfilm within a filmtraptied uphandgundismembermentkillingmonkeyarsonuzishavingdestructionburned alivekilling an animalrevelationspearelectronic music scoremass murdermachetesexual abusesexual attractionmutilationspidercovered in bloodpart of trilogyvictimskullrape victimtorchdead womansocial commentaryhomicideswitchbladesufferingcannibalmercilessnessgunshot wounddisembowelmentgang rapeperversionslaughterturtletigertribemustachecastrationlieutenantsexual assaultparrottank topburned to deathphysical abusemuddead girlnude swimmingexpeditionbandagecanoefilm crewflutelightertelevision newssexual perversionsexual violenceanimal crueltyshoutingamazonraftdegradationanimal abusecrewunconsciousnessheld captivemissingsnuff filmactual animal killedcarnageatrocityalligatorsouth americaextreme violencecamouflagegropingfilmingfemale victimsnake bitetelevision reporterviolent deathdovesexual humiliationexploitation filminfanticidecaptivityloinclothburningfemale journalistgenital mutilationundershirthutmass mediasexual torturesexual crueltybanned filmleechwild boaranthropophagushuman fleshpregnant woman nudemutilated corpsecold blooded murderentrailsvideo nastywoman in a towelmurder of a pregnant womaneating human fleshshaving creamamazon riveremasculationcovered in mudamazon tribesavagerytransgressive filmgraphic rapetorture deviceamazon jungleextreme filmnorth americatv journalistamazon rainforestphysical torturecannibal tribewooden stakeanacondabarbarismhemorrhagerunning nakedburning villageamazon forestamazoniaman in a towelnaked bathingextreme crueltyinsidemacawtelevision executivenude in natureblow darttribal warfarevileanimal violenceamazonian indian (See All)

Blair Witch (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blair Witch (2016)

Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try β€¦ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)

Subgenre:
found footagesuspensesupernaturalvideosurvival horrorpsychological thrillerpsychological horrorfolk horror
Themes:
supernatural powerghostmurderdeathfriendshipkidnappingbetrayalfearescapedeceptionparanoiaevilpaniccampingnear death experience
Mood:
gorerainambiguous endingmyth
Locations:
tunnelforestsmall townnightclubwoodscampfire
Characters:
boyfriend girlfriend relationshiphostagewitchself mutilationdeath of girlfriend
Period:
2010s
Story:
vomiting bloodnight visioncharacters killed one by onehandheld cameracharacter's point of view camera shotscreamingflashlightsubjective camerabloodcharacter name in titleviolencesequeltwo word titletitle spoken by characterchase β€¦surprise endingcell phonecorpseblood splatterrescuefalling from heightvomitingrunningriverf wordsurvivaldeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationapologyno opening creditsdouble crosscreaturesearchthird parttreelegendcursedangermissing persontentknocked outcollege studentlightningactor shares first name with characterdisappearancebasementsuspicionprofanitysleepingfreeze frameheavy rainloss of friendwalkie talkieoverallsvideotapewristwatchyoutubeinterracial friendshipcrushed to deathbroken legtensionmercilessnessescape attemptblack and white sceneinfectionaerial shotatticrainstormtripteleportationtracking deviceyellingminimal castvomitold dark houseabandoned housedroneno title at beginningfilm starts with textcabin in the woodsdeath of boyfriendcamcorderparasitewatching a videosymbolpentagrampsychotronic filmtime loopgrindhouse filmleg injuryno endingbanishmentmarylandbarricadefilm studentcamping triploss of girlfriendshaky camlost in the woodsrebootloss of boyfriendcrawlinghearing noisesriver crossingcentipedetime paradoxmysterious noiselovecraftianbroken footdark forestno cell phone signalrunning in the darkblair witchcrossing a riveropening creditsbootstrap paradoxsleeping in the foresthouse in the woodsblair witch projectmysterious figure (See All)

The Taking Of Deborah Logan (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Taking Of Deborah Logan (2014)

What starts as a poignant medical documentary about Deborah Logan's descent into Alzheimer's disease and her daughter's struggles as caregiver degenerates into a maddening portrayal of dementia at its most frightening, as hair-raising events begin to plague the family and crew and an unspeakable mal β€¦evolence threatens to tear the very fabric of sanity from them all. (Read More)

Subgenre:
fake documentaryfound footagemockumentarymedical
Themes:
supernatural powermurderdeathkidnappingdrinkingfearinvestigationmemoryangerparanoiaillnessevilphotographypanicmysterious death
Mood:
gorenightdarkness
Locations:
tunnelhospitalforestcarwoodskitchenpolice carcavebackwoods
Characters:
policemother daughter relationshipfrienddoctorpolice officerserial killerpolicemanpriestsherifffilmmakerself destructivenessself destructionthe familyout of controlself injury β€¦lesbian daughter (See All)
Story:
handheld cameraladdertalking to the cameralooking at the cameravideo cameraflashlightsubjective camerabloodfemale nuditynudityviolenceflashbackgunfemale rear nudity β€¦photographknifetelephone callfirecryingcell phonecorpseshot to deathfoodmirrorshotguncomputercameradrinksecretshootingpaintingvomitingbirthdaybedbathroomneighborpianorevolvertelephonereporterbedroomcookingeatingwidowsuicide attempthouseinternetsnakeman with glassesbirthday partyritualold womanjeansconfessiontreeargumentpossessionmissing personinjectionbasementpolicewomangardensacrificemaniactv newsmedicinedresshypodermic needleinjurydiseasedesperationdriving a carhomehomiciderampagesufferingsurveillance cameraattempted suicideshovelmedicationstairsdead childsurpriseattichealingalzheimer's diseasecellphoneh.p. lovecraftfemale doctorminedark pastopening a doorfemale reporternervous breakdownliving roomroomdead girlpsychopathic killerconfusionmysterious mangardeningdark secretmoney problemspaintfilm crewstaircasetelevision newsdiggingtv reporterx raycameramanhospital roomhospital bedwhisperingsicknessjacketworminternet videomedical studenthallwayvirginiauniversity studentshirtfemale police officerdecadencemysterious womannervousnessriteholeanguishenigmamedical doctorwindowtalking while drivingtelevision reportercaverndisturbed individualquestionbiteloss of controlsmartphonecorridorloss of memorybitingfemale studentdigital camerasenilityhostilityserpentblouseevil powerdiagnosisobscuritythesiscancer patientnightiehummingtrousersporchbloody handevil forcetelephone operatorcomputer screenfurystaringtroubled pastdistorted voicepediatriciansackforces of evilmysterious noisemedical testpantsspadedark powerburnt corpsecamera operatordark forcehospital patientmedical examhuman remainsdegenerative diseasedisturbed personrecuperationspinal tapclosed doorfemale patientpagan ritualforce of evilswitchboardburning corpsemysterious behaviortrowelradiographybewildermentswitchboard operatoraspsinister forcechild with leukemiamurmuringsenile dementia (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Silent Hill (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Silent Hill (2006)

Sharon Da Silva wakes up every night screaming about "silent hill". Pursued by a police officer suspicious of her motives and swerving to avoid another child her adoptive mother crashes the car knocking herself unconscious. When Rose Da Silva awakens to find her adopted child is missing, she searche β€¦s the fog and ash blanketed town for her beloved daughter. (Read More)

Themes:
supernatural powerghostmurderdeathfriendshiprevengesurrealismreligionbetrayaltorturemonsterbrutalitysadismfaithhope β€¦self sacrificemurder of a police officermissing childghost townreligious cult (See All)
Mood:
gorerainnight
Locations:
hospitalschoolhotelelevator
Characters:
policemother daughter relationshipgirlpolice officernursepolicemanlittle girlwitchreligious fanatic
Story:
blood on camera lensfogladderscreamingflashlightdemonbloodfemale nudityviolenceflashbackgunphotographtitle spoken by characterknifepistol β€¦cell phoneblood splattercar accidentrescuearrestshowdownbathroomhandcuffsclassroomgood versus evilsurvivalwomanbridgeimpalementstabbed in the chestmapnundouble crosscreaturebeaten to deathkeyperson on firemissing personcourtscardarkpolicewomanwaterfallhandgunsacrificedismembermentburned alivegothicmutilationorphanagecompassionjanitortrappedsufferingbased on video gametitle appears in writingcigarette lighterdark herosoulcliffsirentorso cut in halfheroismbarbed wirefemale bondingfemale fighterhuman monsterbus stopburnt faceunconsciousnesshandcuffedpipeconscienceashesburnt bodypersecutioncar radiochild molesteradopted daughtermotorcycle copmurder of a nude womanimmolationsleepwalkingsecret roommissing daughterretreatknife in the chestmisthornhidden roomsliced in twomoral ambiguitycoal minebodily dismembermentwest virginiaabandoned minedaylimbohandcuffed womanskinned aliveburned at the stakesexy nursetown name in titlemultiple monstersmelting facemurder of a policewomanchain link fencesplit in twonightmare becomes realitysleeping on couchcatholic orphanagefundamentalist christianroom keywitch burninghandcuffed behind backschool roomsilent hillmaternal instincttorn fleshash falldead but doesn't know itmotherly instinctbarcelona chairdust mask (See All)

Quarantine (2008) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Quarantine (2008)

A television reporter and her cameraman are assigned to spend the night shift with a Los Angeles Fire Station. After a routine 911 call takes them to a small apartment building, they find police officers already on the scene in response to blood curdling screams coming from one of the apartment unit β€¦s. They soon learn that a woman living in the building has been infected by something unknown. After a few of the residents are viciously attacked, they try to escape with the news crew in tow, only to find that the CDC has quarantined the building. Phones, internet, televisions and cell phone access have been cut-off, and officials are not relaying information to those locked inside. When the quarantine is finally lifted, the only evidence of what took place is the news crew's videotape. (Read More)

Subgenre:
found footagemockumentarysurvival horrordisaster film
Themes:
deathdrunkennessescapevoyeurismparanoiapaniccannibalismmurder of a police officer
Mood:
one night
Locations:
helicopterlos angeles californiaelevatorapartmentfire truckfire station
Characters:
husband wife relationshippolicezombiesniperkiller dog
Story:
blood on camera lensnight visionhandheld camerafirst partratcharacter's point of view camera shottalking to the camerasubjective camerabloodviolenceone word titleinterviewdogbare chested malepistol β€¦showercorpseshot to deathblood splattershot in the chestremakepunched in the facefalling from heightheld at gunpointtelevisionreporterfoot chasebasketballimmigrantold womanshot in the foreheadbeaten to deathkicked in the faceactor shares first name with characterinjectiontragic eventneck breakingexperimentfalling down stairssyringekilling an animalragevirusloss of loved onecrushed to deathback from the deadbroken legapartment buildingeaten alivegas masktrappeddeath of protagonistjumping through a windowinfectionblood on shirtshot multiple timesfirefighterdead dogfiremansuffocationneedlehit in the faceveterinarianepidemicalarmtv reportercameramanhead bashed inbitten in the neckfeverkiller childquarantinesick childtenantspitting bloodhit with a hammerzombie violencesledgehammerdog attackbreaking through a doorbludgeoningstairwellthroat rippingmedia manipulationzombie childemaciationtelevision broadcasthandballaudio tapenight shiftzombificationdalmatianhandcuffed to a pipebitten in the facedrill in the headfire departmentmaulingchief of policeinfectious diseaseteacher student romancevideo voyeurismrabiesvetcontamination suitaudio begins before videoshot in sequencesick dograbid dogapartment managerremake of spanish filmladder truck (See All)

The Amityville Horror (1979)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Amityville Horror (1979)

Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β€¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)

Subgenre:
paranormal phenomenacult filmindependent filmsupernatural horror
Themes:
supernatural powerghostmurderlovemarriagefearweddingtheftparanoiasurveillanceevilpanicpolice investigationmurder of family
Mood:
nightmare
Locations:
barchurchmotorcyclecatholic church
Characters:
husband wife relationshippriestterrorcatholic priest
Period:
1970s
Story:
white briefsbriefsmale underwearhaunted housefirst partdemonbloodsexfemale nudityflashbackdogthree word titlepantiesbased on bookdream β€¦shotgunvomitingbeerplace name in titleriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibrarycurseattacklightningscreamcrosshauntingchild murderoccultfireplacegothicbabysitterlifting someone into the airagingcrucifixbeardblockbustergrindhousereincarnationstairsthunderstormdemonic possessionwedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toeremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Evil Dead (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Evil Dead (1981)

Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β€¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)

Subgenre:
cult filmindependent filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror
Themes:
supernatural powerghostmurderdeathrapedancesadismevilsupernatural rapebook of evil
Mood:
goreslasherone night
Locations:
forestcarwoodssinging in a car
Characters:
friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism
Period:
1980s
Story:
blood on camera lenscharacters killed one by onedead manfogfirst partcharacter's point of view camera shotsubjective camerademonbloodfemale nudityviolencekissthree word titlesurprise endingfire β€¦blood splatterremakeshot in the headshotgunwritten by directorshootingbooklow budget filmcollegeriverdecapitationaxestabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriespossessionisolationbasementhauntingcabindirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legeye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcellardeath of loved onetripplaying cardsclose up of eyesdead girlbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All)

The Bay (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Bay (2012)

This "found-footage" film is set in 2009 in the town of Claridge, Maryland on the Chesapeake Bay. During the town's annual 4th of July Crab Festival, townspeople become sick, exhibiting a variety of symptoms, which leads local news reporters to suspect something has infected the water there. No one  β€¦is sure what it is or how it's transmitted, but as people start to behave strangely, and others turning up dead, fear spawns into panic. The town is shut down as government authorities confiscate video footage from every media or personal source they find, in an effort to cover-up the incident. But one local reporter who witnessed the epidemic, was able to document, assemble, and hide this film in hopes that one day, the horrible truth would be revealed . . . (Read More)

Subgenre:
found footagemockumentarytragedy
Themes:
murderdeathsuicidedrinkingfearinvestigationbrutalityillnesscrueltypanicenvironmentmadnessmysterious death
Mood:
gorenightmare
Locations:
hospitalbeachcarsmall townboatwaterpolice carseaoceantown
Characters:
husband wife relationshippolicedoctorpolice officerpolicemanbabykillerterrormayorfemale scientistout of control
Period:
2000s
Story:
blood vomitingsevered tonguenight visionhandheld cameradead manscreamingtalking to the cameralooking at the cameravideo camerasubjective camerabloodviolenceinterviewflashbackgun β€¦title spoken by charactertelephone callcell phonecorpseshot to deathblood splatterfoodcar accidentshot in the chestshot in the headcomputercameradrinkbikinisecretshootingvomitingliecar crashtelevisiontelephonescientistreporterjournalistambulancebridgeeatingweaponinternetaccidentfishnonlinear timelineman with glassesradiounderwater scenenews reportpainmicrophonedangerfactorycover upscreamscene during end creditsamerican flagtragic eventsplit screenthreatunderwaterchickenfreeze framedisastertv newsrevelationdressinjurytouristwoman with glassesdiseasemutilationsecurity camerapatientyoutubedesperationswimsuitaudiencefestivaldead womanhomicideeaten alivedivingecologychaosanxietyinfectionseasidepollutioncellphonepierfemale reportersevered legsurgeontank topcrowdplantt shirtharbortruthtourismdark secretshortscar drivingwebsitewebcamcameramanhospital roomradio stationmarried couplesicknessdeputypoisoningamputationinternet videoindustrymotorboatemergency roomshirtcrabmaggotfrightparasitemenacetv interviewdead birdfourth of julyriskanguishmedical doctorportscaretelevision reporteroutbreakwater fountainloss of controlfemale journalistsmartphonecatastrophecontaminationmass mediawaiting roomdigital cameramarylandskypedesolationinterviewercreekhidden truthdead fishblouseperilseashoreintoxicationgooglebayenvironmental disastermass deathshorehomeland securitycomputer screenreportpolice radioindependence dayseaside townjeopardytoxinblistercautionary talerashwater pollutioncontaminated watermass hysteriatight pants24 hourslarvalesioncamera operatorecological disasterwashed ashorewater contaminationbig buttfemale patientpoisoned foodboilpoisoned waterfemale tv reporteroceanographerchesapeake bayenvironmental contaminationpolluted environmentcrustaceanfestivitycontaminated foodscientific investigationwikipediaenvironmental pollutionirritationmass panicskin rashcenter for disease control (See All)

Stir Of Echoes (1999) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Stir Of Echoes (1999)

A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β€¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)

Subgenre:
independent filmsuspense
Themes:
insanitysupernatural powerghostmurderdeathlovesuicidekidnappingpregnancydrinkingfeardrunkennessfuneralmemoryobsession β€¦paranoiadrug usedysfunctional familyguiltafterlife (See All)
Mood:
rainnightmaremurder suicide
Locations:
bathtubcemeterychicago illinois
Characters:
family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero β€¦seeing a ghost (See All)
Story:
blood on facefoghaunted housetalking to the cameraflashlightsubjective camerabloodsexbased on novelbare chested malegunfemale rear nudityfightpartyknife β€¦erectioncryingsongwoman on topcorpseshot to deathblood splattershot in the chestwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backbandambulancesuicide attempthousenonlinear timelinecoffinsearchgraveyardgraveproduct placementmissing personcover upattempted rapedisappearancesleepingpsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewunderage drinkingshoveldelusionhypnosissuperstitionlooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
paranormal phenomenacult filmindependent filmpsycho thrillerslasher flickteen horroramerican horror
Themes:
supernatural powermurderdeathrevengemonsterpsychopathevildrug addictionmurder of a police officer
Mood:
gorerainhigh schoolslasher
Locations:
new york cityboatwoodsseacityamericasewer
Characters:
teenage girlteenage boyzombiepolice officerserial killerkillervillainteacher student relationshipterrorslasher killermysterious villainserial murderer
Period:
1980s
Story:
characters killed one by onemale underwearcharacter's point of view camera shotvideo cameraflashlightdemonbloodfemale nuditycharacter name in titlenumber in titleviolencesequelbare chested maleexplosionpanties β€¦blood splattermirrornumbered sequelhallucinationguitarmanhattan new york citydecapitationgangnew yorkstrangulationaxestabbingthroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyebody countsequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

The Ring (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Ring (2002)

Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own  β€¦life. (Read More)

Subgenre:
paranormal phenomenasupernatural horror
Themes:
supernatural powerghostmurderdeathrevengesurrealismsuicidefearfuneralinvestigationvoyeurismphotographyadoptiondyingmysterious death
Mood:
rainnightmarehorror movie remake
Locations:
wheelchairbathtubwaterelevatorcity
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlserial killerstudent β€¦writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All)
Story:
elevator shaftmental hospitalladderfirst partbloodf ratedbased on novelflashbackcigarette smokingphotographtitle spoken by charactersurprise endingpantiesshowertelephone call β€¦cell phonedreamhorsemirrorblondeface slapremakewatching tvcomputercamerafalling from heighthallucinationvoyeurislandclassroomtelephonereportergood versus evilcleavagenewspaperjournalistaxewomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationunderwater scenetreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeapartment buildingmental institutionsevered fingerpastdead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secreturban legendwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowninghookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All)

The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (1980)

As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β€¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)

Subgenre:
paranormalcult filmindependent filmcreature featureamerican horror
Themes:
supernatural powerghostmurderdeathrevengefearescapemonsterevil
Mood:
darkness
Locations:
barbeachchurchsmall townwaterrural settingseashipcampfirefishing boatghost ship
Characters:
mother son relationshipchildrenboyzombiepriestsingle motherlittle boyvillainsheriffterroremployer employee relationshipcatholic priestmysterious villain
Period:
1980s1970syear 1979
Story:
demonicfogdemonbloodviolencetwo word titleknifechasesurprise endingcorpsesworddead bodydecapitationcaliforniastabbing β€¦womanimpalementstabbed to deathchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorkillingundeadrecord playerpirategoldelectronic music scoremass murdergothictape recorderlifting someone into the airmutilationstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagebutcherpsychotronicautopsyeye gougingslaughterpierdark pastkilling spreelighthousedjbad guymysterious manliving deadspiral staircasejournalevil spiritblackoutslashingradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulbutcherygrindhouse filmhookradio broadcasttragic villainmistphonograph recorddockscreepydisturbingmusic score composed by directorstained glass windowremadedrive in classicbayhorror movie remadefemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Mirrors (2008) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mirrors (2008)

In New York, the former NYPD detective Ben Carson is hired to work as night watch of the remains of the Mayflower Department Store that was partially destroyed by fire many years ago. Ben became alcoholic and was retired from the police force after killing a man in a shooting. His marriage was also  β€¦destroyed and now he is living in the apartment of his younger sister Angie. However he has not been drinking for three months and sees the employment as a chance to rebuild his life. When he goes to the rounds in his first night, he finds that the mirrors are impeccably clean and his colleague explains that the former night watch was obsessed with the mirrors. After a couple of nights, Ben sees weird images in the mirrors, but due to the lack of credibility of his past, his ex-wife Amy believes he has hallucinations as a side effect of his medication. When Angie is found brutally murdered in her bathtub, Ben discovers that there is an evil force in the mirror that is chasing him and jeopardizing his family. (Read More)

Subgenre:
supernatural horror
Themes:
insanitysupernatural powerghostdeathsuicidemarriagefearangerguiltgriefevilalcoholismmurder of a police officer
Mood:
gorehorror movie remake
Locations:
bathtubhospitalnew york citybarrural settingpolice carpennsylvania
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipgirlpolice officerlittle girlsecurity guardpsychiatristtalking to oneself in a mirrorghost in a mirror
Story:
breaking down a doorabandoned buildingman cryingmental hospitalratflashlightdemonbloodfemale nudityone word titleflashbackfemale rear nudityphotographtitle spoken by characterexplosion β€¦knifechasesurprise endingpistolfirecorpseblood splattercar accidentmirrorremakewatching tvcameravomitingheld at gunpointbirthdayhallucinationprayermassacreambulancethroat slittingimpalementtied to a chairsubwayapologynunchild in perildrowningbartenderlocker roomperson on firepossessionbasementgraffitinewspaper headlineburned alivecoplooking at oneself in a mirrormutilationtied to a bedmorguebuttockshomecrying manschizophreniacrushed to deathmental institutionwhiskeypillsgash in the facescissorsmedicationdeath of protagonistbathingautopsydeath of sisteralternate realitymarital separationdemonic possessionalarm clocksirennewspaper clippingnannydoppelgangerclosetex cophiding in a closetmonasterybandagesubway stationremorsephysicianconventbroken mirrorburnt faceinterracial marriageglassscene of the crimepsychiatric hospitalvideo footageinterracial coupledeath of familystatue of libertycut handmurder of a nude womanpool hallimmolationbreaking a mirrorhousemaidcityscapenypdnight watchmanblond hairexposed breastcprfire enginevideo recordingdummyscreaming in painstartledestranged coupleinterracial loveestranged wifeevil forcethrown through a wallsprinkler systemglass shardmirror does not reflect realityfather child relationshipreflection in waterjaw ripped offremote controlled toy carfaucetestranged husbandhandprintspurting bloodpaint on glasssliced bodychild drowningtrapped underwatermirror as portalpsychiatric treatmentburned out buildingmalevolent entityantisepticpleading for helpremake of korean filmartistic imagery (See All)

Hellboy (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hellboy (2004)

In the final days of World War II, the Nazis attempt to use black magic to aid their dying cause. The Allies raid the camp where the ceremony is taking place, but not before a demon - Hellboy - has already been conjured. Joining the Allied forces, Hellboy eventually grows to adulthood, serving the c β€¦ause of good rather than evil. (Read More)

Subgenre:
paranormal investigationparanormal phenomenamartial artsblack comedysuperherosteampunk
Themes:
murderfuneralherowrestlingapocalypse
Locations:
tunnelnew york citycemeteryrussiamuseum
Characters:
love triangleaction heroprofessorself mutilation
Period:
world war two1940s
Story:
severed tonguefirst partdemonbloodcharacter name in titleone word titletitle spoken by characterexplosionpistolfireshootoutcorpseshot to deathfistfightcar accident β€¦face slapbattleswordgunfightbrawlfalling from heightbased on comicshowdownhand to hand combatrevolvergood versus evilhalloweenassassinsword fightbased on comic booknew yorkthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsubwaybrunetteno opening creditsanti heroone man armyhit by a carunderwater scenecigar smokingshot in the legone against manygravestabbed in the backfbiperson on fireelectrocutionpay phonecover upkicked in the faceopening action sceneshot in the shoulderexploding bodytrapoccultdestinygrenademutantfbi agentexploding buildingsevered handmilkcrushed to deatheaten alivemental institutionreverse footagevisionstabbed in the throatresurrectiontitle appears in writingfather figureaquariumstabbed in the legsouldisfigurementwilhelm screamsurprise after end creditstelepathytorso cut in halfcartoon on tvoutcastportaltrafficmegalomaniacstabbed in the armkittenhanged manrepeated lineroofgarbage truckcarouselalternate dimensionhit by a trainrosarydecomposing bodyrubik's cubenarration from the graveclairvoyancecandy barpyrokinesisfighting in the airslide locked backtinnitusdark horse comicsnazi occultismmale soldierman eating monsterreanimated corpseinterspecies romancenazi experimentsecret government organisationsix packoccult detectiveowning many catscombat photographymoldaviawebbed fingersaquatic humanoidbreathing apparatustentacled monsterblue flameshumanoid demon (See All)

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
paranormalsuspensesupernaturalpsycho thriller
Themes:
insanitysupernatural powerghostmurderdeathsuicidekidnappingmarriagerapeprisonfeartortureescapememorypsychopath β€¦paranoiadrug usemental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
gorerainneo noirnightmareslasherdarkness
Locations:
bathtubhospitalswimming poolcartaxipolice stationpolice car
Characters:
family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonistserial killernursepolicemanlawyerreference to godkiller β€¦security guardvillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
hospital gowndemonicmental hospitalscreamingvideo cameraflashlightsubjective camerabloodsexfemale nudityf ratedviolencefemale frontal nudityinterviewflashback β€¦bare chested malegunkissfightphotographexplosionknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcorpseblood splattercar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreporterswimmingsurvivalfoot chaseaxewomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophoneperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memorydisturbingbreaking glassfingerprintsnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Rec 3: Genesis (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rec 3: Genesis (2012)

The action now takes place miles away from the original location and partly in broad daylight, giving the film an entirely fresh yet disturbing new reality. The infection has left the building. In a clever twist that draws together the plots of the first two movies, this third part of the saga also  β€¦works as a decoder to uncover information hidden in the first two films and leaves the door open for the final installment, the future '[REC] 4 Apocalypse.' (Read More)

Subgenre:
survival horrorsupernatural horror
Themes:
murderpregnancyweddingdeath of mother
Mood:
gorerain
Locations:
tunnelchurchbus
Characters:
zombiepriestcousin cousin relationship
Story:
blood vomitingsevered tongueblood on camera lensnight visionvideo camerasubjective camerademonsequelcigarette smokingpistolshot to deathblood splattershot in the chestface slapshotgun β€¦swordfalling from heightshot in the backdecapitationfoot chasemansionbridgeimpalementstabbed in the chestchild in perilpantyhosethird partcharacter repeating someone else's dialoguebeaten to deathstabbed in the backkicked in the facecharacter says i love yousevered armchainsawslow motionvirussecurity cameracamera shot of feetstabbed in the headdeath of protagonistinfectionone daystabbed in the eyelens flaredemonic possessionwedding receptionprequelfoot closeupbitten in the neckgroomquarantinetragic endingbloody violencearm cut offwoman slaps a manbreaking through a doorbreaking a bottle over someone's headgrindhouse filmzippo lighterthroat rippingsuit of armorfemale stockinged footsliced in twobandaged handbitten handpregnant woman murderedflesh eatingfrenchwomanhead cut in halfchainsaw murderhit with a tire ironreference to genesisreference to sponge bob (See All)

In The Mouth Of Madness (1994) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Mouth Of Madness (1994)

With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends  β€¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)

Subgenre:
paranormal phenomenacult filmindependent filmblack comedysuspensesupernatural
Themes:
insanitymurderdeathsurrealismsuicidefearescapemonsterinvestigationdeceptionparanoiaapocalypseself sacrificepolice brutalityghost town β€¦end of mankind (See All)
Mood:
neo noirnightmare
Locations:
tunnelnew york citybarchurchhotelcarsmall townbusbicycleelevatormoteltownnew england
Characters:
policedoctorpolice officerwriterlawyerpsychiatristsecretaryhomeless manself referentialinsurance agentevil monster
Period:
1990s
Story:
going in circlesmanic laughtercharacter's point of view camera shotsubjective camerademonbloodviolenceflashbackdogguncigarette smokingtitle spoken by characterchasesurprise endingbeating β€¦corpseshot to deathblood splattercar accidentshot in the chestshot in the headshotgunarrestpaintingbookriflecar crashbathroomhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citygood versus evilfoot chaseaxeambulancebridgedinerweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonemissing personlightningcrossfilm within a filmbasementsuspicionmurderercinemasevered armcult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudtorchend of the worldanimal attackschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murdermutationasylumriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguninsane asylumcornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgehorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
paranormal phenomenacult filmsupernaturalpsycho thrillerslasher flickteen horroramerican horror
Themes:
insanitysupernatural powermurderdeathprisonmonsterpsychopathevilmurder of a police officer
Mood:
gorecar chaseslasherdarknessbreaking the fourth wall
Locations:
forestcemeterysmall townboatwoodslakeamerica
Characters:
policeteenagerzombieserial killerkillervillainsheriffterrorslasher killerserial murderer
Period:
1980s
Story:
demoniclooking at the cameraflashlightdemonsexcharacter name in titlenumber in titleviolencesequelflashbacksurprise endingblood splattermasknumbered sequeldecapitation β€¦massacreambulancestabbingstabbed to deathsevered headchilddrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
cult filmindependent filmslasher flickteen movieteen horroramerican horrorindependent horror
Themes:
supernatural powermurderrevengesurrealismfuneralpsychopathevil
Mood:
gorehigh schoolnightmareavant gardeslasher
Locations:
bathtubcemeterypolice station
Characters:
husband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain β€¦serial murdererpolice lieutenant (See All)
Period:
1980s
Story:
demoniccharacters killed one by onefirst partcharacter's point of view camera shotsubjective camerademonbloodviolencebare chested malecigarette smokingsurprise endingdreamcorpseblood splattermirror β€¦face slapslow motion scenearrestfalling from heightbedjailclassroomtelephonegood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriesevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementbody countcellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boysevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

The Descent (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Descent (2005)

A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.

Subgenre:
cult filmcreature featuresurvival horrorbritish horror
Themes:
ghostmurderdeathfriendshiprevengeinfidelitybetrayaldrinkingfearescapemonsterbrutalityguiltgriefpanic β€¦cannibalismblindnessmurder of familyclaustrophobia (See All)
Mood:
gorenightmare
Locations:
hospitalforestcarwoodscavecave in
Characters:
husband wife relationshipfriendfemale protagonistbest friendlittle girl
Story:
hospital gownblood on camera lenshandheld camerafirst partvideo cameraflashlightbloodf ratedviolencetwo word titlephotographknifesurprise endingcryingbeating β€¦corpseblood splattercar accidentblondefalling from heightbookvomitingliehallucinationsurvivalmountaindeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenecreaturenecklacesmokingbeaten to deathdolldarkisolationneck breakingunderwatercabinwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airgroup of friendsvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killingeye gougingstabbed in the eyeloss of husbandkilling spreesuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All)

Night Watch (2004) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night Watch (2004)

Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β€¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)

Subgenre:
cult filmindependent filmsupernaturaldark fantasyurban fantasy
Themes:
supernatural powermurderdeathrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerbrutalitydeath of mother β€¦paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All)
Mood:
gorenightdarkness
Locations:
tunnelbathtubtrainswimming poolairplaneelevatorurban settingapartmenttruckrooftoprussiayachtfire escape
Characters:
father son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boywitchrussian β€¦pregnant womanself mutilation (See All)
Period:
1990s2000s20th century21st centuryyear 1992
Story:
vomiting bloodabandoned buildingfirst partcharacter's point of view camera shotscreamingflashlightsubjective camerabloodfemale nuditybased on novelviolenceflashbackdogtwo word titlebare chested male β€¦female rear nudityfightphotographtitle spoken by characterexplosionknifechasesurprise endingvoice over narrationcell phonebeatingcorpseblood splatterhorserescueslow motion scenepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighbordecapitationgood versus evilfoot chasesword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuemissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellinvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingpsychotronic filmimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectortime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
paranormalcult filmindependent filmsuperherosupernaturalstop motion animationslasher flickbody horroramerican horrorurban fantasy
Themes:
insanitysupernatural powerghostmurderdeathfriendshiprapepregnancyfearmonsterinvestigationpsychopathbrutalitydepressionsadism β€¦eviltrauma (See All)
Mood:
gorenightmareslasher
Locations:
hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident
Characters:
father son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernursebaby β€¦artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
demoniccharacters killed one by oneblood on facemental hospitalhaunted housescreamingflashlightdemonbloodsexfemale nudityf ratednudityviolencebare breasts β€¦sequelflashbackbare chested malegunfemale rear nudityphotographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashhallucinationgood versus evilfoot chasedisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerlocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armdismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundanimated sequenceblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumfifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facemidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

Ouija (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ouija (2014)

A girl is mysteriously killed after recording herself playing with an ancient Ouija Board, which leads to a close group of friends to investigate this board. They later find out that some things aren't meant to be played with, especially the 'other side'.

Subgenre:
supernaturalparanormal activity
Themes:
supernatural powerghostmurdersuicidefearfuneralinvestigationdeceptionevil
Mood:
high schoolslasher
Locations:
wheelchairbathtubswimming pool
Characters:
teenagerfriendboyfriend girlfriend relationshipsister sister relationshipwaitressdeath of girlfriendbest friendsghost girl
Period:
2010s
Story:
characters killed one by onehaunted housecharacter's point of view camera shotflashlightbloodone word titleflashbackphotographtitle spoken by charactersurprise endingtelephone callcell phonemirrorwritten by directorbathroom β€¦death of frienddinerno opening creditsdrowningcharacter repeating someone else's dialoguehigh school studentdarkbasementsisterspiritfireplaceelectronic music scoregroup of friendsloss of loved onemental institutionpower outagetitle appears in writingstairsatticshadowtitle at the endbased on toyclose up of eyeslevitationclosethiding in a closetseanceevil spirityoung version of charactermediumouija boardphone callboard gamepsychotronic filmclose up of eyechristmas lightsbreaking a mirrorgrindhouse filmspiritualismevil childdeath by hangingflickering lightbased on gameghost childwoman in a wheelchairdead teenagerouijamidnight moviestartledfurnacehanged girljump scaremouth sewn shutblack and white photographcommunicating with the deadprimal screamopening credits (See All)

Insidious: Chapter 3 (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Insidious: Chapter 3 (2015)

After trying to connect with her dead mother, teenager Quinn Brenner, asks psychic Elise Rainier to help her, she refuses due to negotiate events in her childhood. Quinn starts noticing paranormal events happen in her house. After a vicious attack from a demon her father goes back and begs Elise Rai β€¦nier to use her abilities to contact the other side in hope to stop these attacks by this furious demon content for a body. (Read More)

Subgenre:
paranormalsupernatural
Themes:
ghostgrieftheatredeath of wifenear death experience
Locations:
wheelchairhospitalapartment
Characters:
father son relationshipfather daughter relationshipteenagerbrother sister relationshipneighbor neighbor relationshipactor director writer
Story:
ghost hunternight visionflashlightdemonflashbackdogphotographsurprise endingwritten by directorstrangulationsuicide attemptno opening creditshit by a carthird partcharacter repeating someone else's dialogue β€¦auditionpossessiondiarydirectorial debutpsychichead buttapartment buildingbloody nosepet dogvegetarianlanterndemonic possessiondeath of loved oneprequelseancebellmediumneck braceblogfootprintfalling through the flooroxygen maskwoman in a wheelchairhelium balloonmohawkbox cutterleg casthit with a wrenchupside downleg in castfractureemergency surgeryhanging out a windowmalevolent entityvacant apartmentknocking on a wall (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Paranormal Activity 3 (2011) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Paranormal Activity 3 (2011)

In 1988, in California, cinematographer Dennis moves to the house of his girlfriend Julie to raise a family with her daughters Katie and Kristi. Little Kristi has an imaginary friend named Toby while weird things happen in the house. Dennis decides to place cameras in the house to capture images dur β€¦ing the night and soon he finds that there is an entity in the house. Dennis's friend Randy Rosen ('Dustin Ingram (I)' (qv)) researches the events and learns that his house might be a coven of witches and the children may be in danger. (Read More)

Subgenre:
paranormalfound footagemockumentarysupernaturalparanormal activity
Themes:
fear
Locations:
kitchen
Characters:
mother daughter relationshipboyfriend girlfriend relationshipsister sister relationshipwitchstepfather stepdaughter relationship
Period:
1980s2000syear 1988
Story:
character's point of view camera shottalking to the cameravideo camerasubjective camerademonnumber in titlesequelthree word titlesurprise endingdigit in titlesecretmaskbookbedroomnonlinear timeline β€¦cultno opening creditschild in perilbirthday partythird partpoint of viewtentcharacter says i love yougaragefalling down stairsbabysittervideotapeteddy bearearthquakefanlooking at self in mirrorprequelfast motion scenemarijuana jointinvisibilitylevitationhiding in a closethair pullingyoung version of characterno title at beginningimaginary friendwhisperingwoman in bra and pantiesactress shares first name with charactervhswoman wearing only a man's shirttrampolinefilmed killinghome videoroller skatessymbolpentagramvcrnumber 3 in titlepinatatea partybroken backlocked in a closetno music scorescratchwatching someone sleepanimate objecttripodwedding videopainting a wallhorror movie prequelhalloween maskprequel and sequelwatching videoloud noisewedding photographreference to the tooth fairybloody marygrandmother's housecrawl spaceinvisible beingoscillating fanreference to macgyversanta rosa californiacovivant covivant relationship (See All)

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
paranormal phenomenacult filmindependent filmsuspensesupernaturalpsycho thrillerslasher flickamerican horrorcanadian horror
Themes:
insanitysupernatural powerghostmurderdeathrevengesuicidekidnappingfeartorturedrunkennesspsychopathdeath of fatherbrutalitydeath of mother β€¦evilabductiontraumafear of water (See All)
Mood:
gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore
Locations:
forestcemeterysmall townpolice stationlakeschool nurse
Characters:
father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β€¦serial murderer (See All)
Period:
2000s
Story:
demonicblood on camera lenscharacters killed one by onecharacter's point of view camera shotdemonbloodcharacter name in titleviolencesequelflashbackphotographexplosionpartysurprise endingpistol β€¦showerfirevoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskcar crashdecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessionkilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

A Haunted House (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Haunted House (2013)

In October 2012 a video footage is found at the home of Malcolm Johnson and the recordings are still unexplained. Past this prologue a story in flashback form unfolds. During the summer of 2012, Malcolm and Kisha move in together and start a happy life. One night Kisha notices a few unexplained phen β€¦omena that convince her their house is haunted by ghosts. To allay her fears Malcom hires a camera crew to film inside the house day and night. A few nights later Malcom and Keisha have sex on camera, despite Keisha's protests at being filmed. Upon reviewing the sex tape the next day, Malcom and Keisha notice a few paranormal phenomena caught on tape. Malcom wants to sell the house but the housing market is slow. Therefore, Malcom decides to hire a psychic to come to the house and investigate. After Kisha confesses to making a deal with the devil for a pair of shoes things start to make sense but it doesn't solve the problems caused by the paranormal phenomena. (Read More)

Subgenre:
paranormal phenomenaparanormalfound footagesupernatural
Themes:
ghost
Mood:
spoofparody
Locations:
swimming poollos angeles california
Characters:
boyfriend girlfriend relationshippriestyounger version of charactersex with a ghost
Period:
year 2012year 1988
Story:
night visionhaunted housevideo camerasubjective camerafemale nudityflashbackmasturbationmale rear nuditybare chested maleinterracial sexpistolbeatingshot to deathshot in the chest β€¦urinationface slappunched in the facebikinicocainehit by a carbirthday partycharacter repeating someone else's dialoguecharacter says i love youpsychicfalling down stairskilling an animalkicked in the stomachflatulencerear entry sexswitchbladetitle at the endhousekeeperdemonic possessionwritten by stardead dogmarijuana jointstuffed animalwebcamanal rapemale rapehamburgerman punching a womanouija boardwoman in a bikiniwoman slaps a manfemale sitting on a toiletbegins with textwriting in bloodsex on a tabletime stamp (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Divide (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Divide (2011)

Nuclear explosions force the residents of a New York apartment block to run from the building. However, the explosions force them into a basement. Eight residents are holed up in the building's bomb shelter. They must acclimatise to each other in difficult, cramped conditions.

Subgenre:
post apocalypsesurvival horror
Themes:
insanityrapetortureapocalypse
Locations:
new york city
Characters:
mother daughter relationshipbrother brother relationshipsoldierlawyergay kiss
Story:
white briefswoman cryingbriefsdead manmale underwearbloodmale nuditymale rear nuditytwo word titlebare chested maleexplosionfireshot in the chestundressing β€¦survivalcandleaxethroat slittinggunshothairy chestbasementtied updestructionshot in the stomachcrying womansafemale male kisslanternduct tapesodomyshaved headgirl in bra and pantiesbrooklyn bridgeloss of childfinger cut offterrorist attackoverhead camera shotnorth koreaman on firenuclear explosionhalf brothershelteroverhead shottrail of bloodman dressed as womanweldingbomb sheltererectile dysfunctionhitting a womanman dressed as a womansexual favorviolent sexcity in ruinsshaving headwall safehair lossradiation sicknesshead shavingbody mutilationbroken glassesreflection in eyetrapped in a roomstruggle for survivalunwanted sexual advancesdestruction of cityfallout shelterseptic tankcut to piecesmedical labrationbuilding superintendentchopped up bodyradiation suitopen woundsurvival kit (See All)

Thir13en Ghosts (2001) is one of the best movies like Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thir13en Ghosts (2001)

Arthur and his two children, Kathy and Bobby, inherit his Uncle Cyrus's estate: a glass house that serves as a prison to 12 ghosts. When the family, accompanied by Bobby's Nanny and an attorney, enter the house they find themselves trapped inside an evil machine "designed by the devil and powered by β€¦ the dead" to open the Eye of Hell. Aided by Dennis, a ghost hunter, and his rival Kalina, a ghost rights activist out to set the ghosts free, the group must do what they can to get out of the house alive. (Read More)

Subgenre:
supernaturalb moviesurvival horror
Themes:
supernatural powerghostmurderdeathrevengesurrealismmoneybetrayalmagicinheritancebook of magic
Mood:
gorehorror movie remake
Locations:
bathtub
Characters:
family relationshipsfather son relationshipfather daughter relationshipbrother sister relationshiplawyerwitchsingle father
Story:
ghost hunterhaunted housebloodfemale nuditynumber in titleviolenceexplosionchasepistoldigit in titleblood splatterremakerescueslow motion scene β€¦swordrifleaxeimpalementchild in perildouble crossfemme fataleshot in the foreheadlimousinewidowerbaseball batlaptoploss of mothersacrificepsychicdismembermentsplattersingle parenteyeglassesrevelationwhat happened to epiloguetape recorderbabysitterlifting someone into the airloss of wifeeccentricfaked deathmillionairedynamitearrowpipe smokinghit with a baseball batjunkyardlast will and testamentmachinescooterflareartifactnaked dead womancollectorintentionally misspelled titlecut into piecessliced in twoghost childbroken backdismembered bodymixed alpha numeric titlesword caneovernight in a haunted houseglass house (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
paranormal phenomenacult filmsuspenseitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
insanityghostmurderdeathsurrealisminfidelityrapechristmasjealousydrinkingdrunkennessfuneralinvestigationangercorruption β€¦psychopathdeath of fatherbrutalityparanoiablackmailillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All)
Mood:
gorenightslasherdarkness
Locations:
wheelchairbathtubhospitalbarrestaurantschoolcarcemeterybicyclewaterelevatorkitchenaustraliapolice stationpolice car β€¦cityitalytruck (See All)
Characters:
homosexualfather son relationshippolicemother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirlserial killerpolicemanmusicianactress β€¦killervillainpsychiatristmaidprofessorjewterrorgermangay friendslasher killermysterious villainserial murdererself pity (See All)
Period:
1970s
Story:
characters killed one by onedead manmental hospitalscreamingflashlightsubjective camerabloodviolenceflashbacktwo word titlegunkisscigarette smokingphotographsinging β€¦knifechasesurprise endingtelephone callfiresongshootoutbeatingcorpseblood splattermirrorface slapwatching tvcameradrinksecretshootingpaintingbookvomitingrunningdead bodycafebathroomneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereporterdecapitationsurvivalgay slurnewspaperbedroomjournalistbandold manstrangulationaxestabbingimpalementstabbed to deathdinerhousejokebrunettedrivingsevered headbirddrawinghit by a carsearchgraveyardold womannecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuepuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playermaniactv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassbutchershoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadoweye gougingslaughterdisfigurementdark pastbody countfemale reportergay stereotypeliving roomdead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsserial murderpsychopathic killermysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesshomicidal maniacfemale psychopathslashingwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on firemurder spreeclose up of eyefingerprintsilhouettebutcherygrindhouse filmhatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Grave Encounters?
<< FIND THEM HERE! >>