Best popular movies like Grease:

Do you need specific genre & keyword selection to find films similar to Grease?
<< FIND THEM HERE! >>

Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grease (1978)

A musical about teens in love in the 50's! It's California 1959 and greaser Danny Zuko and Australian Sandy Olsson are in love. They spend time at the beach, and when they go back to school, what neither of them knows is that they both now attend Rydell High. Danny's the leader of the T-Birds, a gro β€¦up of black leather jacket-wearing greasers while Sandy hangs with the Pink Ladies, a group of pink-wearing girls led by Rizzo. When they clash at Rydell's first pep rally, Danny isn't the same Danny from the beach. They try to be like each other so they can be together. (Read More)

Subgenre:
teen romanceteen moviecoming of agecult film
Themes:
first lovewrestlingdancejealousyfriendship
Mood:
high school
Locations:
school dancebaseballlos angeles californiaschoolbeach
Characters:
australianfemale protagonistteenage boyteenage girlboyfriend girlfriend relationshipteenager
Period:
summer1950s
Story:
smoking a cigarettecigarette holdersummer romancedance contestlast day of schoolschool principalreference to rosemary clooneyspandex disco jeansbased on stage musicallos angeles storm drainhair colorscanimatepep rallyear piercingpregnancy scare β€¦wrong side of the trackswolf whistlefunhouseblack leather jacketgreaserdrive in theaterbleachersyear 1959pie in the facehickeyauto repairlive televisionstudent athletefamous songcigarette smokingexchange studentautomobile racingdrag racingslumber partyyearbooknostalgictv show in filmflying caranimated creditsopposites attractunderage smokingferris wheelmooningcigarettemakeoverlockerstreet gangreference to elvis presleygraduationyoung loverivalunderage drinkingnostalgiacarnivalamerican footballgossipblockbusterlifting someone into the airloss of virginityteen angstcoachpremarital sexcheerleaderwigconvertibleringfantasy sequencedinerbasketballrock musicrunningcondomblondecar accidentone word title (See All)

Pretty In Pink (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pretty In Pink (1986)

Teenager Andie is one of the not-so-popular girls in high school. She usually hangs out with her friends Iona or Duckie. Duckie has always had a crush on her, but now she has met a new guy at school, Blane. He's one of the rich and popular guys but can the two worlds meet?

Subgenre:
teen romanceteen moviecoming of agecult filmindependent filmteen comedy
Themes:
first lovedancefriendshipdrinkingdrunkennessangerpovertydysfunctional familydatingunrequited lovefashionwealth
Mood:
high school
Locations:
school danceschooltrainnightclubschool teacher
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfather daughter relationshipsingerstudentmusicianlustteacher student relationshipchinesesingle father
Period:
1980s
Story:
dance contestwrong side of the tracksslumber partyyearbookopposites attractlockerteen angstconvertibleblondekissdancingphotographsingingthree word titlepanties β€¦cryingunderwearfistfightwatching tvcomputertearsmarijuanacolor in titlecleavagebrarock bandwhite pantieslibraryargumentmicrophonegymhigh school studentclass differencesredheadrecord playergirl in pantieseyeglassesnerdtraditionanswering machinedresstitle based on songcrushforbidden lovepet dogshoppingposterplaying cardscartoon on tvteenage lovealarmbicyclingmaking outvolleyballlistening to radiogeneration gapteenage daughterpromaudio cassettehouse partysewing machinedesignerhigh school girlhomeworkreference to madonnasuitorrecord storemusic storesnobphonograph recorddevotionreference to karl marxhigh school dancehigh school boynylonsrich snobwashroomteenage romancehalljuvenilehigh school promteen lovereference to franklin d. rooseveltunderageparty dressbrat packrich man poor womanshy girlschool yearbookrailroad tracksreference to david lettermanmusic albumhigh school sweetheartsprom dressbreasts growingsocial consciousnessreference to tina turnertwo suitorspreppiesingle dadreference to lionel richieshermer illinois (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Sixteen Candles (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sixteen Candles (1984)

Samantha's life is going downhill fast. The sixteen-year-old has a crush on the most popular boy in school, and the geekiest boy in school has a crush on her. Her sister's getting married, and with all the excitement the rest of her family forgets her birthday! Add all this to a pair of horrendously β€¦ embarrassing grandparents, a foreign exchange student named Long Duk Dong, and we have the makings of a hilarious journey into young womanhood. (Read More)

Subgenre:
teen romanceteen moviecoming of agecult filmteen comedy
Themes:
first lovemarriagedrunkennessweddingdysfunctional familyunrequited love
Mood:
high schoolbreaking the fourth wall
Locations:
schoolrestaurantchurchschool bus
Characters:
teenage boyteenage girlteenagerfamily relationshipsfather daughter relationshipmother daughter relationshipbrother sister relationshipsister sister relationshipjapaneseself discoverydream girl
Period:
1980s
Story:
exchange studentunderage drinkinglifting someone into the airloss of virginityteen angstconvertiblecar accidentfemale nuditynumber in titlefemale frontal nuditytwo word titlephotographpartypanties β€¦showerunderwearbeerbirthdaylingeriegay slurwhite pantieslooking at the camerasuburbfemale removes her clotheshigh school studentdirectorial debutgrandmotherclass differencesrecord playerpizzabirthday cakenerdfarcetitle based on songcrushgrandfatherwedding dressethnic slurgeekfirst daterestroom16 year oldjockunderage sexporscheillinoisnight vision gogglesveilshower roomdental bracesperson in a car trunkhigh school dancehouseguestcoors beerasian stereotypeyellow pantiesdorkbrat packdental headgearwild partyshy girlwedding veildrive in restaurant16th birthdayfuture in lawswedding ceremony gone awrybridal veilforgotten birthday16 year old girl (See All)

The Princess Diaries (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Princess Diaries (2001)

Mia Thermopolis is the average teenager - sweet, a little geeky and pretty much invisible to everyone with the exception of her mother, best friend Lilly and Lilly's older brother Michael. Making it through high school without throwing up is a challenge in itself for Mia, so it doesn't come as welco β€¦me news when her estranged grandmother shows up out of the blue and calmly informs her that she is in fact the heir to the throne of a European country called Genovia. Suddenly Mia's life is thrown into complete overload. She's being taught about scarves, waves and pears in order to become a perfect princess, she gets a makeover and a tough looking yet sweet bodyguard/limo driver called Joe. Things get out of hand when the media gets a hold of the story and suddenly Mia is thrust into the spotlight in both the newspapers and in school. On top of all that Mia has a choice to make. She must decide by Genovia's Independence Day Ball whether she longs to relinquish her claim on the throne or to become the princess and heir to the throne her father and grandmother want her to be. (Read More)

Subgenre:
teen romanceteen moviefish out of water
Themes:
first lovedancefriendshipdrunkennessdeath of fatherdatingunrequited love
Mood:
high schoolrain
Locations:
schoolbeachhelicopterpolice carsan francisco californiaschool teachercable carbeach party
Characters:
female protagonistteenage boyteenage girlteenagermother daughter relationshipsingerteacherpolice officermusicianwriterbest friendbullysingle mothermayorgrandmother granddaughter relationship
Story:
school principalauto repairmakeoverlockerteen angstcheerleaderfantasy sequencebasketballrock musiccar accidentbased on novelflashbackvoice over narrationcell phonecat β€¦cameraletterpaintingsunglassesclassroomguitaralcoholreportersoccerjournalistwomanrock bandnunpainterpantyhoseprincesscoffeelimousinemicrophonelocker roomumbrelladiarygymspeechbodyguarddateloss of fatherclassreference to william shakespearequeenpizzateaballoonhatroyaltysecurity cameramediacrushtv showdebategirl with glassescamera shot of feetyogacameosculpturebutlerfirst kissschool uniformchoirschoolgirl uniformsailortuxedogeekviolinistchauffeurhairdressercandydinner partyhigh school teacherfountainteenage lovefemale teachersailboatarcadewhistlesailingscooterharmonicaprincipalfriendship between girlsgreenhousekiss on the lipsgiving a toastpopularitypaparazzipressawkwardnesschewing gumauto mechanicford mustangprivate schoolscarfpizza deliveryteenage crushbechdel test passedpuerto ricanarm wrestlingrock musiciangolden gate bridgeconductorrock climbinglocketkeyboardpacific oceandance lessonballroom dancingtennis courtenvelopefictional countryice cream conetrolleycar mechanicturbanbrandymarionettepreparatory schoolclassic carphoto boothgym teacherfictional talk showtalking to an animalsoftballlimousine driverpublic speakingdartsbeauticiancinderella storyetiquettegarage bandpopular girlprincipal's officemannerspole the structurebehavior modificationconsulatepearugly ducklingkiss on cheekdancing lessontelevision writerchoir practiceodd neighborrose gardenpearl earringtransamerica pyramidcorndogfirehousecharm braceleteyebrowssashschool choirfoot popping kissawkward girlneedlepointroyal ballpublic access televisionbook bagwalking with a book on one's head (See All)

Clueless (1995) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Clueless (1995)

Cher, a high school student in Beverly Hills, must survive the ups and downs of adolescent life. Her external demeanor at first seems superficial, but rather it hides her wit, charm, and intelligence which help her to deal with relationships, friends, family, school, and the all-important teenage so β€¦cial life. (Read More)

Subgenre:
teen romanceteen moviecoming of ageteen comedycomedy of mannerscoming of age film
Themes:
dysfunctional familyfashion
Mood:
high schoolsatireaffection
Locations:
los angeles californiaschoolschool teacher
Characters:
female protagonistteenage boyteenage girlteenagerteacherlawyerteacher student relationshipdaughtergay teenagersingle fatherstepbrother stepsister relationshipnew student
Period:
1990s
Story:
opposites attractmakeoverlockerteen angstblondeone word titlef ratedbased on noveltitle spoken by characterpartysurprise endingcell phonetitle directed by femaleclassroomno opening credits β€¦drawingvirginmini skirthigh school studentschoolgirlloss of motherreference to william shakespearefalling down stairsjeeptennisdebatecamera shot of feetshopping mallskateboardingshaved headhappy endingtriple f ratedbongfemale friendshipfriendship between girlsteenage daughterpopularitymugginghigh school girlreference to shakespeare's hamletfootsienarrativeplaying footsieskateboarderbeverly hills californiageneration xcliquematchmakershakespearean quotationgym teacherwardrobebracesmodern day adaptationrich girlhigh school boyblonde stereotypereference to oscar wildereference to barbra streisandreference to mel gibsonpopular girlcellular phonereference to jane austendriving testgirl wearing a miniskirtwoman wearing a miniskirtnietzschevalley girlreference to claude monetreference to billie holidayends with weddingsocial consciousnesscartoon on televisionreport cardlove poemknee high socksreference to the rat packdumb blondereference to tony curtisreference to pippi longstockingolder person playing teen (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Grease 2 (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grease 2 (1982)

Return to rockin' Rydell High for a whole new term! It's 1961, two years after the original Grease gang graduated, and there's a new crop of seniors - and new members of the coolest cliques on campus, the Pink Ladies and T-Birds. Michael Carrington is the new kid in school - but he's been branded a  β€¦brainiac. Can he fix up an old motorcycle, don a leather jacket, avoid a rumble with the leader of the T-Birds, and win the heart of Pink Lady Stephanie Zinone? He's surely going to try! (Read More)

Subgenre:
teen romance
Themes:
dancelovegangsterrivalrybreak upboy girl friendship
Mood:
high school
Locations:
schoolmotorcyclepolice cargas stationschool bustwo on a motorcycle
Characters:
teenage boyteenage girlteenagerteacherstudentcousin cousin relationshipex boyfriend ex girlfriend relationship
Period:
1950s1960syear 1961
Story:
black leather jacketgreasercigarette smokingopposites attractteen angstcheerleaderdinernumber in titlesequelkissdancingsingingclassroomrabbithigh school student β€¦group of friendsbikerbowlingleather jacketenglishman abroadpiano playingtween girlbowling alleybriton abroadtalent showintergenerational friendshiptwin sistergogglesschool lifemotorcycle with a sidecargas station attendantnumber 2 in titledirt bikeplay rehearsalmotorcycle helmetboy meets girlbomb shelterdance numberpublic address systemflag polemotorcycle jumppink carsexy teachernurse cap (See All)

She's All That (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

She's All That (1999)

She's All That is your typical high school prom king and queen story and the run in defending the star status in the upcoming election. High school hottie, Zack Siler is dumped by his prom-queen girlfriend, the equally attractive and extremely popular, Taylor Vaughan who fell for a second-hand world β€¦ reject TV soap star who she met over the spring break. Having been publicly dumped, Zack defends his discomposure by stating that Taylor is all make-up and wonder-bra and he can make any ordinary girl a prom queen with a similar package. His high-school buddy, Dean Sampson, engages him in a bet following this statement and picks the geeky looking Laney Boggs out of the crowd as the girl Zack must transform into the new prom queen. Zack agrees since he has no option, but as time passes and Laney begins to transform, Zack begins to find her attractive. While all that falls beautifully in place, it's not your typical fairy-tale. Throw in Dean Sampson to complicate the situation, as when he first made the bet he never thought that Zack could rise to the challenge but looking at how Laney has transformed, it looks like Zack could be on a winning streak. (Read More)

Subgenre:
teen romanceteen moviecult filmfish out of waterteen comedy
Themes:
friendshipdeceptionhumiliationrivalrybullyingfalling in love
Mood:
high schoolnightmare
Locations:
los angeles californiaschoolbeach
Characters:
teenagerfather son relationshipfather daughter relationshiptattoobrother sister relationshipbullyself expression
Story:
wrong side of the tracksstudent athleteyearbookopposites attractmakeovergraduationyoung loveunderage drinkingteen angstkissdancingtitle spoken by characterpartybikini β€¦vomitingtransformationpublic nuditylocker roomloss of mothernerdjeepblack humorbreakupmakeupbetcafeteriamisfitvolleyballpopularitywagerpromjockhouse partychick flickperformance artfast food restaurantjerkmodern artsoccer footballperformance artistart classhigh school dancetv starclown makeupcinderella storypool cleanerbeeperbeatboxingtrippingugly ducklingpygmalionmusical sequence in non musical workfemale rivalryeyebrowsspontaneous choreographyavante garde art (See All)

High School Musical 3: Senior Year (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High School Musical 3: Senior Year (2008)

Troy and the gang of East High School are going through their senior year, facing graduating and going their separate ways. Coming to terms with the reality of it all, Troy wants to attend the nearby University of Albuquerque next year on a basketball scholarship, but Gabriella wants to attend Stanf β€¦ord University in California. Meanwhile, Sharpay, the school's shallow and spoiled rich girl, plots to go all out planning the school's final musical show with the idea to add music to her hopes and fears about the future. While Sharpay takes an up-and-coming British exchange student under her wing, her flamboyant fraternal twin brother, Ryan, has his sights set on something different after school. In addition, Troy's best friend and basketball teammate Chad, and Garbiella's best friend Taylor, all have their sights set on their plans after high school and come to terms with the reality of the real world. (Read More)

Subgenre:
teen romancehigh school dramahigh school musical
Themes:
dancefriendshiprivalry
Mood:
high school
Locations:
schoolrooftop
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipfamily relationshipssingerdancerinterracial relationship
Period:
2000s
Story:
exchange studentgraduationbasketballf ratednumber in titlesequeldancingsingingsongdigit in titlenumbered sequelpianono opening creditsthird partinterracial romance β€¦stage performancebloopers during creditsjunkyardoptimismcamera focus on female butthigh school graduationhigh school seniorsong and dancegraduateserenadehigh school basketballchastitydiplomacurtain callmise en abyme (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Cinderella Story (2004) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Cinderella Story (2004)

Samantha or "Sam", has a rough childhood with her father dying in an earthquake and a new stepmother with two awful stepdaughters. But on the bright side, Sam has an awesome best friend named Carter and an email relationship with a guy named Nomad. One day, Sam gets an email from her Nomad saying th β€¦at he wants to meet her in the middle of the dance floor at their high school Halloween dance. She accepts the invitation and glides into the room wearing the best outfit ever! Her Nomad takes her outside where they share a romantic dance together and Sam realizes that her email friend is the most popular guy in school, Austin Ames. She runs back to her stepmother's diner before she knows she went to the dance and drops her phone on the way. Austin finds it and starts a search for his Cinderella. (Read More)

Subgenre:
teen romanceteen moviefairy tale
Themes:
danceweddingdeath of fatherhumiliationunrequited love
Mood:
high school
Locations:
school dancelos angeles californiaschool
Characters:
female protagonistteenage girlfather daughter relationshipteacher
Story:
wolf whistlemakeovercheerleaderdinermaskcollegehalloweeninternetmistaken identityuniversityhalloween costumehigh school studentloss of fatherpublic humiliationlying β€¦legsbully comeuppancequitting a jobpopularityjack o'lanterncomeuppancesnowglobestepsisterhigh school athletetwin sisterscat costumecorrespondencechat roomcinderella storyangel costumenun's habitstepsister stepsister relationshippopular girlfitting inkissing in the rainprinceton universitycostume shopevil step motherhomecoming dancezorro costumeawkward girlhalloween dance (See All)

The Last Song (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last Song (2010)

Ronnie's (Miley Cyrus) and her younger brother, Jonah's, parents are divorced. They live with their mother until this summer when they are sent to live with their father (Greg Kinnear) in a small town on the beach. Ronnie resents her father and has no intention of being friendly or even talking to h β€¦im for the summer. But after meeting a handsome guy and beginning to fall in love, Ronnie starts rediscovering her love for music, something she shares with her father. Reconnecting with music revives a kinship with her father which proves to be the most important relationship she may ever experience. (Read More)

Subgenre:
teen romanceteen moviecoming of age
Themes:
loveweddingfuneraldeath of fathercancerguiltfalling in lovewealthforgiveness
Locations:
beachhospitalchurch fire
Characters:
female protagonistteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipsfather daughter relationshipboybrother sister relationship
Period:
summer
Story:
summer romanceyoung lovecarnivalteen angstbased on novelbare chested malekissfightdancingpartythree word titlefiretitle directed by femalerescuetears β€¦pianistdateloss of fatherarsontoweldivingshopliftingreconciliationfather figureaquariumvegetarianpiano playingdivorced parentsraccoonswimwearbeach volleyballhidden truthrebellious daughterstained glass windowfather daughter conflictrebelliousnesssea turtleattitudetrying on clothesspilled drinkjuilliard school manhattan new york cityfather children relationshipsent away (See All)

Election (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Election (1999)

Tracy Flick is running unopposed for this year's high school student election. But school civics teacher Jim McAllister has a different plan. Partly to establish a more democratic election, and partly to satisfy some deep personal anger toward Tracy, Jim talks popular varsity football player Paul Me β€¦tzler to run for president as well. Chaos ensues. (Read More)

Subgenre:
teen romanceteen moviecoming of agegay interestblack comedypolitical satireteen comedy
Themes:
jealousymarriageinfidelityreligionbetrayalpoliticsadulterylesbianismextramarital affairdivorcecorruptionunfaithfulnesscruelty
Mood:
high schoolsatire
Locations:
schoolnew york citybicyclecatholic school
Characters:
female protagonistteenage boyteenage girlteenagerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteacherstudentlove triangleteacher student relationship β€¦gay teenagerself destructivenessteacher student sexlesbian daughterself absorption (See All)
Story:
graduationteen angstrunningblondeone word titlef ratedbased on novelflashbacksex scenekisstitle spoken by characterpartylesbian kiss β€¦showervoice over narrationcryingurinationprayermanhattan new york cityconfessionlimousinefired from the jobelectionkissing while having sexclass differencesteenage sexwashington d.c.freeze framedestinyathletejoggingoverallsbroken legapplemoralityjanitorcynicismhot tubswingposterfemale female kissteachingethicsteenage loveblonde womanmotel roombeeelection campaignpolitical campaignenvyteenage daughterteenage sexualitystatue of liberty new york cityjointjockpolitical candidatespitteenage crushsex with a minormarital infidelitygirls' schoolnebraska16mmhigh school athletepepsibracesbannerpower plantcampaigningclicheridiculedumped by girlfriendphotocopiermultiple narratorsbee stinglesbian teensprinkler systemteen lovehistory teacherlawn mowingasparaguspinpower lineapple treepower stationlesbian sisternarcissistic personality disorderchemistry classgirl girl relationshipomaha nebraskaoverachieverskiing accidentwipemathematics teacherfaculty loungehigh school electionlincoln memorial washington d.c.student council presidentmuseum guideteenage issuesparochial schoolschool administratorhigh school vice principalwide angle lensstudent governmentvote tampering (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dirty Dancing (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dirty Dancing (1987)

In 1963, Frances "Baby" Houseman, a sweet daddy's girl, goes with her family to a resort in upstate New York's Catskill Mountains. Baby has grown up in privileged surroundings and all expect her to go on to college, join the Peace Corps and save the world before marrying a doctor, just like her fath β€¦er. Unexpectedly, Baby becomes infatuated with the camp's dance instructor, Johnny Castle, a man whose background is vastly different from her own. Baby lies to her father to get money to pay for an illegal abortion for Johnny's dance partner. She then fills in as Johnny's dance partner and it is as he is teaching her the dance routine that they fall in love. It all comes apart when Johnny's friend falls seriously ill after her abortion and Baby gets her father, who saves the girl's life. He then learns what Baby has been up to, who with and worse - that he funded the illegal abortion. He bans his daughter from any further association with "those people". In the first deliberately willful action of her life, Baby later sneaks out to see Johnny - ostensibly to apologize for her father's rudeness - and ends up consummating her relationship with Johnny. A jealous fellow vacationer sees Baby sneaking out of Johnny's bungalow the next morning, and in an act of retribution, tells management that he is responsible for a theft the evening before, knowing he would not furnish his real whereabouts. (Read More)

Subgenre:
teen romanceteen moviecoming of agecult filmindependent film
Themes:
first lovedancelovetheftabortion
Mood:
rainnight
Locations:
rural settingstorm
Characters:
female protagonistteenage girlteenagerfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipdoctordancersister sister relationship
Period:
summer1960syear 1963
Story:
summer romancewrong side of the tracksfamous songopposites attractgossipblockbusterpremarital sexblondetwo word titlebare chested maledancingsingingpantiesvoice over narrationsunglasses β€¦cleavagenew yorkwhite pantiesbrunettefalse accusationapologyman with glassesscantily clad femalepantyhosemicrophonevacationsensualitydirectorial debutclass differencesapplausewaiterscene during opening creditsred dressvisitdriving a carforbidden lovecamera shot of feetbarefootnicknametitle at the endopening a doorhappy endingsexual awakeningpink pantieslegsmarried coupleknocking on a doorresortmegaphoneteenage daughterlying on bedchick flickwatermelonwaking upunwanted pregnancyeuphemismsong during end creditsfade to blackdriving at nightfamous lineliberalolder man younger womandance lessonprotective maleshort shortsfamily vacationalliterative titlebreaking a car windowsexual euphemismparking a cardance instructortightstwo sistersspeaking to audienceclass systemreference to cleopatrafather daughter hugcatskills1957 chevroletlabor day (See All)

Risky Business (1983) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Risky Business (1983)

A suburban Chicago teenager's parents leave on vacation, and he cuts loose. An unauthorised trip in his father's Porsche means a sudden need for lots of money, which he raises in a creative way.

Subgenre:
teen moviecult filmerotic fantasy
Themes:
wrestlingjealousyfriendshipdrugsmoneyvoyeurismrobbery
Mood:
high schoolcar chase
Locations:
cartaxiairportchicago illinoiscar in waterschool nursesex in a chair
Characters:
teenage boyteenagerfather son relationshipmother son relationshipfriendprostitutepimpdancing in underwear
Period:
1980s
Story:
auto repairunderage drinkingblockbusterteen angstpremarital sexfantasy sequenceblondesexfemale nuditymale nudityfemale frontal nuditymasturbationtwo word titlebare chested malesex scene β€¦dancingpartypantiesshowertelephone callwoman on topunderwearslow motion sceneundressingbedmarijuanabathroomprostitutionvoyeurtelephonecleavagebedroomhousesubwaywhite pantiesscantily clad femalestrippingprankdirectorial debutclass differencesteenage sexsexual fantasyshavingdesirenipples visible through clothingpokersexual attractiongroup of friendsice creamred dressblack humormale underwearsexual desireburglarysex talkpanties pulled downsexual humorattractionextortionliving roombriefswrestlermale in showerclose up of eyespractical jokedockcar drivingfemale removes her dressstairwaymini dresscall girlbikeporschewhite briefsdrug humorsex on stairspoker gameoverhearing sexsubway trainshort shortsfemale in a showerhome alonesodaadolescent boysexual jokecounting moneylifting weightsburgermale in a showerkissing in publicdark glassesbutt grabelectric razorwearing sunglasses at nightweight trainingtransvestite prostitutelake michiganfifty dollar billcollege boundfaberge egghigh school wrestlingalone in houseadult actor playing minorbaby picturecollege interviewtrashed housepop quiz (See All)

A Walk To Remember (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Walk To Remember (2002)

In North Carolina especially in Beaufort a prank on a guy goes wrong and puts the student in the clinic. Carter, a famous student with no plans for the future, is held responsible and forced to join in after-school community service activities as consequence, which include starring as the lead in th β€¦e play. And participating in these activities is Jamie Sullivan, the reverend's daughter who has great ambitions and nothing in common with Landon. When Landon decides he wants to take his activities seriously, he asks Jamie for help and begins to spend most of his time with her. But he starts to like her, that he did not expect to do. They relationship, much to the chagrin of Landon's old popular friends and Jamie's strict reverend father. But when a heart-breaking secret becomes known that puts their relationship to the test, it is then that Landon and Jamie realize the true meaning of love and fate. (Read More)

Subgenre:
teen romanceteen moviecoming of agecult filmtragedymelodramahigh school dramateen drama
Themes:
first lovejealousyfriendshiprevengemarriageescapeweddingdeceptioncancerredemptiondatingfaithnear death experience
Mood:
high schoolcar chasetearjerkerbittersweet
Locations:
schoolhospitalrestaurantchurchcemeterysmall townwheelchairpolice carschool bus
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfather son relationshipmother son relationshipfather daughter relationshipdoctortattoopolice officernursestudentpriestchristianbest friend β€¦bullysingle motherchristianitysecurity guarddirectorbibleex husband ex wife relationshipex boyfriend ex girlfriend relationshippolice chasesingle fatherself confidence (See All)
Period:
2000s
Story:
yearbookopposites attractunderage drinkingteen angstbasketballcar accidentbased on novelkissdancingsingingvoice over narrationurinationrescueslow motion scenepunched in the face β€¦bookcar crashpianoflashlightambulancemontagefour word titledrivingmarriage proposallibrarycharacter repeating someone else's dialoguewidowerprankhigh school studentdatecharacter says i love yousingle parentterminal illnessrevelationwhat happened to epiloguefaintingscene during opening creditsmale bondingrebeljumping from heightforbidden loveinterracial friendshippreacherambitiontelescopeministermiraclelove at first sightfirst kissbutterflychoirbalconyswinglonerpassionate kissjuvenile delinquentdead mothersports carpractical jokewedding ceremonyoutcastparalysishigh school teachercafeteriateenage lovecrutchesbully comeuppanceoutsiderpeer pressurestage playteenage daughterleukemiatutorreverendjocknorth carolinastar crossed loverswet t shirtchick flickchapelhigh school girlfather son estrangementcar radiofather son reunionscriptschool playcometchurch servicedance lessongospelsweatercliquedockscrutchhigh school principalreference to aristotlestar gazinghigh school boyacting musicianteenage rebellioncommunity serviceevangelical christianityinitiation riteaccident victimprank gone wronglife changingintimateteen rebelgospel choirmobbinghigh school sweetheartsbad boyends with weddingsweetheartwet pantsdrama clubamerican muscle (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Sisterhood Of The Traveling Pants (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sisterhood Of The Traveling Pants (2005)

The movie is based on the young adult book, The Sisterhood of the Traveling Pants, by Anne Brashares. As four best friends spend their first summer apart from one another, they share a magical pair of jeans. Despite being of various shapes and sizes, each one of them fits perfectly into the pants. T β€¦o keep in touch they pass these pants to each other as well as the adventures they are going through while apart. (Read More)

Subgenre:
teen romanceteen moviecoming of agedocumentary filmmakingdocumentary footage
Themes:
first lovefriendshipdeathpregnancyweddingfuneralfilmmakingdating
Locations:
beachhospitalchurchcemeterynightclubairportkitchenmexicosinging in a carfishing boat
Characters:
female protagonistteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipsfather daughter relationshipmother daughter relationshipboygirlpriestlittle girlmaidfilmmakeramerican abroadchildhood friend β€¦self discovery (See All)
Period:
summer
Story:
cigarette smokingloss of virginityteen angstblondef ratedbased on noveldancingphotographpartypantiesvoice over narrationcryingwatching tvcomputerletter β€¦tearscleavagesoccerbracandlevideo cameraambulancewhite pantiescoffindrawingjeansvacationpianiststagefirst partloss of motherterminal illnesssupermarketgroup of friendsjoggingloss of friendloss of loved onetimetennisbrideremote controlpet doggreeceheadphonesfirst kisslaughingsirenadolescentmusic bandjoygirl in bra and pantiesdonkeywedding ceremonylatinasummer campfriendship between womenfemale friendshiptween girlparamedicfriendship between girlsstretcherballerinaleukemiasummer vacationcruise shipwindmillsoccer playerchick flicksoccer matchbabysittingstarsbus ridesick childmailmanpuerto ricanteenage girl in underweartailorclumsinessfamily feudmortalityvideo cassettemotor scooterwedding gowndocumentary crewairlinersmilingswimming in underwearsouth carolinabedriddenblue hairensemble filmdeath of parentfemale artistgoodbyedeath of a childmediterraneangreen hairbased on young adult noveltrouserssoccer coachsisterhoodsummer jobteenage girl in swimweargreek islandstring quartetpantssleep overgreyhound bussports brayoung filmmakerisland lifeaerobics classdepartment store clerk (See All)

Never Been Kissed (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Never Been Kissed (1999)

Chicago Sun Times copy editor Josie Gellar (25), who was desperate to graduate from perfectionist copy editor to reporter, gets her chance when the goody owner orders the editor to cover the high-school scene by undercover. Josie, who was a frustrated, ridiculed nerd, gets a popular make-over from h β€¦er drop-out, naturally funny brother Rob Geller. Both siblings find love and joys of youth again. But in Josie's case, it's sensitive bachelor teacher Sam Coulson, who enjoys sophisticated conversation. As the publication deadline approaches, the price of blowing their cover seems ever more daunting, yet inevitable unless she sacrifices her career. (Read More)

Subgenre:
teen romanceteen movieteen comedy
Themes:
first lovefriendshiphumiliationcruelty
Mood:
high schoolaffection
Locations:
schoolcarchicago illinoisold car
Characters:
female protagonistteenage boyteenage girlboyfriend girlfriend relationshipboybrother sister relationshipteachergirlstudentteacher student relationship
Period:
1980s1990s
Story:
teen angstcoachflashbackbare chested malekisspartythree word titleswordclassroomreporternewspaperjournalistundercoverprankhigh school student β€¦nerdathleteeggjournalismcrushembarrassmentsurveillance camerapublic humiliationbriefsteachinghigh school teachercafeteriadouble lifeeditorbaseball playersex educationnewspaper articlepopularitybaseball gamepromchick flickhigh school girlbaseball fieldschool lifebaseball stadiumcliqueentrapmentgymnastbraceshigh school boysombrerohigh school prompopular girlshakespeare in modern dressnewspaper storypygmalionundercover missionsurveillance deviceundercover reporterundercover journalistnorthwestern universitypopular teacherassistant coachsenior prom (See All)

The Virgin Suicides (1999) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Virgin Suicides (1999)

A man about forty years of age tells the story from when he was a teenager in upscale suburban Detroit of his and three of his friends' fascination with the mysterious and doomed Lisbon sisters. In 1974, the sisters were seventeen year old Therese, sixteen year old Mary, fifteen year old Bonnie, fou β€¦rteen year old Lux, and thirteen year old Cecilia. Their fascination still remains as they try to piece together the entire story. The sisters were mysteries if only because of having a strict and overprotective upbringing by their father, who taught math at the girls' private co-ed school, and overly devout Catholic mother, who largely dictated the household rules. The story focuses primarily on two incidents and the resulting situations on the girls' lives. The first was an action by Cecilia to deal with her emotions over her life. And the second was the relationship between Lux - the sister who pushed the boundaries of the household rules most overtly in doing what most teenagers want to do - and Trip Fontaine, he who could have any girl he wanted but wanting solely Lux. (Read More)

Subgenre:
teen moviecoming of agecult filmindependent filmblack comedycoming of age film
Themes:
first lovejealousydeathsuicideinfidelitybetrayalghostadulterydrinkingescapedeceptionmemoryextramarital affairobsessiondepression β€¦unfaithfulnessmental illnessunrequited loveregret (See All)
Mood:
high school
Locations:
school danceschoolhospitalswimming poolcemeterytaxi
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipsingerteacherdancerpriestsister sister relationshiplust β€¦psychiatristcatholiccatholic priestgay fatherwriter directorself destructivenessdeath wishself inflicted injuryhomosexual father (See All)
Period:
summer1970s
Story:
cigarette smokingunderage drinkingamerican footballgossiploss of virginityteen angstsexf ratedbased on novelflashbackkissdancingsingingpartyvoice over narration β€¦cryingsongtitle directed by femaledreamunderwearwatching tvdrinkvomitingtearssunglassesmarijuananeighborhallucinationvoyeurclassroomprayertelephoneambulanceimpalementsuicide attemptdinnerchild abusegraveyardtalking to the cameravirginsuburbpop musicpoisonpassionstorytellinghangingdiarymanipulationtragic eventcrosssplit screenrock 'n' rollisolationdirectorial debutclassteenage sexrecord playerflirtingpot smokingloyaltyballoonrecordingcrucifixwatching a moviemagazinemovie theatergay parentflatulencehome movietennisvirginitypeeping tomgas masktelescopefootball playertheatre audiencecigarette lightertime lapse photographyaviationnotemelancholypromiscuityreflectionnews reportersexual awakeningteachingcannabishigh school teacherhomecomingpostcardfenceloss of daughterrepressiontombstonetween girltv reportersexual promiscuityinsomniarumorinfatuationpoisoninggeneration gapwrist slittingpopularityloss of childfootsie under the tablehearseprommichiganschoolteacherdown syndromequarantinebeltfootball teamlabor unionknittingenigmateen suicidefirst sexual experiencecocktailunicornfemale to male footsie playingabusive mothertennis courtasphyxiationsexual explorationtamponmental instabilitylabor strikemirror ballsleeping pillshigh school dancemodel airplanetv crewfootball stadiuminsulinsparklerfootball fieldlawn sprinklerpopsiclehouse arrestinnocence lostdebutantemorse codemass suicidelovesicksouvenirauditoriumhanged girlabused childrat poisonmentally challenged personchild suicidejumping off a rooffootball practiceoverprotective parentsuicide preventiondrugged foodpicket lineyale universitycarbon monoxide poisoninginsomniacgirls' bathroommathematics classmath teacherbrownie the foodprom dressschnappsgas stoveimpaled childstrict mothercataloguetalking to a plantemotional depressionhollyhomecoming dancereference to kiss the bandmaximum securityphotosynthesisdead child with eyes openreference to aerosmith the bandscotch tapemysteriousnesstwo on one footsie playingbaseball on tvelmiron fencemedicine overdosestrict parent (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Crossroads (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Crossroads (2002)

Three best friends get together and bury a box, making a pact to open it at midnight at their high school graduation. In the small town in Georgia that they live in, things soon change. One is little miss perfect, one is an engaged prom queen, and the other is a pregnant outcast. On the night of the β€¦ir graduation, they open the box and they strike up a conversation. Suddenly, one brings up the topic of her going to Los Angeles for a record contract audition. They all decide to go together and they leave. With a little money, they set out on the road with a guy named Ben. When one of them tells the other a rumor that he might be a homicidal maniac, they are all scared of him. When they reach Los Angeles, Lucy (Britney Spears) falls in love with Ben and against her father's wishes, she stays and she goes to the audition. (Read More)

Subgenre:
teen movieindependent film
Themes:
friendshippregnancyangerwritingcampingdeath of unborn child
Mood:
high school
Locations:
los angeles californiaschoolbeachhospitalwaterroad tripmoteloceangas stationcampfiretexassinging in a carbeach party
Characters:
female protagonistteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipsfather daughter relationshiptattoosingerinterracial relationshipsingle fatherchildhood friendparent child relationshipold friendself confidencepregnant teenager β€¦self centeredness (See All)
Period:
2000s
Story:
graduationpremarital sexconvertibleblondeone word titlef ratedbare chested malekissdancingsingingpartycryingtitle directed by femaledreamunderwear β€¦punched in the faceundressinglingeriecriminaljourneynecklacehotel roomvirginpop musicpay phoneauditionon the roadproduct placementcrossdatekissing while having sexfalling down stairscatfightrape victimmale underwearsandboxer shortsrejectionnew orleans louisianakaraokearizonarainstormplaying pianomiscarriageteenage pregnancybloopers during creditsrunning awayfemale bondingfriendship between womenfemale friendshipfriendship between girlsdisappointmentsleeping in a carchick flickacoustic guitarcheating boyfriendold photographcross countryroadtripimplied sexsong during end creditsexpectant motherhigh school graduationbroken engagementgrand canyonpathpepsiaspiring singerteen drinkingconfidencemuscularsinging contestmother daughter reunionrealizationcrossroadsechofemale musiciantucson arizonacross country triprebelliousnessyoung romancebroken down carestranged motherchildhood friendsold friends reunitedbooingsmall town girlgirl talkshoeboxdancing in one's underwearpursue a dream (See All)

The Perks Of Being A Wallflower (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Perks Of Being A Wallflower (2012)

Based on the novel written by Stephen Chbosky, this is about 15-year-old Charlie (Logan Lerman), an endearing and naive outsider, coping with first love (Emma Watson), the suicide of his best friend, and his own mental illness while struggling to find a group of people with whom he belongs. The intr β€¦overt freshman is taken under the wings of two seniors, Sam and Patrick, who welcome him to the real world. (Read More)

Subgenre:
teen moviecoming of ageperiod film
Themes:
first lovedancejealousyfriendshipsuicidedrugschristmasdrinkingfearincestmemoryseductionlonelinessdepressiondrug use β€¦cancerguiltdatingmental illnesspoetryabusebullyingunrequited lovehomophobiabreak updyingwritingcheatingdying from cancerdeath of best friendsuicide of friend (See All)
Mood:
high school
Locations:
school dancehospitalrestaurantchurchsnowtrucktunnelcatholic churchpennsylvaniakitchen knife
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfrienddoctorsingerbrother brother relationshipboy β€¦brother sister relationshipteachergirlpolicemandancerphotographerwriterpriestbest friendreference to godgay kissbullylittle boyteacher student relationshippsychiatristcatholicgay teenagergay relationshipaunt nephew relationshipcatholic priestboyfriend boyfriend relationshipgay friendstepbrother stepsister relationshipnew friend (See All)
Period:
1990syear 1991
Story:
last day of schoolschool principalgraduationamerican footballcheerleaderrunningcondomcar accidentbased on novelflashbackkissfightdancingphotograph β€¦singingpartyknifetelephone callvoice over narrationcryingbeatingfoodmirrorface slapslow motion scenepunched in the facewatching tvcamerawritten by directordrinksecretlettershootingbooktearsbirthdaycafemarijuanabathroomcollegehallucinationreference to jesus christclassroomprayertelephonef wordsubjective cameragay slurbedroomwinecandledeath of friendeatingfootballsuicide attemptdinnerchild abusedrivingapologyracial slurpainflash forwardlibraryvirginreadingchristmas treecollege studentprankhigh school studentglassesrock 'n' rollsadnesssix word titleclassreference to william shakespearetypewritertrustteenage sexpickup truckbirthday cakeeyeglassescloseted homosexualhuggingfireplacelooking at oneself in a mirrorlistening to musicsexual abuseice creamred dresshappinessmovie theaterimpersonationnew year's evecrushvirginityclockpromisebuddhistmovie theatrenicknameinnocencepillssufferingmobile phonebackstagepunched in the stomachsexismkaraoketaking a picturemental hospitalfootball playertheatre audiencefirst kisschristmas evesurprisevoice over letterlong titlelonermale male kissdressing roomnervous breakdownholding handschildhood memorymale virgingoth12 year oldshynessvietnam veteranchristmas presentbirthday presentcafeteriahomecomingteenage lovefirst dateadolescencechild molestationblackoutlooking out a windowharmonicaponytaillsd16 year old15 year oldstonedkiss on the lipsunhappinessgiving a toastveganhazingtutoreasterpromaudio cassettehouse partylip synchingcar radioteenage crushdance scene11 year oldwriting a letterabusive boyfriendwhite brasuicide notegoth girlmassstudyingpittsburgh pennsylvaniasaying gracerecord storehigh school graduationletter writingfootball gamehigh school seniorreference to santa clausaspiring writerenglish teachersing alongholy communionscreenplay adapted by authorcaught in the actreference to frank sinatracrossing selfchristmas seasonreference to charles dickenslord's prayertruth or darehigh school dancehigh school principalblowing out candlecherryheartbeatteen drinkingintrovertbased on young adult novelfootball stadiumshort haircold the temperatureschool lockershort haired femaleadaptation directed by original authorfirst day of schooltouching someone's breastsshoplifternew year's daymilkshakechildhood flashback9 year oldfriendship between teenshigh school promaunt nephew incestpunk girlsign of the crosshappy new year7 year olddouble datedeath of auntreference to new york citysocial lifeblowing out candles on a birthday cakedrugged foodlistening to music on headphonesschoolboy crushschool cafeteriacaught kissing3d glassesenglish classfacial injuryprincipal's officeacid triphigh on drugsteen partybrownie the foodinfinitytheatre marqueereference to billie holidaysanta claus hatsnow angelgoing away partytripping someonehigh school lifereference to the smithsshovelling snowsinging along with a recordcollege acceptance lettergraduation cap and gownmale ponytailmix tapewriting a poemwallflowerhomecoming dancereference to harvard university45 recordingash wednesdaycollege acceptanceexamination resultshigh school prankmale in dragpaperbackschoolfightsat testreference to harvey milkreference to seattle washingtonshooting oneselfshop classhigh school freshmanmale slaps a femalenew suitreference to columbia universityone year time spanphone hang uprocky horror picture showapology for kissreference to fay wrayreference to to kill a mockingbird the novels.a.t.secret santa (See All)

The Wackness (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wackness (2008)

Friendship, love, and coming of age in New York City, summer of 1994. Luke Shapiro has just graduated from high school, sells marijuana, and trades pot for therapy from a psychologist, Dr. Jeffrey Squires. Luke is attracted to a classmate, Stephanie, who's out of his league and Squires' step-daughte β€¦r. By July, he's hanging out with Stephanie, taking her on his rounds selling pot out of an ice-cream pushcart. Then things take a turn. In the background, Squires and his wife as well as Luke's parents are having their troubles. (Read More)

Subgenre:
coming of ageindependent filmerotic fantasy
Themes:
first lovefriendshiploveinfidelitydrugsmoneydrinkingdrunkennessdivorcelonelinessparanoiadepressiondrug usedysfunctional familyunrequited love β€¦falling in love (See All)
Mood:
high schoolhip hop
Locations:
schoolbeachnew york citybartrainbicycleelevatorlakerooftopoceansex in shower
Characters:
teenage boyteenage girlteenagerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipafrican americanfriendpolice officerpolicemandancermusician β€¦best friendpsychiatristolder man younger woman relationshipgrandfather grandson relationshipgrandmother grandson relationshipdoctor patient relationshipsuicide by hangingstepfather stepdaughter relationshipolder man younger man relationshipparty girlsuicide by drowningconsidering suicidesuicide by pills (See All)
Period:
summer1990syear 1994
Story:
cigarette smokingunderage drinkingloss of virginitypremarital sexfantasy sequencecondomsexfemale nuditymale nuditymasturbationmale rear nuditydogbare chested malegunkiss β€¦dancingphotographtitle spoken by characterpartyerectionpistolshowertelephone callvoice over narrationcryingdreammachine gunmirrorurinationslow motion scenewatching tvdrinkarrestundressingbare buttbookvomitingbeertearsmarijuanasex standing upbathroomcollegejailvoyeurreference to jesus christguitarmanhattan new york citysubjective cameraswimmingnewspapercandledrug dealermontagecocainesuicide attempttoiletsubwayunderwater scenecoffeebartenderparkprologuepay phonemassagereadingcharacter says i love youhandgunobscene finger gesturegraffititherapyfreeze framesexual fantasypot smokinglistening to musicice creamjail cellexerciseguitaristdrug abusetherapisteccentricphone boothswimsuitvirginitystreet lifepillsnew jerseyattempted suicidehypocrisybackpackpet dogheadphonescigarette lightercard playingnintendoraised middle fingertuxedobrushing teethmarital problemworld trade center manhattan new york cityferrymidlife crisisfast motion scenemale virginimpotencenarrated by charactersandwichbongshortscentral park manhattan new york cityevictionmen's bathroomsnorting cocainejukeboxstonermasseusedrug dealmaking outtape recordingunconsciousnessstonedpopularitybeach housecdplaying a video gamereindeeraudio cassettealtered version of studio logopsychoanalysisbroken heartaerobicshomeless personpsychotherapyheatpremature ejaculationhigh school graduationboom boxcrossword puzzlewife leaves husbandbailgeneration xcassette tapehidden moneyillegal drugspagerwriting on a wallempire state building manhattan new york cityreference to bob dylansweatingsocial outcastshared showerwatching pornographygame boycheating on wifemagic mushroompeepholesummer jobprescription drugsbeeperdancing in the streetwanting a divorceattempted drowningreference to kurt cobaingraduation partyrotterdam netherlandswater ballooneye dropsforeign exchange studentterrierbongo drumdog urinationoutdoor showerritalincrying during sexeuphoriahigh school yearbookscratching facereference to goldilocks and the three bearsgraduation cap and gownreference to pearl jamworkout video40 ozmagic markerwest highland white terrierflushing drugs down a toiletpush cartcigarette behind earpracticing a line of conversationreference to rudy giulianialcohol in brown paper bagapartment evictionice cream cartblowing smoke ringscharacter lies about agefalling out of lovereference to boyz ii men (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Easy A (2010) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Easy A (2010)

After a little white lie about losing her virginity gets out, a clean cut high school girl sees her life paralleling Hester Prynne's in "The Scarlet Letter," which she is currently studying in school - until she decides to use the rumor mill to advance her social and financial standing.

Subgenre:
teen movieteen comedyteen sex comedy
Themes:
friendshipmarriageinfidelityreligionadulterydrinkingextramarital affairdivorceguiltunfaithfulnessdatinghomophobiaadoptiondevilreligious intolerance
Mood:
high schoolsatire
Locations:
schoolrestaurantchurchswimming poolkitchensinging in the shower
Characters:
female protagonistteenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationshipmother daughter relationshipfriendsingerboy β€¦brother sister relationshipprostituteteachergirlstudentpriestchristianbest friendreference to godchristianityteacher student relationshipbiblecatholicolder man younger woman relationshipgay teenagerolder woman younger man relationshipgay friendreligious fanaticreligious teen (See All)
Period:
2010s
Story:
school principalpep rallygossiploss of virginitycheerleaderbasketballcondomfemale nuditydogtwo word titlebare chested malesex scenekissphotograph β€¦singingpartypantiesshowertelephone callcryingcell phonesongmirrorface slapslow motion scenewatching tvdrinkliebeertearssunglassesvibratorbirthdaycafemarijuanareference to jesus christclassroomprayerguitarstrippercleavagegay slurbedroomcaliforniadinnerfalse accusationscantily clad femalespankingtalking to the cameraconfessionmicrophonevirginprotestlocker roomliarmini skirtmoaninggymamerican flaghigh school studentcrossgardenclassgraffitifreeze framemachismoscandalcloseted homosexualwaiterhuggingpot smokingfaintinghappinessdemonstrationfloridaone night standvirginitypreacherembarrassmentmovie theatrebloody noserap musiccynicismhypocrisyministerpunched in the stomachaquariumtime lapse photographyhit on the headpanties pulled downbookstorebelief in godcliffred pantiesclassmatelooking at self in mirrorpastorbigotrypromiscuityfast motion scenesouthern accentoutcastreference to facebooksneakerswoman cryingcafeterianame callingconfessionallegsrumorpeer pressurefascistprincipalfriendship between girlsacceptanceadopted sonpopularitycdman in swimsuitguitar playertolerancevolkswagenchick flickreference to googleweekendallergytextingsewingborn again christiandetentionunwanted kissinterracial adoptioncloseted gayinner title cardgay pridemotor scootercheerleader uniformvolkswagen beetleimplied nuditypreachingreputationhappy birthdayice cream coneenglish teachermascotcliquejumping on a beddevil costumegeneration yreference to marlon brandoteen drinkingpetitiongazebospin the bottleabstinencereference to tom cruiseinfamyguidance counselorwebcastbelief in the afterlifespellingwater slidewatching a movie on tvinnuendoreference to mark twaingay man straight woman relationshipbelief in hellpunched in the gut22 year oldsleazecommunity collegevespastdreference to disneylandadoptive father adopted son relationshippicture framemopping a floorpuritangreeting cardcomedic sex sceneenglish classnotorietyprincipal's officeschool suspensionanagramgirls' bathroompledgereference to huckleberry finnpietyschool bandcouponorange the fruitschool boardchocolate milkmascot costumebelief in the deviladoptive mother adopted son relationshipcontact lensessatan worshipbumping into someonestudent councilbad reputationprayer groupreference to alfred kinseycarpoolstate flagthrowing a cell phonebirth control pillreference to home depothand signaljesus freakporno theatrereference to ashton kutcherreference to costcoreference to demi mooreearth dayreference to disney worldhigh school gymnasiumreference to john hughesschool mascotchlamydiafake sexkissing gamepeasrumor mongerschool detentionsharpening a penciltowel snappingcleaning a bathroomcommunity gardenreference to google earthreference to sylvia plathreference to the scarlet letterspreading rumorbreaking a picture framegift cardreference to nathaniel hawthorne (See All)

Say Anything (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Say Anything (1989)

High school senior Lloyd Dobler wants nothing more than to go out with beautiful and intelligent Diane Court. Lloyd attempts to win her heart over the objections of her over-protective father before Diane leaves for a scholarship in England.

Subgenre:
teen romanceteen moviecult filmmartial artsteen comedy
Themes:
friendshiploveprisondivorceunrequited lovebreak up
Mood:
high school
Locations:
schoolairplaneengland
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfather daughter relationshipbrother sister relationshipdaughterself discoveryself doubt
Period:
summer1980s
Story:
last day of schoolgraduationtwo word titlefighttitle spoken by characterpartycollegetrainingmartial artisttragic eventmartial arts masterelectronic music scoreforbidden lovekickboxingcameo β€¦roundhouse kickseattle washingtonellipsis in titleimperative in titlecameo appearancenursing homescholarshipkickboxerblack beltpencommitmenthigh school graduationboxing glovesboom boxprotective malehigh school seniorsparringfear of flyingmalibuplay fightbrat packstereooptimistreal life siblings as fictional siblingsvaledictoriantax fraudcompilation music scoredrunken telephone callbackground music score revealed to be source musicsmart kids (See All)

West Side Story (1961)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

West Side Story (1961)

West Side Story is the award-winning adaptation of the classic romantic tragedy, "Romeo and Juliet". The feuding families become two warring New York City gangs- the white Jets led by Riff and the Puerto Rican Sharks, led by Bernardo. Their hatred escalates to a point where neither can coexist with  β€¦any form of understanding. But when Riff's best friend (and former Jet) Tony and Bernardo's younger sister Maria meet at a dance, no one can do anything to stop their love. Maria and Tony begin meeting in secret, planning to run away. Then the Sharks and Jets plan a rumble under the highway - whoever wins gains control of the streets. Maria sends Tony to stop it, hoping it can end the violence. It goes terribly wrong, and before the lovers know what's happened, tragedy strikes and doesn't stop until the climactic and heartbreaking ending. (Read More)

Subgenre:
teen movietragedy
Themes:
dancejealousymurderdeathrevengeracismprejudice
Mood:
tearjerker
Locations:
new york cityurban settingrooftopsluminner cityfire escape
Characters:
boyfriend girlfriend relationshipteenagerpolicesingerbrother sister relationshippolicemandancerinterracial relationshipcatholic
Story:
based on stage musicalstreet gangyoung loverivalblockbusterlifting someone into the airbasketballdancingsingingbased on playsongfistfightface slapbrawlshowdown β€¦manhattan new york citygangstabbingimmigrantno opening creditspassionattempted rapereference to william shakespearegraffitihateloyaltyforbidden loveparking garageinterracial romanceswitchbladeplaygroundgunshot woundsexismlove at first sightfeudknife fighthighwaysocial workersexual assaultjuvenile delinquentethnic slurcellarloss of brotheradolescentgang warunited nationstomboyobsessive lovestar crossed loversfamous scoreoverhead camera shotreference to shakespeare's romeo and julietpuerto ricancardinal direction in titlejuvenile delinquencysecret lovelifting female in airempire state building manhattan new york cityseamstressmodern day adaptationgang warfaretenementdeath in familycandy storepolish americanshakespeare in modern dressnubile womanwedding veil70mm filmbridal shopbridal veilyoung couple in loveovertureconfectionermean streetsbased on stage musical based on stage play (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Varsity Blues (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Varsity Blues (1999)

In small-town Texas, high school football is a religion. The head coach is deified, as long as the team is winning and 17-year-old schoolboys carry the hopes of an entire community onto the gridiron every Friday night. In his 35th year as head coach, Bud Kilmer (Jon Voight) is trying to lead his Wes β€¦t Canaan Coyotes to their 23rd division title. When star quarterback Lance Harbor (Paul Walker) suffers an injury, the Coyotes are forced to regroup under the questionable leadership of John Moxon (James Van Der Beek), a second-string quarterback with a slightly irreverent approach to the game. "Varsity Blues" explores our obsession with sports and how teenage athletes respond to the extraordinary pressures places on them. (Read More)

Subgenre:
teen moviecoming of agefootball movie
Themes:
jealousyfriendshipreligiondrinkingdrunkennessrobberytheftobsessionprejudice
Mood:
high school
Locations:
schoolhospitalbarrestaurantcarsmall townbuspolice cartruckstrip clubtexasschool buscar theft
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfrienddoctorboyteachergirl β€¦police officernursestudentthiefchristiansheriff (See All)
Story:
pep rallycigarette smokingamerican footballcoachcheerleadersexfemale nuditynuditybloodmale nuditybare breastsfemale frontal nuditymale rear nuditybare chested male β€¦kissfemale rear nuditynipplespartyerectionpantiestopless female nuditycryingbeatingdreamunderweardrinkundressingthongbare buttvomitingriflebeertearscafevoyeurclassroomprayerstrippersubjective cameracleavagebratoplesswhite pantiesman with glassespainpublic nudityargumentblack pantiesstrippingspiritualitystripteaselocker roommini skirtbaseball batinjectionhairy chesthigh school studentcrosspigchickenprofanityclasspickup trucktopless womansurgerycircuswoman with glassesfamecowboy hatcrucifixdrug abusebuttocksrebelrebellionpicnicbroken legwhiskeyhit in the crotchconvenience storenipplefootball playerblack bradiscriminationheartsexual humorbarbecuetrophycar drivingsports teamfemale teacherpink pantiesmini dressfencerear nudityvulgarityboy with glassessex educationpopularityhead injuryscholarshipbroken nosehigh school girlwashing machinerevoltbreastwhipped creamfootball coachhigh school seniormascotfemale studentmutinyfake breastscoyotemusclehigh school footballnaked buttadolescent boydrinking gamehigh school athletefootball stadiumwinningadolescent girlpeanut butterhigh school boyquarterbackteenage rebelliongirl in brabelchingknee injurypain killermale bare buttfootball practicesteroidnarrow mindednessbare butt maleblurry visionhail maryathletic scholarshipsyrupmini martice cream sundaehit with a ballobese boysports trainerscar tissuebrown universitychugging beerdriving in the nudefootball refereetouch downcherriesfemale stripteasemale buttocksfootball injurysports broadcasterwhipped cream bikini (See All)

Save The Last Dance (2001) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Save The Last Dance (2001)

Sara wants to be a ballerina, but her dreams are cut short by the sudden death of her mother. She moves in with her father, who she has not seen for a long time. He lives on the other side of town, in a predominantly Black neighborhood. She gets transferred to a new school where she is one of the fe β€¦w White students there. She becomes friends with Chenille, and later, falls in love with Chenille's brother, Derek. (Read More)

Subgenre:
teen movie
Themes:
dancejealousyracismdeath of motherrivalryprejudice
Mood:
high schoolhip hop
Locations:
schoolnew york citynightclubkitchenpolice carchicago illinoisfire escapefight in bar
Characters:
teenagerfather daughter relationshipafrican americanbrother sister relationshipsingle motherinterracial relationshipsecurity guardex boyfriend ex girlfriend relationshipgrandmother grandson relationshipgrandmother granddaughter relationshiplow self esteemformer best friend
Story:
lockeryoung loveteen angstdinerbasketballviolenceflashbackdancingphotographarrestcar crashclassroomprayergay slurracial slur β€¦auditionballetmachismointerracialcatfightoverallsclubinterracial romancemourningmentorghettopassionate kissbruisedead motherintimidationprayingimperative in titlehead woundold dark houseoutsidertrain rideroad accidentdrive by shootingchick flickracial tensionschool lifedance lessonfedoradeath of parentel trainmodern dancegym classjazz musiciantriumphslangdance instructorteenage mothercross cultural relationscultural diversityghetto blasterballet dancingballet shoesforced relocation (See All)

Youth In Revolt (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Youth In Revolt (2009)

At 16, Nick Twisp is wry about his teen funk: he lives in Oakland with his sex-addled mother; his father's child support is her meal ticket. While camping in Ukiah, Nick meets Sheeni: for him, it's love at first sight. Nick has to figure out how to get his father a job in Ukiah, then how to get sent β€¦ to live with his father, then how to get close to Sheeni, whose religious parents may want her sent away from temptation to a boarding school. There's also Sheeni's all-American boyfriend to contend with. Overwhelmed by the challenges, Nick's about to give up when he conjures an alter ego who whispers revolt into his ear. Nick is not altogether hapless, but can this end well? (Read More)

Subgenre:
teen moviecoming of age
Themes:
friendshipinfidelityadulterydeceptionextramarital affairobsessionguiltgriefunfaithfulness
Mood:
high school
Locations:
schoolbeachrestaurantforestwoodspolice carfrancelakesex in shower
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother sister relationshippolice officerstudentpolicemanbest friendbible β€¦older man younger woman relationshipfrencholder woman younger man relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshiptruck driverlove letterreligious fanaticdream girl (See All)
Story:
cigarette smokingslumber partyloss of virginityteen angstwigconvertiblerunningcar accidentsexbased on novelflashbackmasturbationdoggun β€¦kissfightphotographexplosionchaseerectionpantiesshowertelephone callfirevoice over narrationcell phoneunderwearfoodurinationslow motion scenepunched in the facecomputerarrestundressingbikiniletterbookvomitingliesunglassescafemarijuanabathroomneighborjailf wordbraeatingexploding carapologyspankingon the runbinocularsblack pantiesvirginprologuepay phonetentreadingscene during end creditsamerican flagpursuitsplit screencabinpoetteenage sexpoempot smokinglistening to musicsociopathcaught having sexvandalismexploding buildingphone boothswimsuitbreakfastgrocery storeboxer shortsbackpackanimated sequenceblack brafirst kisscard playingboarding schoolalternate realitycliffnotefamily dinnerholding handsthanksgivingmale virginnarrated by charactercar troublerunning awayteenage lovevideo storeadolescencejournalhikinglegssplit personalitymaking outknocking on a door16 year oldstonedbathrobebunk bedwhite trashmushroomdeath of boyfriendmoustachebeltlighting a cigarettealter egodivorced parentspolitical activistbmwmiseryclothing storedonutpolice sirenplagiarismdrug tripman in dragwoman in bikinisleeping bagtamponaspiring writerrunning out of gasreference to frank sinatraanimated opening creditssleeping pillsmobile homeloss of boyfriendlaundry drying on clothes linelooking for a jobjuvenile detentionsuicide contemplationfilm fanschool lockeroakland californiateenage rebellionmagic mushroomdestruction of propertymother's boyfriendpart time jobschool expulsionthanksgiving dinnerberkeley californiapain killergrocerieswashing a cartrailer houseinvented languagetripping and fallingbroken down carsteroidschool cafeteriabeating with a beltpipe organu.s. sailorsedationvandalizing a carexploding trailerfamily portraitreciting poetrychild supportgarden hosepathological liarreference to federico fellinireference to albert camuspastry shopdestroying a cardoughnut shopgasoline cansetting a car on firecar over a cliffmischievous boyreference to jean paul belmondosanta cruz californiavenetian blindsslurpingrunaway carbloggingfalling asleep in classsex manualthree headed monsterlove childlp recordingreference to john dillingerascotdriving in the nudefather's girlfriendreference to robert bressonfinger in someone's anusfictional tv news showcar inside a househand on someone's thighreference to serge gainsbourgwindsurfer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hairspray (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hairspray (2007)

Tracy Turnblad, a teenager with all the right moves, is obsessed with the Corny Collins Show. Every day after school, she and her best friend Penny run home to watch the show and drool over the hot Link Larkin, much to Tracy's mother Edna's dismay. After one of the stars of the show leaves, Corny Co β€¦llins holds auditions to see who will be the next person on the Corny Collins show. With all of the help of her friend Seaweed, Tracy makes it on the show, angering the evil dance queen Amber Von Tussle and her mother Velma. Tracy then decides that it's not fair that the black kids can only dance on the Corny Collins Show once a month, and with the help of Seaweed, Link, Penny, Motormouth Maybelle, her father and Edna, she's going to integrate the show.....without denting her 'do! (Read More)

Themes:
dancefriendshipdrinkingracismdysfunctional familycheating
Mood:
high schoolbehind the scenes
Locations:
schoolbarbuspolice carschool bus
Characters:
female protagonistteenage boyteenage girlteenagerhusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendsingerbrother sister relationshipteacherpolice officer β€¦nursestudentpolicemandancerbest friendreligious fundamentalist (See All)
Period:
1960syear 1962
Story:
dance contestbased on stage musicalcigarette smokingnostalgiarunningone word titlef ratedkissdancingphotographtitle spoken by charactersingingpartytelephone callcrying β€¦songfoodremakewatching tvdrinktearsclassroomtelevisionnewspaperflashlighteatingfalse accusationno opening creditsnews reportmicrophoneprotestauditionscene during end creditsrattied upclassfireworksnewspaper headlineblack americanrecord playerapplauseropetv newsrace relationsfaintingdemonstrationcommunistagentflatulencetv showfemale tied upgas maskcivil rightsinterracial romanceswitchbladeobesitybackstagelove at first sightdressing roomalarm clockmusic bandunderdoghaircrownbeauty pageantbillboardblackboardteenage daughtertv studiobeauty salonteenage crushgarbage truckracial tensionironingbaltimore marylanddetentionmarchfat womanrecord storeprotestortitle appears in songmusic storephonograph recordracial segregationtv cameraclothes linefat suitsocial changemarchingtiarabomb shelterdoughnutfat girlinstructorpageanttheatrical agentcandy barprotest signwashing clothesblonde stereotypeflasherreference to j. edgar hooverboys' bathroommemorabiliaoverprotective parentwoman played by mandress shopreference to doris dayhiding in a car trunkplacardtv show hostgirls' bathroomhair sprayshoeshinenewspaper boyironing boardtv cameramancivil rights eratony award sourcechemistry classracial integrationreference to jackie kennedyfitting roomturkey bastergirl tied upfadlaundressblack white friendshipgorilla maskreference to gina lollobrigidawhoopee cushionphysical education classnovelty shopp.e. classshoeshine man (See All)

The Spectacular Now (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Spectacular Now (2013)

Sutter Keely lives in the now. It's a good place for him. A high school senior, charming and self-possessed, he's the life of the party, loves his job at a men's clothing store, and has no plans for the future. A budding alcoholic, he's never far from his supersized, whiskey-fortified thirst-master  β€¦cup. But after being dumped by his girlfriend, Sutter gets drunk and wakes up on a lawn with Aimee Finecky hovering over him. She's different: the "nice girl" who reads science fiction and doesn't have a boyfriend. While Aimee has dreams of a future, Sutter lives in the impressive delusion of a spectacular now, yet somehow, they're drawn together. (Read More)

Subgenre:
coming of age
Themes:
dancejealousyfriendshipmarriagemoneydrinkingdrunkennessmemorydivorcedeath of fatherdatingbreak upalcoholismfalling in lovesuicide of father
Mood:
high school
Locations:
baseballschoolhospitalbarswimming poolbus driverwater gun
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipafrican americanfriendbrother sister relationshipteacherdancerbest friend β€¦reference to godsingle motherteacher student relationshipex boyfriend ex girlfriend relationship (See All)
Story:
cigarette smokingunderage drinkingloss of virginitycar accidentsexfemale nuditybased on novelflashbackbare chested malekissdancingpartyshowertelephone callvoice over narration β€¦cryingcell phoneslow motion scenecomputerdrinksecretliebeertearssunglassesreference to jesus christclassroomalcoholtelephonef wordbramontageapologyhit by a carbartenderflash forwardprologuefired from the jobstorytellingreadingwaterfallclasssleepingtrustteenage sexblack americanpickup truckhuggingcomic bookhappinesscheating husbandcrying manpromisewhiskeybackpackconvenience storefirst kissabsent fatherpridebookstorephiladelphia pennsylvaniareckless drivingwoman in underweartext messaginghandshakeloss of jobdead fatherjukeboxhangover17 year oldflask18 year oldknocking on a doorwoman in bra and pantiesunhappinessgiving a toastpromsecond chancecollege campusbouncerfather son reunionwhite brabeggingmiserystudyinghomeworkhigh school graduationtelephone numberpassing outhigh school seniorstore clerkgeneration ykiss on the foreheadfootball fieldporchabandoned by fatherdumped by girlfriendhigh school prompart time jobpain killeri.d.big sisterfirst sexreference to nasateenage drinkingjumping into a swimming poolbreakfast cerealgeometryschool cafeteriayellow dresstutoringbaseball pitcherarm in a slingcollege applicationreference to californiareference to texasfear of failuredrinking on the jobhip flaskmen's clothing storedelivering newspaperreference to mexicoprom datewaiting for someonerefusing a handshakedrunken drivinglooking into a window (See All)

Better Off Dead... (1985) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Better Off Dead... (1985)

The teenager Lane Meyer has a crush on his girlfriend Beth Truss. When Beth dumps him to stay with the successful skier Roy Stalin, Lane is depressed and decides to commit suicide. However he gives up and tries to improve his skill of skier to ski the dangerous K12 slope to impress Beth. Meanwhile h β€¦is neighbor Mrs. Smith receives the exchange French student Monique Junot and her fat son Ricky Smith considers Monique his girlfriend; however, Monique has an unrequited crush on Lane that does not note her. When Lane stumbles upon Monique in a high-school party, he befriends her. The upset Lane challenges Roy in a competition on the K12 slope but then he regrets. However Monique is a great mechanic and skier, and fix Lane's Camaro and teaches him how to ski the K12 slope. What will happen to Lane? (Read More)

Subgenre:
teen moviecult filmindependent filmblack comedyslapstickteen comedyclay animation
Themes:
surrealismchristmasdepression
Mood:
high schoolspoofparody
Locations:
schoolsnow
Characters:
boyfriend girlfriend relationshipteenagerteacher
Period:
1980s
Story:
exchange studentdrag racingteen angstcatbikinifalling from heightsuicide attemptautomobilemachismonerdwoman with glassespart animationblack humorgirl with glassesabsurd humor β€¦skiingduckharassmentellipsis in titlecartoon on tvboy with glassessaxophonespace shuttlehamburgerrunning gagstation wagondrug humortongue in cheekfrisbeedental bracesgoofballdumped by girlfriendpaperboygag humordental headgearchevrolet camaronewspaper boyoffbeatgarage doorcat foodmotor car washsteel plate in headvoice impersonatorvoice sampling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

She's The Man (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

She's The Man (2006)

Here's the thing! Viola's soccer team at Cornwall gets cut. She wants to join the boys team, but they do not allow girls. So she thinks "If you can't join them, beat them". So she does! She disguises herself as her twin brother Sebastian, and goes out for the rival school, Illyria, boys' soccer team β€¦ and makes it. Unfortunately, she didn't plan falling in love with her roommate Duke. But Duke has his eyes on Olivia. What makes matters worse is that Olivia starts to fall for Sebastian because he/she has a sensitive side. If things couldn't get more problematic, the real Sebastian (who was in London working on his music) comes home early. He arrives on campus and has no clue that he was replaced by his twin sister. (Read More)

Subgenre:
teen romanceteen movieteen comedy
Themes:
friendshipdeceptionobsessiondatingbreak upfalling in love
Mood:
high school
Locations:
schoollondon england
Characters:
female protagonistteenage boyteenage girlteenagerfamily relationshipsfather daughter relationshipmother daughter relationshipbrother sister relationshiplove triangleex boyfriend ex girlfriend relationship
Story:
rivalcarnivalcoachwigkissfightshowerbased on playcell phoneface slappunched in the facesecretsoccerdisguiseman with glasses β€¦dream sequenceroommatelocker roommini skirttwinreference to william shakespearecross dressingstrong female characterflirtingclaim in titleshavingathletecatfightspiderimpersonationcrushstrong female leadforbidden lovebald mangirl with glassesbreakupsexismboarding schoolinsultdressing roomlooking at self in mirrorgeekwilhelm screamgenderinsecurityshortssports teamschemeassumed identitylong hairmini dressponytailtomboymaking outdisappointmentshort skirtcampusdivorced parentsbutt slapinvitationfemale athleteheadmastergender disguiseandrogynydental bracespassing outtamponbritish accentgender benderminiskirtwoman dressed as manbreast flashingcrossdresservoice mailaspiring musicianmodern day adaptationhair stylisteye candylifting weightsdebutanteflashing breastsskipping schoolpizza parlorsoccer gamesecret revealedlyricsbad datesideburnsdental headgeargirl dressed as boyexposing one's breastsfitting inchanging clothesgirl disguised as boyshakespeare in modern dressbehavior modificationbinding breastsgirls' soccerwoman dressed as a manwoman flashingringtonefemale flashing breastsshakespeare's twelfth nightwoman flashing breastsshakespeare adaptationgirl on boys teamtransfer studenttryoutsvindicationwoman in man's clothesdebutante ballmotion sicknesskissing boothfrog dissectionwater poured over someone's headandrogynous femalehigh school shakespeare adaptationvarsity (See All)

Can't Buy Me Love (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Can't Buy Me Love (1987)

Ronald Miller is tired of being a nerd, and makes a deal with one of the most popular girls in school to help him break into the "cool" clique. He offers her a thousand dollars to pretend to be his girlfriend for a month. It succeeds, but he soon learns that the price of popularity may be higher tha β€¦n he expected. (Read More)

Subgenre:
teen romanceteen moviecoming of age
Themes:
dancefriendshipmoneyredemptionunrequited lovebreak up
Mood:
high school
Locations:
schoolmotorcycleairplane
Characters:
boyfriend girlfriend relationshipteenagerfamily relationshipspolicebest friendex boyfriend ex girlfriend relationshipdream girl
Period:
1980s
Story:
opposites attractteen angstcheerleaderkisspantiespunctuation in titlebeerbedapostrophe in titlebathroomneighborhalloweenbedroomcultmission β€¦class differencesnerdtraditiontitle based on songpoolnew year's evescamremote controltelescopereconciliationbootsshopping malltvfrustrationcrowdvodkareflectionhappy endingtruthcafeteriaboy with glassescowboy bootspopularityobsessive lovehouse partystation wagonferraridetentionschool lifepoker gamesocial climberlawn mowernew year's eve partycheerleadinghigh school footballhigh school danceostracismthe beatles songhalloween pranknylon stockingsremadefoolpersonality changetucson arizonahappy new yearhunkcable tvfavorpygmalionsocial isolationparty goerhanging outegging a housedog barksenior yearboogieautomatic pilot (See All)

Submarine (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Submarine (2010)

Precocious Oliver struggles with being popular in school but when a dark-haired beauty takes interest in him, he's determined to become the best boyfriend in the world. Meanwhile, his parents' already rocky relationship is threatened when his mother's ex-boyfriend moves in next door. Oliver makes so β€¦me unorthodox plans to ensure that his parents stay together and that Jordana still likes him. (Read More)

Subgenre:
teen moviecoming of ageteen comedydeadpan comedy
Themes:
friendshipinfidelitychristmasadulterybullying
Locations:
schoolbeachtrain
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfrienddance teacher
Period:
winter
Story:
young loveloss of virginityteen angstone word titlekissneighborbedroomfireworkscheating wifevirginityfirst kissschool uniformclassmateriding a bicycletaking a photograph β€¦film projectorteasing15 year oldquarrelwalesawkward situationsuper 8polaroid cameragreat britainloveless marriagesuper 8mmsnoopingchristmas dinnerintrovertwelshanti depressantoverprotective motherpolaroid photographpyromaniacspying on someoneunexpected kissworried motherawkward kiss (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

American Beauty (1999) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Beauty (1999)

After his death sometime in his forty-third year, suburbanite Lester Burnham tells of the last few weeks of his life, during which he had no idea of his imminent passing. He is a husband to real estate agent Carolyn Burnham and father to high school student Janie Burnham. Although Lester and Carolyn β€¦ once loved each other, they now merely tolerate each other. Typical wallflower Janie too hates both her parents, the three who suffer individually in silence in their home life. Janie tries to steer clear of both her parents. Carolyn, relatively new to the real estate business, wants to create the persona of success to further her career, she aspiring to the professional life of Buddy Kane, the king of the real estate business in their neighborhood. Lester merely walks mindlessly through life, including at his job in advertising. His company is downsizing, and he, like all the other employees, has to justify his position to the newly hired efficiency expert to keep his job. Things change for Lester when he falls in love at first sight with Janie's more experienced classmate, Angela Hays. Both Janie and Angela can see Lester's sexual infatuation with Angela, who courts such attention from any man as a sign that she is model material, she having once appeared in Seventeen and it a career to which she aspires. Lester's infatuation with Angela gives him a reenergized view on life, where he openly doesn't care anymore what anyone thinks about what he does, anyone except Angela. This in… (Read More)

Subgenre:
teen romancecoming of agecult filmblack comedydark comedydeadpan comedytragicomedy
Themes:
dancefriendshipmurderdeathinfidelitydrugsadulteryseductionextramarital affairangerobsessionparanoiadepressionblackmaildrug use β€¦dysfunctional familyunfaithfulnesshomophobiafalling in lovecheating (See All)
Mood:
high schoolgoresatirerainsocial satiremoving
Locations:
schoolswimming poolcarsmall townbathtubmotelsinging in a carsex in a motel
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipwriterbest friendreference to godgay kiss β€¦lusthomosexualityolder man younger woman relationshipself discoverymilitary officerself destructivenessamerican dreamself hatredgirl nudityfather and daughteronly daughter (See All)
Period:
1990s
Story:
cigarette smokingunderage smokingblockbusterteen angstpremarital sexcheerleaderfantasy sequencebasketballblondefemale nudityf ratednuditybloodmale nudityviolence β€¦bare breastsfemale frontal nudityflashbackmasturbationmale rear nuditytwo word titlebare chested malegunsex scenekissfingeringnipplessurprise endingpantiesshowertopless female nudityvoice over narrationfondlingbeatingshot to deathblood splatterface slapshot in the headslow motion scenecomputercamerasex in bedbare buttbeerbedmarijuanabathroomneighborvoyeurtelevisionf wordcleavagegay slurbedroombratoplessvideo cameradrug dealerwomandinnermodelno opening creditsdream sequenceanti heroscantily clad femalelatex glovesgunshotargumentstrippingvirginbusinessmanscreamingsuburbmini skirtmoaningdomestic violencefemale removes her clothestragic eventschoolgirlsemiautomatic pistoldirectorial debuthandgunobscene finger gesturegay couplecheating wifegaragehatesexual fantasyflirtingcloseted homosexualeavesdroppingpot smokingcountry name in titleheavy rainjoggingtold in flashbackexercisemagazinebuttocksvideotapedysfunctional marriagecrushvirginitycoloneldrug dealingwatching televisionsexual desirebuddhistbarefoottensionmale masturbationcouchcynicismmisunderstandingunfaithful wifejob interviewnipplereference to satanadvertisingroseperversiondeceitrainstormabusive fatherfamily dinnerexistentialismloss of husbandalienationmarital problemmidlife crisissports carneighborhoodlingerie slipexhibitionismlyingirreverencemain character diesage differencewoman in bathtubadulterous wifereal estate agentworkoutunhappy marriagetablegardeningtruthcannabisinsecuritypedophiliaparenthoodblue pantiessarcasmmotel roomrepressionloserweightliftingloud sexschoolboydenialquitting a jobexhibitionistinfatuationtyranttopless girlmale protagonistsofacamcordervideo footagesexual repressionmurder by gunshotnatural breastsrealtorreference to james bondin medias resdrug humorpool of bloodshooting rangemovie camerawet clothesunwanted kissfast food restaurantabsent motherlolitaolder man younger womanmaterialismcheerleader uniformcrime of passiondomineering fatherloveless marriageex marinesoul matewoman moaning from pleasurewoman moaningmoaning womanolder man young girl relationshipu.s. marinerainy nightcheerleadingplastic bagsecret lifehomophobeneurosisbasketball gamegirl toplessnarration from the gravecocktail partybeer bottlevhs tapespit takeillegal drugcubicleestranged couplemuscle cartalking during sexmale in a showerfiring rangemistrustrepressed homosexualinnuendomasturbating in a showerdirty old manbalaclavacovered female frontal nudityemotional breakdownlava lampteen smokingyounger woman older man relationshipfemales talking about sexblood on walldrive thrurepeated scene from a different perspectiveasparagusmemorabilianight drivingolder man younger girlmistaken for gayspying on someonevisual hallucinationbarely legalwoman undressing for a manplaying musicyounger girl older manreference to pink floydremote controlled toy carthe color redbroken dishdrug testingfamily problemsmother slaps daughterunexpected kissurine samplehouse cleaningvideotapingweight trainingman undressing a womanolder man teenage girl relationshipjoblessnessflower petallocking a doorvirgin girlcamera zooming inchange of minddissatisfactionfacadehomophobic violencehomosexual couplewoman taking off pantsrandomnessbench presslow paid jobrose petalwhirlwindman on topseverance payapplying for a jobdv cameraefficiency expertspying on neighbortalking dirty during sexnazi paraphernalianew automobileurine testvideo collectionman hugging a manvaporcushionnon communicationnymphetthreat of employment dismissalviolence against a teen (See All)

Footloose (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Footloose (1984)

Classic tale of teenage rebellion and repression features a delightful combination of dance choreography and realistic and touching performances. When teenager Ren McCormack and his family move from big-city Chicago to a small Midwestern town, he's in for a real case of culture shock. Though he trie β€¦s hard to fit in, the streetwise Ren can't quite believe he's living in a place where rock music and dancing are illegal. However, there is one small pleasure: Ariel Moore, a troubled but lovely blonde with a jealous boyfriend. And a Bible-thumping minister, who is responsible for keeping the town dance-free. Ren and his classmates want to do away with this ordinance, especially since the senior prom is around the corner, but only Ren has the courage to initiate a battle to abolish the outmoded ban and revitalize the spirit of the repressed townspeople. Fast-paced drama is filled with such now-famous hit songs as the title track and "Let's Hear It for the Boy". (Read More)

Subgenre:
teen moviecult film
Themes:
dancenear death experiencereligious intolerancereligious fundamentalism
Mood:
high school
Locations:
churchmotorcyclesmall townrural settingcity
Characters:
teenage boyteenage girlteenagerfather daughter relationshipdancerpriestbiblecousin cousin relationshipreligious fanaticreligious zealotreligious fundamentalistreligious leader
Story:
famous songblockbusterteen angstrock musicblondemale nuditymale rear nuditybare chested malekissdancingshowerbeatingfistfightface slapundressing β€¦bare buttbookgay slurlocker roompassionhairy chestobscene finger gesturetrusttitle based on songculture clashcompassioncensorshipministerblood on faceconfrontationpastormale in showercartoon on tvtractorrepressioncowboy bootssweatpromutahslappingsexual repressionabusive boyfriendman hits a womandance lessondomineering fathershower roompunchingundershirtgroup showercousinman hits womanhigh school dancewoman hits a manhitting a womanoverprotective fatherbook burningman dancing with manteenage rebellionfather daughter conflictevangelical christianityorthodoxdancing in the streetoverprotective parentdance partymuscle shirtfather slaps daughterpublic moralityreal life sisters playing sisterschange of mindburning a bookman dancing with a manmen dancing togetherbrick thrown through a windowslapping a womanspontaneous choreographythrowing a stonechurch state enmeshment (See All)

I Love You, Beth Cooper (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Love You, Beth Cooper (2009)

When Dennis Cooverman gives the commencement speech at his graduation, his friend tells him to let it all out. So he proclaims his love for Beth Cooper the head cheerleader, and says things about everyone in the graduating class as well as some other people. Later Beth confronts him and he invites h β€¦er to a graduation party at his house. And to his surprise she and two of her friends show up. But also some of the people he offended with his speech, who want to tear him apart. And one of them is Beth's boyfriend whom she just broke up with. So they all get in Beth's car and drive away. And what follows is a wild adventure. (Read More)

Subgenre:
teen movie
Themes:
escapemilitary
Mood:
high school
Characters:
boyfriend girlfriend relationshipteenagerbully
Period:
summer
Story:
graduationunderage drinkingcheerleadercondomcar accidentcharacter name in titlebased on novelthreesomeflashbackkissfighttitle spoken by characterpartyerectionpanties β€¦showerpunctuation in titleunderwearpunched in the facewhite pantiesscantily clad femalehit by a carfive word titlecoming outchampagnekicked in the facespeechcownerdclaim in titlenosebleedembarrassmentconvenience storecomma in titleinsultgeekreckless drivinghit in the faceadviceteenage sexualitypopularitysunrisehouse partyraccoonhigh school graduationimplied nudityfalling off a rooftamponhot pantsdead brothergym teacherfake idblonde stereotypefilm buffhigh school friendsteen lovesocial lifepopular girlponchosuspected homosexualawkward silenceconfession of lovegirls locker roomhigh school crushmaking out in a carvaledictoriancellular phone tracedrivers edbad driverhit in the eyepossessive boyfriend (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Big (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Big (1988)

Josh Baskin would do anything to be big to hang out with his crush at the carnival. He finds a Zoltar machine, and he wishes to be big. After Zoltar tells him, "his wish is granted", Josh notices the machine is unplugged. He wakes up the next morning in an adult's body but he still has the same pers β€¦onality. With the help of his best friend, Billy, Josh learns how to act like a grown up. But as he gets a girlfriend and a fun job, he doesn't want to be a kid again. Will Josh stay big or become a 13 year old boy again? (Read More)

Subgenre:
coming of agefish out of water
Themes:
friendshipseductionhope
Mood:
affection
Locations:
new york cityhotelbicycleofficeoffice party
Characters:
teenage boyboyfriend girlfriend relationshippolicemother son relationshipfriendbest friendbullyemployer employee relationshipchildhood friend
Period:
1980s
Story:
carnivalblockbusterlifting someone into the airloss of virginityringbasketballone word titlesexf ratedbare chested malekisstitle spoken by charactertitle directed by femaleunderwearmirror β€¦neighborpianomanhattan new york citychildbirthday partygunshotlimousinehairy chestgamewalkie talkietoyhomebossmale underwearchild's point of viewco workerthirty somethingclassmatecareerfemale directorwishjobage differencepiano playeradolescencebaseball gamebunk bedrole reversaltrampolinebronx new york citymarketingbody swapduettap dancingjob promotionfunfairwish fulfillmentpinball machinetoy storeloftbody switchingshaving creamtap dancewhat ifracquetballbody transformationtoy makerswitching bodieschild as adulthomesickpiano duetyankee stadium bronx new york citybirthday songunplugged electronic workscheap hotelquarterdo oversilly stringchild as an adultface on a milk carton (See All)

Just Friends (2005) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Just Friends (2005)

Chris Brander has always been friends with Jamie Palamino, but now decides it is time to take his relationship to the next step. The problem is that Jamie still wants to be 'Just Friends'. When he runs away and moves to L.A., he becomes an attractive music manager, whom everyone wants. When his jet  β€¦catches fire and is forced to land, when flying to Paris with his newest singing sensation, Samantha James, he ends up back home. To his surprise, he encounters Jamie again, and sets out to be more than 'Just Friends' this time. (Read More)

Subgenre:
teen romanceteen movieteen comedy
Themes:
first lovefriendshiplovechristmascelebrityfalling in love
Mood:
high school
Locations:
los angeles californiaschoolchurchsnowsmall townairplane
Characters:
teenage boyfriendbrother brother relationshipmusicianbest friendgay kissold friendbest friends
Period:
1990s2000schristmas partyyear 1995
Story:
graduationcheerleaderblondeflashbackmasturbationkissfightsinginglesbian kisspantiescell phoneface slapfalling from heightcafeguitar β€¦cleavageambulancejokewhite pantiesscantily clad femalepantyhosebartenderlatex gloveschampagnechristmas treedategirl in pantiesholidaynerdinjurysanta claushollywood californiamovie theatercrushwomanizerpop starstupiditymovie theatredentistnew jerseyrejectionshopping mallchristmas eveice skatingice hockeyarrogancefemale female kisstasermedical masksurgical masksuccessmini dressdental maskchangemale protagonistlip synchingchristmas lightsweight losshometownpancakemultiple time framesfrozen lakemale female friendshipmicrowavefat suitsongwritinggirl next doorrental carblonde stereotypeyounger brothertoothpastepin upteeth knocked outdental retainerchristmas cardhigh school crushmusic executivechristmas carollingfriend zonereference to the notebookface to faceten years (See All)

A Goofy Movie (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Goofy Movie (1995)

It's the last day of school, and Max wants to catch the eye of Roxanne, one of the more attractive girls in school. But how can you be cool when your dad's Goofy? Stage an impromptu concert at the final assembly, that's how! Or at least it sounded good until Principal Mazer found out. Goofy finds ou β€¦t about his son's antics (sort of), and decides a fishing trip, like his dad took him on, is the solution. Of course, he doesn't know that Max finally lands a date with Roxanne for a party thrown by the class valedictorian. Through the movie, Goofy tries to bring Max out of his shell, while Max resents being taken away, and lying to Roxanne about the trip (he tells her he & his dad will be appearing on TV at the PowerLine concert in LA). Will Max sink or swim? Will Goofy goof up his son's first shot at romance? Will Bigfoot step back? And what about those nuns? (Read More)

Subgenre:
coming of agedisney
Themes:
lovetravelangerdepressionhumiliationforgivenessnear death experience
Mood:
high schoolnightmare
Locations:
los angeles californiaschoolcarbuswaterwoodsroad tripmotelsinging in a carschool buscanyonsinging on a busschool bus driversinging on bus
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipteenagerfather son relationshipsingerphotographerwaitresssingle fatherbaby girlsinging girl
Period:
summer1990s
Story:
last day of schoolbleachersteen angstdinerrock musiccharacter name in titledogkisssingingthree word titleunderwearrescuewatching tvfalling from heightlie β€¦bedtelevisiontelephoneconcertname in titlecaliforniamapfishexploding cardrivingnundream sequencefishingargumentbased on tv serieson the roadvacationdatefirst partwaterfallflowersingle parenteavesdroppinghugginghatcampcrushdriving a cartowelanthropomorphismpromisereconciliationanthropomorphic animaltvamusement parkhot tubbowlingwilhelm screamsurprise after end creditsyellingohioteenage loveparenthoodfenceselfishnessroller coastervacuum cleanerbigfoothugprincipalgeneration gapsouptravelingmovie in titlesummer vacationstation wagonteenage crushroadkiss on the cheekcampergrand canyonbad dreammusic concertsing alongbuddy moviestudio logo segues into filmblue jeanshigh school principalidahocompanionreference to walt disneybowling ballolder actors younger roleswaterbedauditoriumvacuumfriendship between teenspuppy lovefather son hugteenage sonmopfishing rodlife jacketoverweight mangoofy the characterpower line8 trackfishing polegroup of teenagerskeychaindangerous drivingcompanionshipteen bedroombath towelrebellious sonnightmare sequencewhite liesinging duetrvsinging animalmarkersinging groupvacuum cleaningfast talkerpancakesfather son bondingvacuumingblue shirtfather sonreference to disneycrush on girloverweight teenagerangry teenbowling pinflower in hairgoofy hollerwaking up from a nightmaresinging duobackwards hatpossumcatholic nunfront porchsinging dogyellcardboard cutoutdamaged carfamily bondfather son teamglove boxteenage lifebeing coolfather son talkgroup singingtowel on headfamily bondinglie to parentsprincipleresturantsent to principal's officesleeper hitwearing underwear on headcar rolling down hillgreen shirtkicking a carsinging womanteen in perilvacation gone wrong (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Brooklyn (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brooklyn (2015)

In late 1951, Eilis Lacey, a young Irish girl, emigrates to Brooklyn. Sponsored by Father Flood, a priest from her native town Enniscorthy, she is assured to find a full-time job there. But the early days are tough, seasickness being soon replaced by loneliness and homesickness, two feelings all the β€¦ more acutely felt by Eilis for having had to leave behind her widowed mother and her dear sister Rose. She nevertheless little by little manages to find her footing by adapting to her job as a salesgirl, by studying bookkeeping at Brooklyn College as well as with a little help from both Father Flood and Mrs. Kehoe, the owner of the boarding school she now lives in. And not only does graduation follow but love shows its face in Tony, an Italian-American plumber, full of adoration and respect for her. They end up marrying, although keeping the thing secret. It is at that point that tragedy strikes inciting Eilis to return to Enniscorthy to support her mother morally. And there a strange thing happens : she gradually gets lured by the charms of her native place, going far as to let herself be wooed by Jim Farrell, a young local. (Read More)

Subgenre:
melodramafamily tragedy
Themes:
dancejealousyfriendshipdeathmarriagechristmasmoneydrinkingweddingtraveldatingillnessfalling in loveprejudicedeath of daughter
Locations:
baseballschoolbeachnew york citybarrestauranttrainsnowcemeterytaxiapartmentshipusacatholic church
Characters:
female protagonistboyfriend girlfriend relationshiphusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendsingerbrother brother relationshipteacherstudentdancerpriestsister sister relationshiplove triangle β€¦best friendreference to godcatholicemployer employee relationshipself deception (See All)
Period:
summer1950swinter
Story:
wolf whistlecigarette smokinggraduationgossiploss of virginitypremarital sexone word titlebased on novelbare chested malesex scenekissdancingphotographtitle spoken by charactersinging β€¦telephone callcryingsongfoodmirrordrinkundressingsex in bedlettervomitingtearssunglassesbedbathroomreference to jesus christclassroomprayerrivermanhattan new york citytelephonef wordsubjective cameraswimmingbandold manambulancewomaneatingimmigrantapologyjourneyvoice overgraveyardmarriage proposalimmigrationgraveprologuesuitcasechristmas treeflowersamerican flagtragic eventcrosssadnessirelandclasseuropefreeze frametwenty somethingeyeglassesitalianapplausewaitergolftealooking at oneself in a mirrorlistening to musicworking classwatching a moviecrying womanswimsuitirishbrooklyn new york citycommunitypromisegrocery storeitalian americandeath of sistervoice over lettersnowingfamily dinnertrophydivorceebenchpipe smokinglocation in titleengagement ringaccountantwedding ceremonyshynessheartbreakirish americanmake upemigrationdead fathergolf clubname callingadvicedepartment storeteasinggiving a toastwhistlingbunk bedplumberrugbyloss of sisterwoman in lingeriemarriage engagementclothingreading a newspapergravestonesleeplessnessanguishreturning homenew york skylinespaghettibride and groomemigrantdiarrheachurch serviceboarding housefemale in swimsuitfemale sitting on a toiletreading a lettertrolleymirror balllong island new yorkdead husbandchristmas dinnerhomesicknessblowing a kissconey island brooklyn new york citynylonslittle brothercotton candyseasicknessbigger dreamssecret marriagewaving goodbyeyear 19528 year oldcrossing oneselflandlord tenant relationshippacking a suitcaseirish accentreference to gary cooperirish musiclamp postdear john letternativity scenesalesclerkbookkeeperreference to the new york yankeesirish immigrantpneumatic tubebrooklyn dodgersfemale flatulencefour brotherscivil weddingdual livescork irelandellis islandbookkeepingtorn between two menwedding vowsreference to the zombie apocalypse (See All)

Charlie Bartlett (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Charlie Bartlett (2007)

Although cheerful, friendly, intelligent, well-dressed, authentic and wealthy, Charlie Bartlett has problems. With his father gone and his mother loopy and clueless, he's been expelled from every private school for his victimless crimes. Now he's in a public school getting punched out daily by the s β€¦chool thug. He ever longs to be popular - the go-to guy - and the true crux of his troubles is that he invariably finds the means to this end, whatever that might be. At Western Summit High, he makes peace with his tormentor by going into business with him - listening to kids' problems and selling them prescription drugs. Charlie's a hit, but attraction to Susan (daughter of the school's laissez-faire principal), new security cameras on campus, a student's overdose, and Charlie's open world view all converge to get him in serious trouble. Can this self-made physician possibly heal himself and just be a kid? (Read More)

Subgenre:
teen moviecoming of age
Themes:
friendshipinfidelitydrugsmoneyadulteryprisondrinkingdrunkennessextramarital affairdivorcedepressiondrug usedysfunctional familyunfaithfulnessdating β€¦humiliationbullyingabductionalcoholismwealth (See All)
Mood:
high school
Locations:
schoolbarrestaurantswimming poolsmall townpolice carschool bussex in a carschool bus driver
Characters:
teenage boyteenage girlboyfriend girlfriend relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendsingerteacherstudentpolicemandancerwriter β€¦bullysingle motheralcoholicpsychiatristtalking to oneself in a mirrorstudent protest (See All)
Story:
cigarette smokingamerican footballloss of virginityteen angstcheerleaderfantasy sequencebasketballsexfemale nuditycharacter name in titlebloodbare chested malegunkissdancing β€¦title spoken by charactersingingpartypistoltelephone callcryingcell phonesongbeatingunderwearmirrorpunched in the facecomputerdrinkarrestundressingbooktearssunglassescafemarijuanapianojailclassroomrevolverguitartelephonewinebandconcertmansiondrug dealermontagesuicide attempttoiletrock bandinternetman with glassesanti herounderwater scenelimousinemicrophonevirgincoming outprotestfired from the jobauditionbodyguardsplit screendateloss of fatherhandgunclassclass differencesteenage sexgarageriotice creamjail cellvandalismdemonstrationassaulttherapistfraudtennisskateboardcompassiondrug overdoserampageremote controlpillssurveillance cameraresearchbackstagepool tablefootball playermedicationfirst kissschool uniformdaydreamblack eyelonerclassmatebriefcasebrushing teethpajamaschauffeurpiano playervideo tapeteenage loveoverdoseconfessionalplaywrightpeer pressurebare chested boymegaphonepopularitylollipoppsychiatryprivate schoolfootball teamsexual repressionwatching a videorescue from drowningteen suicideloudspeakersuicidal thoughtsvillain turns gooddriver's licensefrench accentbritish accenthigh school principalsocial outcastpetitionfake idsedativepenitentiarytoilet stallfalling into a swimming poolanti depressantdestruction of propertystreakingtoilet bowlgiving the fingerschool expulsionmentally challenged personprescription drugsfake doctortax evasionboys' bathroomsexual confusionprozacchauffeured limousineattention deficit disorderhead in toiletkid outsmarts adultrailroad tracksritalintoy boatgarage doorxanaxdrive in movie theatrepsychiatric institutionbackseatmodel boatzoloftschool blazerdestructivenessfight in men's roomnicotine gumpassing notehigh school playrave the partysocial acceptanceschool superintendentchuck taylor gym shoesfake psychiatristmisdiagnosis (See All)

Across The Universe (2007) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Across The Universe (2007)

Across The Universe is a fictional love story set in the 1960s amid the turbulent years of anti-war protest, the struggle for free speech and civil rights, mind exploration and rock and roll. At once gritty, whimsical and highly theatrical, the story moves from high schools and universities in Massa β€¦chusetts, Princeton and Ohio to the Lower East Side of Manhattan, the Detroit riots, Vietnam and the dockyards of Liverpool. A combination of live action and animation, the film is paired with many songs by 'The Beatles' (qv) that defined the time. (Read More)

Subgenre:
documentary footagerock musical
Themes:
dancejealousyfriendshipmurderdeathsurrealismmarriagedrugspoliticspregnancydrunkennessescapefuneralartmilitary β€¦depressiondrug useabuseunrequited lovetheatrepanicfreedomfalling in loverevolutionpolice brutalitynear death experiencecheating death (See All)
Mood:
high schoolrainbreaking the fourth wall
Locations:
beachhospitalnew york citybarchurchhelicoptersnowcemeterybusnightclubtaxiwheelchairshiptruckrooftop β€¦taxi driverschool busbus stationfire escapecorpse in water (See All)
Characters:
boyfriend girlfriend relationshiphusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendsingerbrother sister relationshipprostituteteachersoldierpolice officer β€¦nursealienstudentpolicemandancerpriestlawyersister sister relationshipartistsingle motherwaitressinterracial relationshipprofessoruncle nephew relationshippimppolice arrestdeath of boy (See All)
Period:
1960swinter
Story:
bleacherscigarette smokinglockeramerican footballpremarital sexcheerleaderfantasy sequencebasketballrunningblondefemale nudityf ratedbloodmale nudityfemale frontal nudity β€¦male rear nuditybare chested malegunkissfemale rear nudityfightdancingphotographtitle spoken by characterexplosionsingingpartychasethree word titletelephone callfirecryingsongtitle directed by femalebeatingcorpsemachine gunurinationslow motion scenepunched in the facewatching tvbattlearrestundressinglettershootingriflebombmarijuanajailbritishclassroomguitarmanhattan new york cityalcoholtelevisionswimmingnewspaperbandconcertcaliforniamontagearmyimmigrantrock bandsubwayno opening creditsassassinationdrawingunderwater sceneroommatejourneypantyhosenews reportlooking at the cameraimmigrationmicrophoneprotesttentcollege studentuniversitydomestic violencegymamerican flaginjectioncrossdeath of sonrock 'n' rollsadnessclassgraffitipubnewspaper headlineheroinrunawayriotcircusfemale stockinged legssyringeflyinghypodermic needleperformancetitle based on songjail cellguitaristdemonstrationbeardhammerbuttocksvietnam warphone boothcomposertorchburialhitchhikerstreet lifehitchhikingapplehookerjanitorimaginationbloody noseveteranbreakupu.s. armyfanmourninghippieanimated sequencepool tableshot in the facebroken glassnewsreel footagefootball playertheatre audiencemedical examinationabsent fatherdead childbilliardsdrunksketchblack eyechoirsongwritersnowingdressing roombowlingwar veteranbruisemeetingdeath of loved oneillegal immigrantpatriotismmusic bandposterthanksgivinglighthouseanti warclosetdockplaying pooldetroit michigangolf clubblack pantyhoseescalatortelevision newsdeportationstrikehangoverbroken windowclimbing through a windowlaundromatmaking outlsdcornfieldelectric guitarlandladymegaphonetoastdance clubbowling alleybreaking a windowamericanabumhearsepromvolunteerjockdomestic abusedeath of boyfriendmoustacheinterracial coupleacoustic guitarcollege campuswashing machinecultural differencepatriotironingtelevision setinfantrythe beatlestour buscounter culturestatue of libertygururadicalloudspeakersmoking potmarchrock singerestranged fatherguard dogdrug triplootingstrawberryletter writingimperialismprotestormuralpassing outcerealrecord producersearch for fatherdog tagreference to martin luther king jr.barricadefloatingliverpoolgiggreenwich village manhattan new york citybiological fatherhigh school danceprotest marchwelderfootball fieldkeyholesexy nurseshipyardsketchingpolitical unrestpsychedeliarepairmanplatoonriot policeafrobus triplocked in a closetmilitary draftwar woundhare krishnathanksgiving dinnerpatrolslow dancingtrippybasic trainingdropoutnude drawingfootball practicepeace signreference to lyndon johnsonchest hairflying machinethanksgiving daydrafttitle sung by characterblack white relationsgreyhound busbomb makingdelicatessenphysical examreference to brigitte bardoturine samplegraffiti artgospel choirjukebox musicalrecord contractwall paintingprinceton universitysinging to the cameraoutdoor concertphysical examinationprotest songsocial unrestrecord dealwashington square manhattan new york citycollege boundcollege kidmarch on washingtonpicket signrecord executivetranscendental meditationprotest riotdockworkerhomemade bombstreet theaterfloating bodypsychedelic drugreference to jack kerouacanti war movementbus depotdraft noticeex lovers back togetherlesbian attractionlooking at the audiencestudent movementburning paperdayton ohiopacketriotingsliding down a banisterocean wavesolarisationuncle samarmy inductioncranberry saucedouble negative (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cry-baby (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cry-Baby (1990)

Allison is a "square" good girl who has decided she wants to be bad and falls hard for Cry-Baby Walker, a Greaser (or "Drape" in John Waters parlance). Spoofing Elvis movies and Juvenile Delinquency scare films of the '50s, this movie follows the adventures of Cry-Baby who, though he is sent to juvi β€¦e, is determined to cross class (and taste) boundaries to get Allison back. (Read More)

Subgenre:
teen moviecult filmcampy
Themes:
friendshipseductionracismdysfunctional family
Mood:
high schoolsatirespoofsocial satire
Locations:
helicoptercourtroom
Characters:
boyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshiptattoobaby
Period:
1950s
Story:
wrong side of the tracksgreaserreference to elvis presleyfantasy sequencesingingpantiesliehandcuffsgangwhite pantiesjudgescantily clad femalespankingrat β€¦cult directoreyeglassesno pantiesforbidden lovebikerswitchbladethunderstormpanties pulled downjuvenile delinquentirreverencestar crossed loversprison breaktalent showwrongful imprisonmentrockabillyjuvenileyear 1954removing panties in public placegame of chicken (See All)

John Tucker Must Die (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

John Tucker Must Die (2006)

Kate (Brittany Snow) is the new girl in school. She catches John Tucker (Jesse Metcalfe) dating three different girls at once: Carrie - the smart girl, Heather - the cheerleader, and Beth - the activist slut; none of them are aware that they are not the only girl in John's heart. Kate, having been r β€¦aised by a single mother, has seen the pain caused by playboys like John Tucker, and she won't stand idly by. Together with the three jilted ex-girlfriends, they hatch a plan to teach John a lesson. Things rarely go as planned, especially when Kate starts to think that she might be falling for John herself. (Read More)

Subgenre:
teen movieteen comedy
Themes:
friendshiprevengevoyeurismguiltdatingbreak upcheating
Mood:
high school
Locations:
schoolhotelboatyachtbeach party
Characters:
teenage girlboyfriend girlfriend relationshipteenagermother daughter relationshipbrother brother relationshipstudentsingle motherwaitressex boyfriend ex girlfriend relationshipcheating on girlfriendnew student
Story:
premarital sexcheerleaderbasketballblondecharacter name in titlebare chested malephotographlesbian kisspantiestitle directed by femalecomputercamerabikinithonglie β€¦birthdayvoyeurcleavagevideo camerascantily clad femalebirthday partyhotel roomlocker roommini skirtscene during end creditsmanipulationfemale removes her clotheslaptopgirl in pantiesclaim in titlefalling down stairsathletewristwatchflatulencewomanizersexual humorred pantiesfemale directorfemale female kisswoman cryingfemale bondingfirst datefemale friendshipwebcamthong pantiesvolleyballelectric shockdruggedpopularityromantic rivalryinternet chatbasketball playerfood fightwoman wearing black lingeriehigh school frienddigital camerachemistrycupcakewomen kissinggeneration yplayerbasketball teamlawn sprinklerphilandererback stabbingbare midriffhiding in a carnew homekissing in publichigh school basketballman wearing a towelsprayed with waterwhite rosespelling beevideo conferencingpromiscuous motherwinkingchocolate cakesecret filmingwearing a wireshort circuitwoman wearing red lingeriegirl kissing girlbrownieteam captaintrick shotbeakersloopstreet hockeyestrogenexposed thong underwearhit with a ballmale wearing a thonggoodnight kissdingymale wearing thongcurtsyflower deliveryman wearing womans pantiesvisible thong strapsboys' locker roombumping headssexy mothertongue tied (See All)

Mamma Mia! (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mamma Mia! (2008)

Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the β€¦ Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)

Subgenre:
cult film
Themes:
dancefriendshipmoneypregnancydrinkingdrunkennessweddingmemory
Mood:
breaking the fourth wall
Locations:
beachnew york citybarchurchhotelmotorcycleairplanenightclubtaxirooftopoceanyacht
Characters:
female protagonisthomosexualfather daughter relationshipmother daughter relationshipfriendsingerdancermusicianwriterpriestsingle motherolder woman younger man relationship
Story:
summer romancebased on stage musicalblockbusterlifting someone into the airfantasy sequencef ratednuditymale nudityflashbackmale rear nuditydogsex scenekissdancingejaculation β€¦photographsingingpartypunctuation in titlecryingsongtitle directed by femalemirrorslow motion scenedrinkthongbare buttfalling from heightletterbooktearspianoislandguitarswimmingbandwomanbridgetoiletinternetfishno opening creditsdrawingbartenderlimousinebinocularssuitcaseflowersscene during end creditsdiaryexclamation point in titlepianistsplit screencloseted homosexualtouristfaintingtitle based on songbarnoverallsarchitectbuttocksbrideladdergoatearthquakepassportbarefootdivinginterracial romancehippiegreecewedding ringferryreckless drivingwedding receptiondonkeypeasantharbortriple f ratedlaundrydocksailboatold flameraftmailmailboxillegitimate childmusic boxjumping into waterbagpipesbride and groomcanceled weddingpaternitylifting female in airbridesmaidcrossing selfgirl bandbiological fathermediterraneanlifting an adult into the airtoilet stallplaying against typebachelorette partygreek islandmiddle age romancescubapushed into waterair guitarpromiscuous pasttitle sung by characterengaged couplenubile womanjukebox musicalfeather boapaddle boatresort hotelswinging on a ropewindchimeabbafalling through the ceilingflower powerreference to aphroditeswim flippers (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Whisper Of The Heart (1995) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Whisper Of The Heart (1995)

A young girl finds that all the books she chooses in the library have been previously checked out by the same boy. Later she meets a very infuriating fellow... could it be her "friend" from the library? The boy's grandfather has a violin sales and service shop. The boy wants to be a violin maker lik β€¦e his grandfather. (Read More)

Subgenre:
teen romance
Themes:
first lovelovesurrealismunrequited loveeducationfalling in lovewriting
Mood:
high schoolrainanime
Locations:
schooltrainbicycleapartmentjapanitalyrooftopcavetwo on a bicycle
Characters:
female protagonistteenage boyteenage girlboyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipwritersister sister relationshiplove trianglebest friendgrandfather grandson relationship
Story:
famous songfantasy sequenceflashbackdogsingingsongdreamcatbookbased on comicclassroombedroombased on comic bookold mandream sequence β€¦marriage proposalflash forwardlibrarysuburbbased on mangadollreadingscene during end creditshigh school studentreunioncharacter says i love youdirectorial debutrockfireplacescene during opening creditscrushviolinfollowing someoneclockambitionimaginationone dayviolinistbarking dogteenage loveinspirationlibrariantrue loveteasingbunk bedimmaturitysunriseexamintergenerational friendshipfamily homefemale writerrocking chairaspiring writerantique shoptranslationgemboy meets girlgrandfather clockwood carvingstudysleep deprivationlyricselderly manhandwritinglibrary bookbookwormclimbing over a wallcarpe diemlibrary cardluthierviolin makergradesimple lifegeodeinstrument makerbad grades (See All)

Freaky Friday (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freaky Friday (2003)

The wide generation gap between Tess Coleman and her teenage daughter Anna is more than evident. They simply cannot understand each other's preferences. On a Thursday night they have a big argument in a Chinese restaurant. Both receive a fortune cookie each from the restaurant owner's mother which c β€¦auses them to switch bodies next day. As they adjust with their new personalities, they begin to understand each other more and eventually it's the mutual self-respect that sorts the things out. (Read More)

Subgenre:
teen movie
Themes:
friendshipbetrayalweddingdysfunctional family
Mood:
high schoolaffection
Locations:
los angeles californiarestaurantmotorcyclenightclubchinese restauranttwo on a motorcycle
Characters:
female protagonistteenage girlteenagermother daughter relationshipbrother sister relationshipsingle mother
Period:
2000s
Story:
ear piercingmakeoverteen angstcar accidentf ratedbased on noveltwo word titlekissdancingremakeslow motion sceneguitarwidowpantyhoseaudition β€¦scene during end creditshigh school studentsubtitled scenetherapysupermarkettherapistpsychologistcrushhaircutcamera shot of feetrock songgrandfathermisunderstandingshoppingtitle at the endwedding receptionfast motion scenefemale stockinged feetspellhappy endingyellingstepfatherfoot closeup15 year oldvolleyballtoastgeneration gapteenage daughterunsubtitled foreign languageday in titleexammistakereference to shakespeare's hamletdetentionscrewballbanquetbody swapscreaming womanfiancereference to the rolling stonesstudio logo segues into filmsnorricamshakespearean quotationalliterative titlecharacter appears on tvmother daughter conflictbody switchingreference to shakespeare's macbethcoffeehouseshort haired femalebody piercingfortune cookieserenadebad girlyounger brothertherapy sessionsoul transferencebody transformationgarage bandswitching bodiesthree generationsmother daughter hugenglish classadult as childcheating on a testselflessnesschild as adultteen bedroomcrowd surfinggiving a speechhearing characters thoughtsreference to keith richardsshopping spreevibrationfemale therapistfemale guitaristhit on the head with a ballauthoressreference to the ramoneswedding rehearsalbride to befemale psychologisthigh school lifeparental relationshipbluetoothsinging along with radiopssttalent auditionwaking up someonepackage deliveryreference to stevie nicksteenage bandcharacter says break a legpop quizreference to world war threeschool detentiontackled to the groundteenage issuesducati motorcyclecharacter appears on a tv talk showwearing underwear on headaspiring rock starreference to the white stripesrunning into someone (See All)

Adore (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Adore (2013)

Lil ('Naomi Watts' (qv)) and Roz ('Robin Wright (V)' (qv)) are two lifelong friends, having grown up together as neighbors in an idyllic beach town. As adults, their sons have developed a friendship as strong as that which binds their mothers. One summer, all four are confronted by simmering emotion β€¦s that have been mounting between them, and each find unexpected happiness in relationships that cross the bounds of convention. (Read More)

Themes:
jealousyfriendshipdeathrevengemarriageinfidelityadulterypregnancydrinkingfeardrunkennessweddingvoyeurismmemoryextramarital affair β€¦divorcelonelinessdeath of fatherguiltunfaithfulnesstheatre (See All)
Locations:
beachhospitalbarhotelcemeterybuskitchenaustraliafranceofficeoceantownsuvrunning on a beach
Characters:
australianteenage boyteenage girlboyfriend girlfriend relationshipfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendsingerboydanceractorbabyactress β€¦best friendreference to godex husband ex wife relationshipolder woman younger man relationshipgrandmother granddaughter relationshipyounger version of charactertheatre director (See All)
Period:
summer
Story:
cigarette smokingrunningblondesexfemale nudityf ratednuditymale nudityflashbackmale rear nuditybare chested malekissfemale rear nudityfight β€¦dancingphotographsingingleg spreadingpantiestelephone callcryingcell phonesongwoman on toptitle directed by femaledreamfoodmirrorface slapcomputerdrinkbikinisex in bedbare buttsecretbookvomitingliebeertearssunglassesbirthdaysex standing upneighborvoyeurreference to jesus christtelephonef wordswimmingcleavagewineeatingwidowapologychildscantily clad femalebirthday partyunderwater scenegraveyardbartenderflash forwardjeansgraveblack pantieschampagneauditionflowerscrossdeath of husbandlaptopsadnessreunionsuspiciontearevelationlooking at oneself in a mirrorlistening to musichappinessagingwatching a movieswimsuitsurfingaudiencecoitusforbidden loveart galleryburialbald manbroken legministercard playingseasidecliffcopulationwedding receptionsunbathingphoto albumfemale female kissnew jobbirthday presentsydney australiaremorsereading aloudcrutcheslost lovesurferraft18 year oldtheatre productiondolphingiving a toastmother in lawbeach houselollipopswimming underwaterreverendsurfboardreading a booksurrogate motherlesbian subtextleg injuryleg woundremarriageoverhead shotbedtime storyhappy birthdayrearview mirrorsaying goodbyeplay rehearsalbreaking upsidewalk cafebased on novellatryst20 year oldunderwater fightsurrogate sonwoman directorleg in a casttravel agentcurtain callwetsuitphysical rehabilitationbank checkloversreference to george gershwin21st birthdaymusical productionreflection in a rearview mirrorantisepticreading a book to a childsurfing accidentwater wings (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

10 Things I Hate About You (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

10 Things I Hate About You (1999)

Adapted from William Shakespeare's play "The Taming of the Shrew," 10 Things I Hate About You starts off with Cameron, new student at Padua High, sitting in the office of the quirky guidance counselor Ms. Perky. He is then shown around the school by Michael, who will become his best friend. During h β€¦is tour is when Cameron first sees Bianca Stratford, a beautiful sophomore with one problem: she isn't allowed to date. And neither is her "shrew" sister, Katarina, a senior who loves indie rock and feminist prose and hates conformity. But Kat and Bianca's father alters his house rule: now, Bianca can date... as long as Kat has a date, too. Now, in order for Cameron to date Bianca, he has to find someone to date Kat. So Michael helps him enlist the help of pretty-boy/jerk/model Joey Donner, tricking him into thinking that *he* will get to take Bianca out if he pays someone to take out Kat. His choice: Patrick Verona, a bad-boy with a mysterious reputation--some say he ate a live duck once, others that he lit a state trooper on fire, and even more claim that he had a brief porn career. Will Patrick win Kat's heart? Will Cameron win Bianca's? Or will everything hit the fan...? (Read More)

Subgenre:
teen romanceteen movieblack comedyteen comedy
Themes:
friendshipbetrayaldrunkennessdeceptiondatingpoetryunrequited love
Mood:
high school
Locations:
schoolbarcarmotorcyclelaboratory
Characters:
female protagonistteenage boyteenage girlboyfriend girlfriend relationshipteenagerfather daughter relationshipdoctorteachersister sister relationshiplove trianglesecurity guarddaughterfathergirlfriendsingle father β€¦dream girlmean girl (See All)
Period:
1990s
Story:
cigarette smokingopposites attractteen angstf ratednumber in titledancingpartybased on playdigit in titlevomitingmarijuanaclassroomguitarsoccermansion β€¦montagemodellibraryproduct placementhigh school studentfeminismsix word titlereference to william shakespearesubtitled scenesingle parentwoman with glassesrebelinterracial friendshipbikergirl with glassespool tablefeministbookstoreboyfriendsexual humorattractionjuvenile delinquentgeekseattle washingtonenglishman abroadgothbriberybloopers during creditshigh school teachercar drivingcafeteriaintolerancebully comeuppanceshot with an arrowarcherymisfitteenage daughtertutormarching bandpromjockchick flickhigh school girlbattle of the sexesdetentionpaintballschool lifemusic storewoman punching a manprotective maleconcussioncliqueresentmentadolescent boybalisongshakespearean quotationreference to ernest hemingwayhigh school principalmisanthropefootball stadiumadolescent girlmodern day adaptationhigh school boyflasherguidance counselorserenadewhite male pretending to be blackshot in the buttyounger sisteroverprotective parentrastafarianshakespeare in modern dressenglish literatureolder sistershakespeare adaptationfrench lessonprotective fatherseattle space needleanti smokingbad poetrydancing on a tableshakespeare's the taming of the shrewshrewteen datingfeminine mystiquehigh school shakespeare adaptationreference to fabio (See All)

The Twilight Saga: Eclipse (2010) is one of the best movies like Grease (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Twilight Saga: Eclipse (2010)

Bella once again finds herself surrounded by danger as Seattle is ravaged by a string of mysterious killings and a malicious vampire continues her quest for revenge. In the midst of it all, she is forced to choose between her love for Edward and her friendship with Jacob -- knowing that her decision β€¦ has the potential to ignite the struggle between vampire and werewolf. With her graduation quickly approaching, Bella is confronted with the most important decision of her life. (Read More)

Subgenre:
teen romance
Themes:
friendshipmurderrevengesupernatural powerrivalry
Mood:
high school
Locations:
snowsmall townwoods
Characters:
female protagonistteenage girlteenagerfriendlove trianglevampirenative americanrevenge motive
Story:
graduationringone word titlebased on novelsequelflashbackkisssurprise endingvoice over narrationbattledecapitationthird partmarriage proposaltransformationvirgin β€¦sacrificeundeadcouplewerewolfinjuryenemyvillainessvirginityvisionmay december romanceengagementseattle washingtonengagement ringtelepathyage differencereturning character killed offsuper strengthphysicianfemale vampirefinal battleopen endedtitle same as bookimmortalvampirismmind readingreturning character with different actorhigh school graduationprotective malebroken handwashington statefangsvolvohero kills a womanbased on young adult noveldistractionalliancehypothermiavampire human lovebloodsuckerwolf packvampire versus vampirechief of policemother daughter hugvampire human relationshipcentenarianmale vampireundead sexualitymay december relationshipstolen kissvampire versus werewolfgraduation speechforks washingtonhead torn offsleeping in a tentmountaintop (See All)

Love, Rosie (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Love, Rosie (2014)

Rosie and Alex have been best friends since they were 5, so they couldn't possibly be right for one another... or could they? When it comes to love, life and making the right choices, these two are their own worst enemies. One awkward turn at 18, one missed opportunity... and life sends them hurling β€¦ in different directions. But somehow, across time, space and different continents, the tie that binds them cannot be undone. Will they find their way back to one another, or will it be too late? Based on Cecelia Ahern's bestselling novel "Where Rainbows End", LOVE, ROSIE is a modern comedy-of-errors tale posing the ultimate question: Do we really only get one shot at true love? (Read More)

Subgenre:
teen romancecoming of age
Themes:
friendshipmarriagepregnancyfuneraldeath of father
Mood:
high school
Locations:
schoolbeachhospitalswimming poolhotelnightclubairportelevatorenglandflathotel maid
Characters:
female protagonistteenage boyteenage girlboyfriend girlfriend relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshippolicemanbabybest friendlittle girlsingle mothermaidchildhood friendyounger version of character β€¦best friends (See All)
Story:
loss of virginitycondomcharacter name in titlebased on noveltwo word titlekisspartytelephone callpunctuation in titlecell phonepunched in the facelettervomitingneighborhandcuffs β€¦britishclassroombedroommodelmarriage proposalcollege studentchildbirthlaptopschoolgirltwenty somethingtold in flashbackone night standcheating husbandfatebreakupboston massachusettsfirst kissvoice over letterbonfireenglishman abroadteenage pregnancyfemale friendshipwebcampregnancy testschoolboycoastpharmacypool partyscholarshipromantic rivalryart exhibitioninternet chattext messagehandbagmarriage of convenienceoverhearing sexchildhood sweetheartdrunken womansoul matedyed hairhotel managermale female friendshipstore clerkworking momteenage motherhandcuffed to a bedinstant messaginghandcuffed to a bedpostyoung motherjumping into a pool with clothes onhiccupsbest friends in lovecomputer classvolkswagen vanintercepted lettermissed opportunityhotel receptionwedding speechdrug store (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Grease?
<< FIND THEM HERE! >>