Best popular movies like Gummo:

Do you need specific genre & keyword selection to find films similar to Gummo?
<< FIND THEM HERE! >>

Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gummo (1997)

Constructing this film through random scenes, director Harmony Korine abruptly jettisoned any sort of narrative plot, so here we go: Solomon and Tummler are two bored teenage boys who live in Xenia, Ohio. A few years ago, a tornado swept through it, destroying more than half the town and killing the … same amount, including Solomon's father. The film, from there, chronicles the anti-social adventures these two boys have. These include sniffing glue, killing cats, having sex, riding dirtbikes, listening to black metal, and meeting a cavalcade of quirky, bizarre, and scary people. These include a man who pimps his mentally ill wife to our anti-heroes, three sisters who play with their cat and practice becoming strippers, a black midget fending off the sexual advances of a troubled man (played by the director Harmony Korine), a 12-year-old gay transvestite who is also a cat killer, Solomon's mother who seems to be the only glimpse of sanity, two foul-mouthed six-year olds, and most importantly, a nymphlike skateboarder who walks around town wearing pink rabbit ears. (Read More)

Subgenre:
experimental filmblack comedycult filmindependent film
Themes:
father daughter incestdying townhome invasionabuseyouthincestsurrealism
Mood:
breaking the fourth wallavant garderain
Locations:
kitchenbathtubsmall town
Characters:
cat killerhomosexualitysingle mothersister sister relationshipprostitutemother son relationship
Story:
tornado damageanimal abusesexual abusedead catreference to henry winklermentally handicapped personreference to p.t. barnumfake rabbit earspellet gungossip columnistreference to michael jordancannabis usehicktap dancemultiple narrators …anti socialracist commentdeath metalshampooalbinosuper 8mmensemble filmchild swearingarm wrestlingvideo footageunderage smokingbreast cancerwhite trashmental retardationtornadoloserdead fatherskinheadaccordionohiooutcastjuvenile delinquentunderage drinkingheavy metaldwarfrednecktenniseccentrictwinsreference to adolf hitlertransvestitedirectorial debutgrandmothertwinactor shares first name with characterlong takedrug addictracial slurcigar smokingnonlinear timelinegay slurf wordprostitutionplace name in titlecatcigarette smokingfemale frontal nuditybare chested maleone word titlefemale nuditysexviolencefight (See All)

Menace II Society (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Menace II Society (1993)

This urban nightmare chronicles several days in the life of Caine Lawson, following his high-school graduation, as he attempts to escape his violent existence in the projects of Watts, CA.

Subgenre:
black comedycult filmindependent filmcoming of ageteen movie
Themes:
murderdeathlovefriendshiprevengedrugsmoneybetrayalprisonpregnancyfeardrunkennessescapegangsterrobbery …angerpsychopathdeath of fatherbrutalitydeath of motherparanoiahumiliationexecutionhopedyingvengeancepolice brutalitynear death experience (See All)
Mood:
goreneo noirhigh schoolarchive footageaffection
Locations:
hospitalcarlos angeles californiaurban settingpolice stationgas stationinner city
Characters:
single mothermother son relationshipfamily relationshipshusband wife relationshippoliceteenagerafrican americanfriendboyfriend girlfriend relationshipbrother brother relationshippolice officerdetectivepolice detectivemuslimcousin cousin relationship …grandfather grandson relationshipgrandmother grandson relationshippolice chasepolice dog (See All)
Period:
1990s1970s
Story:
child swearingjuvenile delinquentunderage drinkingdirectorial debutlong takedrug addictracial slurgay slurf wordcigarette smokingbare chested maleviolencefightnumber in titleblood …flashbackdoggunpartyknifechasethree word titlesurprise endingpistolvoice over narrationshootoutbeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facewatching tvarrestgunfightbrawlshootingvomitingheld at gunpointbeersunglassesinterrogationhandcuffsrevolvercriminalshot in the backsurvivalfoot chaseorphanflashlightgangcaliforniadeath of frienddrug dealercocaineprisonerhouseno opening creditsanti herochild in perilcontroversyflash forwardorganized crimecharacter repeating someone else's dialoguebeaten to deathproduct placementlightningstreet shootoutshot in the shoulderhigh school studentloss of fatherpremarital sexthreatened with a knifeloss of motherprofanityshot in the armheroinhatesingle parentcrime bossmachismouzicard gamepokerstreetheavy rainslow motiontold in flashbackjail cellroman numeral in titlekicked in the stomachvideotapecovered in bloodparking garagehonorstreet lifehomicidedrug dealingdrug overdosethugswitchbladestealing a cardual wieldhatredconvenience storeescape attemptblack and white scenebible quoteghettoblood on shirtrainstormbarbecuerelease from prisonethnic slurhustlerdesert eaglemarijuana jointgraduationstorehigh school teachercar drivingpistol whipfemale teacheroverdosekoreanvulgarityurban decaypolice interrogationn wordshot in the handsubmachine gundrive by shootingcarjackingblaxploitationtragic endingshrinefade to blackdreadlockssocial decayattempted robberygangstaslow motion action scenechild with a gungangsta griphoodlumlatin americanchop shopdominoesdrive thrudeath of cousinconvenience store robberyurban violencemuslim convertice cream vanblack slangwatts riotschevrolet impala convertible (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kids (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kids (1995)

Disturbing, dark, low-budget independent film about teen-agers in New York City. The story focuses on Telly (Leo Fitzpatrick), a teen who has a goal to de-flower as many virgins as he can. When one of his old encounters discovers that she is H.I.V.-positive, after only one encounter with a guy, Tell …y remains undaunted. (Read More)

Subgenre:
cult filmindependent filmcoming of agetragedyteen movie
Themes:
friendshipdrugsrapelesbianismdrug useaids
Mood:
hip hop
Locations:
new york cityswimming poolinner city
Characters:
teenagerafrican americanteenage girlteenage boynurse
Period:
1990s
Story:
sexual abusecannabis useunderage smokingunderage drinkingactor shares first name with charactergay slurf wordcigarette smokingfemale frontal nuditybare chested maleone word titlefemale nuditysexviolencemale nudity …male rear nuditykissnipplespartylesbian kisspantiesbeatingunderwearurinationundressingkissingbare buttbedmarijuanaswimmingbedroombranew yorkdrug dealercontroversyblack pantiesstrippingvirgingay couplekissing while having sexteenage sexactor playing himselfloss of virginitystreethatdrug abusebuttockscaucasianbuttskateboardvirginitystreet lifeinterracial friendshiptensionshopliftingbackpackkickingmedical examinationskateboardingone dayraised middle fingerswearingpromiscuityspittingcannabispubertyweedrear nudityhuman immunodeficiency virussexual promiscuityclinicmale stripperanarchystrong languagedruggedteenage sexualitypotunderage sexspitbagteenage girl in underweardate rapesmoking potskateboarderearringsswimming in underwearnaked buttstatutory rapesexually transmitted diseasenight swimmingblood testvenereal diseasespitting on someonebaseball hatmiddle fingermismatched bra and pantiesgiving the fingerc wordsee through brateenage rapestdteen sexualitymedical testpaper bagdelibuddy filmlost generationtroubled teenagerwet hairnaive young womanstreet kidsbluntbackwards hatalcohol in brown paper bagskateboarding video (See All)

Boyz N The Hood (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Boyz N The Hood (1991)

John Singleton's portrayal of social problems in inner-city Los Angeles takes the form of a tale of three friends growing up together 'in the 'hood.' Half-brothers Doughboy and Ricky Baker are foils for each other's personality, presenting very different approaches to the tough lives they face. Rick …y is the 'All-American' athlete, looking to win a football scholarship to USC and seeks salvation through sports, while 'Dough' succumbs to the violence, alcohol, and crime surrounding him in his environment, but maintains a strong sense of pride and code of honor. Between these two is their friend Tre, who is lucky to have a father, 'Furious' Styles, to teach him to have the strength of character to do what is right and to always take responsibility for his actions. (Read More)

Subgenre:
black comedycult filmindependent filmcoming of agetragedyteen movie
Themes:
home invasionmurderdeathfriendshiprevengedrugsmoneyescapegangsterangerracismdeath of fatherpovertydysfunctional familyrivalry …crueltyvengeancepolice brutalitymurder of brother (See All)
Mood:
high school
Locations:
restaurantschoolchurchcarhelicopterlos angeles californiawheelchairurban settingpolice carsinging in a carschool teacher
Characters:
single mothermother son relationshipfamily relationshipsfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattoobrother brother relationshipteenage girlteenage boy …teacherpolice officerbabytough guylittle boyex husband ex wife relationship (See All)
Period:
1980s1990syear 1991year 1984
Story:
child swearingjuvenile delinquentunderage drinkingdirectorial debutlong takedrug addictracial slurgay slurf wordcigarette smokingbare chested malefemale nuditysexviolencefight …bloodmale rear nuditygunfemale rear nuditydancingnipplespartyknifechasepistolbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facewritten by directorarrestbrawlbare buttshootingrifleheld at gunpointbeerrunninginterrogationhandcuffsrevolvertelephoneshot in the backgangdeath of frienddrug dealermontagefootballmapman with glassesno opening creditsfishingchild in perilshot in the legflash forwardattempted murdervirgindangerprologuelocker roomstorytellingdeath of brothertragic eventstalkingdeath of sonsadnesspremarital sexex convicthatesingle parentak 47machismouziteen angstwhat happened to epiloguedesireelectronic music scoreloss of virginitysurvivortitle based on songloss of friendloss of loved oneamerican footballkicked in the stomachvideotapecovered in bloodskateboardmilkhomicidedrug dealingtensionrap musicconfrontationloss of sonhatredconvenience storedeath threatjunkiepunched in the chestghettoblood on shirtracisttitle at the endbarbecueattractionethnic slurdeath of loved oneloss of brotherneighborhoodmelancholyshot multiple timesthanksgivingvietnam veteranstreet gangcar drivingadvertisementbitternessyoung version of characterreal estateweightliftinggang violencesexual promiscuitybillboarddouble barreled shotgunurban decayfilm starts with textsawed off shotgunmeat cleaverpalm treen worddeath of boyfrienddrive by shootingparaplegicintentionally misspelled titlehip hop musicblack copfast food restaurantclimbing out a windowsocial decayattempted robberyvolkswagen beetlegangstacapgentrificationrescue attemptconspiracy theoristpagerloss of boyfriendgangsta gripafrolowriderroman catholicdominoessouth central los angelesmagnum handgunblack familypacifierfat childfavoritismlow ridercollege boundtrain trackafrican american musicressentimentblack directorblack slanglive in girlfriendchevrolet impala convertiblemortgage broker (See All)

Twin Peaks: Fire Walk With Me (1992) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Twin Peaks: Fire Walk With Me (1992)

Essentially a prequel to David Lynch and Mark Frost's earlier TV series "Twin Peaks". The first half-hour or so concerns the investigation by FBI Agent Chet Desmond (Chris Isaak) and his partner Sam Stanley (Kiefer Sutherland) into the murder of night-shift waitress Teresa Banks in the small Washing …ton state town of Deer Meadow. When Desmond finds a mysterious clue to the murder, he inexplicably disappears. The film then cuts to one year later in the nearby town of Twin Peaks and follows the events during the last week in the life of Laura Palmer (Sheryl Lee) a troubled teenage girl with two boyfriends; the hot-tempered rebel Bobby Briggs (Dana Ashbrook) and quiet biker James Hurley (James Marshall), her drug addiction, and her relationship with her difficult (and possible schizophrenic) father Leland (Ray Wise), a story in which her violent murder was later to motivate much of the TV series. Contains a considerable amount of sex, drugs, violence, very loud music and inexplicable imagery. (Read More)

Subgenre:
experimental filmcult filmindependent film
Themes:
incestsurrealismmurderdeathlovefriendshiprapeinvestigationdeceptionseductioncorruptionpsychopathbrutalitysupernatural powerdrug use …dysfunctional familyredemptionmental illnessmurder investigationmysterious death (See All)
Mood:
avant gardegorehigh schoolnightdarkness
Locations:
small towncanada
Characters:
prostitutepolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlfemale protagonistserial killerbest friendwriter director
Period:
1980syear 1989year 1988
Story:
sexual abusedwarftwinactor shares first name with characternonlinear timelineprostitutioncigarette smokingfemale frontal nudityfemale nuditysexviolencef ratedbloodtelephone call …firecryingdreamcorpseblondesecretbedhallucinationtelephonedrug dealercocainepantyhosebased on tv seriesscreamingfbipossessionangelmissing persondiaryhigh school studentdarksadnessobscene finger gesturemonkeymoonstrong female characterfemale stockinged legsfbi agentclubproduced by directorstrong female leadschizophreniacamera shot of feetcrime scenewoman in jeopardyvisionsufferingfemale leadpsychotronicdespairphiladelphia pennsylvanialooking at self in mirrorprequeldead girldoppelgangerinvestigatorevil spiritdouble lifefemale friendshipsplit personalityfoot closeupfriendship between girlslesbian subtextsalvationenigmaviolent deathagoraphobiareturning character with different actordeja vumultiple personalitydoublehigh school friendmental instabilitybased on cult tv seriestraffic lightwashington statepacific northwestroad ragefilicidewhite horsestrong sexual contentcult movie castjealous boyfriendimplied cunnilingusfemale bare feetfemale in lingeriemysterious eventsone armed manpersonality changedeliberate crueltyreference to fred astairereference to j. edgar hooverfemale stockinged solesdual personalityrape of a minorreference to ginger rogersfingernailred curtainsinger actingblue lightwoman putting on makeupinner demonred roomtaking control of someone's bodyabandoned trainhomecoming queenfemale bare legsunintelligible dialogue with subtitleswaitress uniformtalking backwardscult male charactercrazeerratic behaviortelevision smashingcult female charactertragic female character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Irréversible (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Irréversible (2002)

Events over the course of one traumatic night in Paris unfold in reverse-chronological order as the beautiful Alex is brutally raped and beaten by a stranger in the underpass. Her boyfriend and ex-lover take matters into their own hands by hiring two criminals to help them find the rapist so that th …ey can exact revenge. A simultaneously beautiful and terrible examination of the destructive nature of cause and effect, and how time destroys everything. (Read More)

Subgenre:
cult filmindependent film
Themes:
father daughter incestincestmurderdeathrevengedrugsrapemoneypregnancydrinkingfearvoyeurismseductionangercorruption …lonelinesspsychopathbrutalityparanoiadrug useinsanitysadismevilhomophobiacrueltyvengeanceaidsmadnessrape and revenge (See All)
Mood:
gorenightdarkness
Locations:
barcarparis francewatertaxielevatorurban settingcityfrancetaxi drivertunnelgay barsex in a bathroom
Characters:
prostitutehomosexualpolicefather daughter relationshipchildrengay sexpolicemandancerex boyfriend ex girlfriend relationshippimp
Story:
sexual abusetransvestiteactor shares first name with characterlong takenonlinear timelinegay slurprostitutioncigarette smokingfemale frontal nudityone word titlefemale nuditysexviolencefight …bloodmale nuditybare breastsmale frontal nuditymasturbationmale rear nuditykissfemale rear nudityfemale full frontal nuditydancingphotographpartyknifeleg spreadingerectionpantiesshowerfondlingbeatingblood splattermirrorslow motion scenepunched in the facewritten by directordrinkinterrogationjailvoyeurmale pubic haircleavagebedroomwinecandleambulancewomancocainefemale pubic hairsubwaywhite pantiespainstrippingbeaten to deathdangerscreamingevil manscreamisolationsadnesstrapthreatened with a knifewhippingheroinbralesshatehuggingdestinynipples visible through clothingstreetdresssociopathcomahappinessvandalismassaultdesperationsadomasochismrape victimnaked womanfaterapisthomicidewoman in jeopardysufferinghatredmercilessnessdespairstairspedophilepanties pulled downperversiondisfigurementdark pastunsimulated sexsexual assaultbruisesodomymisogynyfemale in showerfire extinguishermenstruationhead blown offmisogynisthuman monstersubway stationsnorting cocainebitternesssexual perversionsexual violenceselfishnesspregnancy testmasochismanal rapehead injurycrushed headhallwaysex clubextreme violencedisfigured faceoverhead camera shotsex workerwhite dresspsychotronic filmcocaine snortingphilosophercurtaindepravitywashingcelibacydebaucherysexual sadismsexual torturesnorricamsexual crueltybreaking a car windowparisbroken windshieldlawn sprinklereye candymoral corruptionskull crushinghit on the head with a fire extinguisherviolence against a womansexual exploitationdeviant sexbattered womanaltruismpeugeotwatching a porn videounderpassflashing lightsex maniacdegenerationfacial disfigurementhit with a fire extinguisherhardcore technoreverse chronologystreet prostitutiontransvestite prostitutefrench shock cinemablue lightcredits rolling downmistaken for a prostitutederanged manpopperssex degeneratebroken car windowsadistic sexretrograde narrativebreaking an armperverse sexrape scenetapewormtorn pantiesbrutal rape (See All)

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
black comedycult filmindependent filmsuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
home invasionmurderdeathfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited love …exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
raingorecar chaseambiguous ending
Locations:
bathtubhospitalforestbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed
Characters:
father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog
Period:
2000s
Story:
mental retardationunderage drinkingredneckeccentricdirectorial debutracial slurgay slurf wordcigarette smokingfemale frontal nuditybare chested malefemale nudityviolencebloodflashback …masturbationdogsex scenefemale rear nudityfingeringphotographpartyknifechasesurprise endingpantiespistolshowerfirecell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backswimmingdecapitationcleavagesurvivalfoot chaseambushaxemassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifesevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntercovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desirereverse footagetensionstealing a carstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoeabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Boys Don't Cry (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Boys Don't Cry (1999)

Based on actual events. Brandon Teena is the popular new guy in a tiny Nebraska town. He hangs out with the guys, drinking, cussing, and bumper surfing, and he charms the young women, who've never met a more sensitive and considerate young man. Life is good for Brandon, now that he's one of the guys … and dating hometown beauty Lana; however, he's forgotten to mention one important detail. It's not that he's wanted in another town for GTA and other assorted crimes, but that Brandon Teena was actually born a woman named Teena Brandon. When his best friends make this discovery, Brandon's life is ripped apart. (Read More)

Subgenre:
independent filmtragedy
Themes:
home invasionmurderdeathfriendshiprapeprisonlesbianismdrinkingdanceseductionbrutalitydrug usedysfunctional familysexualityhomophobia …transgenderprejudice (See All)
Locations:
kitchensmall townbarrural settingfarmcampfire
Characters:
single motherhomosexualpolicemother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshippolicemantranssexualcousin cousin relationshipself mutilationdeath of girlfriendself worth
Period:
1990s
Story:
white trashoutcastrednecktransvestitedirectorial debutgay slurcigarette smokingfemale nuditysexviolencef ratednudityflashback …kissfemale rear nuditypartylesbian kissthree word titlepistolshowerbased on true storyvoice over narrationpunctuation in titletitle directed by femalebeatingshot in the headpunched in the facewritten by directordrinkarrestundressingsex in bedshootingbirthdayapostrophe in titlejailrevolvernewspaperstrap on dildobreast sucklingdisguisebrunettebirthday partycontroversylatex glovesstrippingfugitivefemale removes her clothestragic eventthreatobscene finger gesturecross dressinghatetwenty somethingmachismoclaim in titletitle based on songstabbed in the stomachrape victimbar fighthaircutrole playingimpostorrejectionkaraokelove at first sightprison cellbigotrypassionate kisssexual assaultsodomymain character diesfemale female kissmenstruationgay bashingtrue crimedouble lifeintolerancesexual violencefarmhousemisfitnewspaper articlehate crimefactory workercontraction in titlebiologyex confisticuffsmugshotmurder by gunshotsociologyftmmain character shotunwanted kisssexual identitygender disguisegirlfriend girlfriend relationshipnebraskaostracismrite of passagelesbian slurgender confusiongirl disguised as boybinding breaststransphobiasexual identity crisistransgender protagonistfemale dressed as maletraffic ticketmale impersonationroll in the haylincoln nebraska (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Natural Born Killers (1994) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Natural Born Killers (1994)

Mickey Knox and Mallory Wilson aren't your typical lovers - after killing her abusive father, they go on a road trip where, every time they stop somewhere, they kill pretty well everyone around them. They do however leave one person alive at every shootout to tell the story and they soon become a me …dia sensation thanks to sensationalized reporting. Told in a highly visual style. (Read More)

Subgenre:
black comedycult filmindependent filmpsycho thriller
Themes:
incestsurrealismmurderdeathloverevengekidnappingrapeprisonfearescapedeceptionseductioncorruptionpsychopath …death of fatherbrutalitydeath of motherparanoiadysfunctional familyinsanitysadismsurveillanceevilexploitationcrueltypolice brutalitymadnessprison escape (See All)
Mood:
breaking the fourth wallgoresatireneo noirnightmarearchive footageslasherstylization
Locations:
kitchenforestparis francedesertlondon englandwoodsfarmroad tripmotelgas stationcampfireroad movienew mexicoprison bus
Characters:
prostitutemother son relationshiphusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerdetectivehostagetough guynative american …waitresssecurity guardjapanesepolice detectivepsychiatristaustralianpolice shootoutself mutilationwitch doctor (See All)
Period:
1990s
Story:
sexual abusewhite trashtornadoredneckgay slurf wordcigarette smokingbare chested maleviolencesexfightbloodinterviewflashbackdancing …photographexplosionsingingknifethree word titlesurprise endingpantiespistolfirecell phoneshootoutbeatingdreamcorpseshot to deathblood splatterfistfightmachine gunhorseshot in the chesturinationface slapshot in the headshotgunrescueslow motion scenepunched in the facecameraarrestundressinggunfightbrawlshootingbookvomitingheld at gunpointbeersunglassesdemonjailhallucinationhandcuffstelevisioncriminalshot in the backsubjective cameraflashlightjournalistbound and gaggedambushstrangulationmassacrewomanmontagethroat slittingbridgestabbed to deathdinerprisonerstabbed in the chestweaponmapsnakechild abusesevered headdream sequenceanti herodisarming someonedouble crosscontroversypolice officer killedfemme fatalenews reportdrowningshot in the foreheadon the runflash forwardone against manyauthorcharacter repeating someone else's dialoguebeaten to deathprologueelectrocutionfantasy sequencefugitivepoisoncharacter's point of view camera shoton the roadangelevil mankicked in the facerabbittough girlringscene during end creditsconvertiblewitnessneck breakingpremarital sexmurdererthreatened with a knifefireworksnewspaper headlinesubtitled scenecorrupt copsplatterfreeze framemaniacriotpickup trucktv newswolfburned alivemass murderlooking at oneself in a mirrortape recordersociopathfamescene during opening creditscowboy hatsecurity camerajail cellwalkie talkiekicked in the stomachpop culturemediavillainesscovered in bloodgrindhousesheepjournalismsadomasochismrape victimpart animationblack humortorchfateanimal attackmexican standoffschizophreniafemale killersocial commentaryhaircutmechanicwatching televisionrampagecrime scenehaunted by the pasttokyo japanprison guardstealing a carcynicismfandual wieldstabbed in the throatanimated sequencemercilessnessironychaosblack and white scenetime lapse photographypunched in the chestsexual harassmentassault rifleaccidental killingarizonablood on shirthighwaywedding ringknife throwinggasolinedark pastabusive fatherfemale reporterkilling spreeburned to deathpsychoticmedia coveragefast motion scenesouthern accentbullet timeclose up of eyesdesert eaglenews reportershot through a windowblood on camera lensvillain played by lead actorpsychopathic killertaserstock footagehuman monsterfilm crewautographjukeboxrepressionhomicidal maniacfemale psychopathfish tankcameramancoca colaescaped convictanarchysawed off shotgunscorpiondeath rowshamanpatricideantpiewoman kills a manshot in the handcorrupt policefight the systemextreme violencefilmed killingtragic pastwoman fights a manmatricidecrowbarfemale criminalnevadatabloidrattlesnakesex with a minorjailbreakpool of bloodcockney accentexposesnake biteanimal killingmass murdererprison wardensolitary confinementknocked out with a gun buttsocial decayinnocent person killedextreme close upkicked in the groincrime spreehorse chasemaceprison riotdrugstoredutch angleantidotesuper bowlgeneration xnewscastermedia manipulationsurprise during end creditswoman punches a manmass mediafemale bodybuilderescaped prisonerfemale serial killermob of reporterspepper spraytelling a joketear gasgas grenadeshooting starreference to charles mansonriot policeimplied incestmagic mushroombleeped dialoguemulletmedia hypehuman shieldmurderer duoindian reservationlaundry roomslide locked backnavajotrippyyin and yanglaugh tracklovers on the lamtwo killerstraumatic childhoodknife in backtv journalisttime magazinenews crewshivmanicsevered toefugitive sextrampled to deathhanging bodyhowie screammedia exploitationpsychedelic imageeeny meeny miny moetv advertdarwinian struggle for survivalrear projectionorff carmina buranatabloid journalistpsychopathic copsnakebite poisonstargazing (See All)

Romper Stomper (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Romper Stomper (1992)

Nazi skinheads in Melbourne take out their anger on local Vietnamese, who are seen as threatening racial purity. Finally the Vietnamese have had enough and confront the skinheads in an all-out confrontation, sending the skinheads running. A woman who is prone to epileptic seizures joins the skins' m …erry band, and helps them on their run from justice, but is her affliction also a sign of impurity? (Read More)

Subgenre:
independent filmtragedy
Themes:
home invasionincestmurderdeathbetrayaljealousydancerobberyracism
Mood:
night
Locations:
kitchenbarbeachtrainbusaustraliacity
Characters:
father daughter relationshipboyfriend girlfriend relationshiplove triangleterrorgrandmother grandson relationshiphomeless man
Story:
skinheadracial slurgay slurf wordcigarette smokingbare chested malefemale nuditysexviolencefightmale nuditytwo word titletelephone callface slapwritten by director …bathroompianotelephonegangstrangulationaxedeath of friendimmigrantmapapologyman with glassescontroversyvanshot in the foreheadbartenderbeaten to deathstabbed in the backkicked in the facescene during end creditsdomestic violencepolicewomancharacter says i love youprofanitysubtitled scenearsongaragepot smokingtouristvandalismflatulenceskateboardrailway stationmale underwearsurveillance camerablood on faceburglaryshopping mallkicked in the crotchmedicationrefrigeratorpolice raidopening a doorbriefsdead motherplaying pianodaggermain character diestelephone boothtelling someone to shut upneo naziknocking on a doorrhyme in titlebreaking a windowlying on bedwhite briefslighting a cigarettefisticuffsepilepsydriving at nightman slaps a womanpublic phonevietnamesethreat to killmelbourne australialooking at picturepinball machinedelinquenthomophobeburning carlaundry drying on clothes linewhite supremacistunfaithful girlfriendneo nazismkettlecorpse with eyes openattempted drowningvandalizing a cardrinking milkwhite powerunprovoked violence (See All)

Mysterious Skin (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mysterious Skin (2004)

Brian Lackey is determined to discover what happened during an amnesia blackout when he was eight years old, and then later woke with a bloody nose. He believes he was abducted by aliens, and N. McCormick, a fellow player on Brian's childhood baseball team, may be the key as to exactly what happened … that night. As Brian searches for the truth and tries to track him down, Neil McCormick takes up hustling and moves to New York, in attempts to forget childhood memories that haunt him. Together, the two of them uncover the terrible truth of the scars they share. (Read More)

Subgenre:
independent filmcoming of age
Themes:
abusefriendshipkidnappingdrugsrapechristmasmoneydrinkingdrunkennessinvestigationvoyeurismmemorycorruptiontheftobsession …paranoiadrug usedysfunctional familyguiltgriefhumiliationunrequited lovecrueltychildhoodtraumaregretchildhood traumaalien abductionpsychological trauma (See All)
Mood:
rainnightmare
Locations:
bathtubsmall townnew york citybarsnowbusbicyclebaseballrooftopmotelgay barbus station
Characters:
single motherprostitutemother son relationshipfamily relationshipshomosexualfather son relationshipfriendtattooboybrother sister relationshipteenage girlteenage boygirlalien …studentgay sexphotographerbest friendlittle girlgay kissbullylittle boygay friendhomosexual rapehomosexual kissgay rape (See All)
Period:
1980s1990syear 1991year 1983year 1981year 1987
Story:
sexual abuseshampoochild swearingunderage drinkingnonlinear timelinegay slurprostitutioncigarette smokingviolencebased on novelnuditybloodmale nudityflashback …masturbationmale rear nuditydoggunkissejaculationphotographsingingshowertelephone callvoice over narrationcryingbased on bookbeatingdreamunderwearfoodurinationface slapwatching tvdrinkcondomundressingletterbeertearsrunningbirthdaybedmarijuanasubjective camerahalloweenbedroomflashlightnew yorkcocainehousesubwaychild abusechilddrawingbathsearchejaculation into someone's mouthlibrarymicrophonestrippingangelreadingchristmas treecollege studentfarmerhalloween costumeprankscargiftsadnessunderwaterobscene finger gesturefireworksgraffitiufosingle parentpizzacoacheyeglassespot smokingrevelationbreaking and enteringheavy rainlistening to musictape recorderfaintingice creamtoywatching a movienosebleedvideotapeteddy bearcrushmovie theatremale prostitutehaunted by the pasttarget practicebloody nosesufferingchild's point of viewplaygroundrejectiontaking a picturepost traumatic stress disorderhypnosislostchristmas eveabsent fatherpedophileperversionrainstormmustachesnowingdark pastbruisecellarhustlerchildhood memorypipe smokingphoto albumtracking devicepervertearphonespresentnew jobshynesspedophiliaspit in the facepostcardmen's bathroomtrick or treatingsnorting cocainechild molestationjournalcrutchesblackoutmotel roombitternesssexual perversiongay crushtween girlclimbing through a windowboy with glassesdegradationanal rapewhisperingmale rapehanging upside downlsdfallingcrippleplaying a video gamemuggingaudio cassetteseizurestation wagonmale prostitutiondecadencesorrowoverhead camera shotchild molesterkansascruising10 year oldpolaroid cameratraumatic experiencewitch costumebaseball teammolestationfast food restaurantloudspeakerinner title cardchristmas caroldepravityletter writingrocking chairleaving homesoul matedisabledboy girl relationshipcerealsweaterborderline personality disorderbody part in titlemistreatmentman boy relationshipsubconsciouscupcakerepressed memorytv show in filmhandballdevil costumeloss of innocencesexually transmitted diseasegomorrahyscaffolddrug snortingmoral corruptionvenereal diseasebed wettingumpiregay hustlereight year oldlittle leagueswing setmother's boyfriendgay man straight woman relationshipmobilemen's toiletuses the word faggotgay kidcommunity collegeporch swinguses the word faghomemade haunted house attractionairplane ticketbaseball coachglbt issuesbreakfast cerealcamaropartner in crimeatariephebophilecrawlspacebroken eyeglassesdead cowbaseball cardconfronting the pasteyesightsilent nightmaking facesunwanted sexual advancesblue lightmale male relationshipmale wearing makeupsexual aberrationdrive in theatremale hustlergarglingcrabsrecovered memorysexual ambiguitytagginglittle league baseballmouthwashburied memorieschristmas carollingfalling glassuniversity of california berkeleyemotional shockman boy lovehand in pantsmodesto californiasandwich shopsexual corruptionsordidnesssubway ridebottomless pitgay man straight man relationshipreference to jan vermeerkarposi sarcomaloss of dignitysnack foodupside down imagevermeer paintingbeanbagcrab licenegligent motherpot pipeamc gremlinbrighton beach new yorkloft bed (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Celebration (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Celebration (1998)

The Father turns 60. His family, which is a big one of the kind, gathers to celebrate him on a castle. Everybody likes and respects the father deeply...or do they? The youngest son is trying to live up to the father's expectations. He is running a grill-bar in a dirty part of Copenhagen. The oldest  …son runs a restaurant in France, while the sister is a anthropologist. The older sister has recently committed suicide and the father asks the oldest son to say a few words about her, because he is afraid he will break into tears if he does it himself. The oldest son agrees without argument. Actually he has already written two speeches. A yellow and a green one. By the table, he asks the father to pick a speech. The father chooses green. The oldest son announces that this is the Speech of Truth. Everybody laughs, except for the father who gets a nervous look on his face. For he knows that the oldest son is about to reveal the secret of why the oldest sister killed herself. (Read More)

Subgenre:
black comedycult filmfamily drama
Themes:
father daughter incestabuseincestmurderfriendshipsuiciderapepregnancydrinkingdrunkennessfuneralmemoryracismdepressiondysfunctional family …sexualityhumiliationabortionprejudicehuntingdeath of daughtersuicide of daughter (See All)
Mood:
satire
Locations:
kitchenbathtubrestauranthotelwaterairport
Characters:
mother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipbrother sister relationshipdancerchristianbullywaitress …interracial relationshipdaughterfatheruncle nephew relationshipgrandfather grandson relationshipgrandmother grandson relationshipgrandmother granddaughter relationshipuncle niece relationshipgrandfather granddaughter relationshipparent child relationshipsuicide by drowningalcoholic drink (See All)
Story:
sexual abusetwinracial slurcigarette smokingfemale nudityone word titlesexviolencefightmale nuditybondagekissdancingsinging …partytelephone callcryingcell phonesongbeatingunderwearfoodblondeface slapdrinksecretlettervomitingshowdowntearsbirthdaybathroompianohallucinationalcoholcookingwinecandleold maneatingdinnerchild abuseapologychilddrawingbirthday partybathcoffeeknocked outspeechpianistdisappearancereunioncharacter says i love youpsychicscandalragecookservantbreakfastembarrassmentcelebrationinterracial romancehaunted by the pasttensionhypocrisysonkickingdespairpedophiledrunkdeath of sisterfallracistboarding schooltuxedofamily secretpedophiliacafeteriafamily reunionlectureblonde womanestatedrunken manwhistleshoutingimaginary friendreceptioniststonedtoastgiving a toastman punching a womanrespectloss of sistercountry housespitanthropologynervousnessgravestonecircular staircasehypocriteriddletwin sisterretributionfather son conflictchild rapeman hits a womansocialistman slaps a womanman slaps womantied to a treepatriarchcaught in the actfamily gatheringsenilitydogme 95danish blondeman hits womantaxi ridecar keysalcohol abusefalling asleeprestaurant ownerreference to alfred hitchcockcountry estatewine cellarostracismdawnman punches a womancompanionlodgefreemasoncognacprodigal sondirty old mandisgracedisrespectdisgustshower curtaindrowning in a bathtubupstairs downstairsspontaneous sexwearing clothes in a bathtubbirthday dinnerfather son incestdeath of twinbanging on a doordanish culturefather sondismaysuicide of sisterdisdaindaybreakexcessive drinkingvenison60th birthdayhotelierpater familiasreference to little black sambo (See All)

Striptease (1996) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Striptease (1996)

Erin Grant loses care and custody of her daughter when she's divorced from her husband Darrell, a small-time thief. Struggling for money, she is a dancer at a nightclub, where one night Congressman Dilbeck (in disguise) attacks another member of the audience. A spectator, who recognizes Dilbeck and  …is fond of Erin, offers to get back her daughter by blackmailing Dilbeck. Things do not work out as planned, though. (Read More)

Subgenre:
black comedycult filmconspiracy
Themes:
murderdeathkidnappingdrunkennessgangsterdeceptiondivorceblackmailmafia
Mood:
satireneo noir
Locations:
hospitalbeachhotelboatwheelchairlakemotelstrip clubyacht
Characters:
single motherfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistpolice officerdetectivethiefchristianpolice detectiveemployer employee relationshipex husband ex wife relationshipcoroner
Period:
1990s
Story:
reference to michael jordanwhite trashredneckeccentriccigar smokingf wordcigarette smokingfemale frontal nuditybare chested malefemale nuditybased on novelnuditybare breastsflashbackdog …gunfemale rear nuditydancingnipplesphotographknifesurprise endingpistoltopless female nuditybeatingcorpseslow motion scenearrestthongbare buttletterheld at gunpointsunglassesdead bodyhandcuffsrevolvercriminalstrippertoplessaxedisguisewomanpoliticiansnakefishjudgedisarming someonecontroversyvanmarriage proposallimousineorganized crimebinocularsblack pantiesstrippingstripteasefactorypay phonebuxomproduct placementcover upknocked outcourtbodyguardhairy chestthreatened with a knifemonkeyheart attacksingle parenttopless womancrime bosscard gamesabotagefarceheavy rainlooking at oneself in a mirrortape recorderfaintingwalkie talkiemorguefloridadesperationpress conferenceteddy bearembarrassmentmale underwearboxer shortsfanitalian americannipplemiami floridaaquariumblack brahit on the headcon artistdressing roombroken armblack bra and pantiessouthern accentchauffeurmob bosscartoon on tvloss of jobexotic dancervideo storecockroachgolf clubabandoned housetrailer homeinformantlaundromatsweatdolphinconservativeinfatuationoffscreen killingchild custodybra removingmafia bossbouncercorrupt officialboard gamebreastpole dancerfundraiserpole dancingsugar555 phone numbercongressmanknife held to throatenvelopered carpetreference to winston churchillrearview mirrorsecret service agentfake breastscustodypower drilltrailer trashphone bookdead fishwearing a sound wiresignaturetopless dancingchristian fundamentalismreal life mother and daughter playing mother and daughterwoman in a towelyarmulkefamily valuesemployee employee relationshipdancing aloneyogurtpet snaketelepromptervaselinereference to george bushpet monkeyfemale attempts to seduce maletic tacsprivate dancerfemale stripteasereference to barbara bushcandy land (See All)

A Clockwork Orange (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Clockwork Orange (1971)

Protagonist Alex DeLarge is an "ultraviolent" youth in futuristic Britain. As with all luck, his eventually runs out and he's arrested and convicted of murder and rape. While in prison, Alex learns of an experimental program in which convicts are programmed to detest violence. If he goes through the … program, his sentence will be reduced and he will be back on the streets sooner than expected. But Alex's ordeals are far from over once he hits the mean streets of Britain that he had a hand in creating. (Read More)

Subgenre:
black comedycult filmcoming of agedystopiapolitical satire
Themes:
home invasionyouthsurrealismmurderfriendshiprevengesuicidedrugsrapebetrayalpoliticsprisontorturedrunkennessdeception …robberypsychopathbrutalityredemptioninsanitysexualityillnessmental illnesssadismdeath of wifehomelessnesswritingpolice brutalitynear death experience (See All)
Mood:
avant gardesatireneo noirambiguous ending
Locations:
bathtubhospitalbarrestaurantchurchsnowmotorcyclenightclublondon englandwheelchairapartmentpolice stationwater torturesex in the snow
Characters:
mother son relationshipfamily relationshipshusband wife relationshipfather son relationshippoliceteenagerdoctorpolice officernurseactorwriterpriestlustpsychiatrist …biblehomeless manpolice sergeantsex with a nurse (See All)
Period:
world war two1990sfuturenear future
Story:
anti socialjuvenile delinquenteccentricreference to adolf hitlerlong takecatbare chested malefemale nudityfightviolencebased on novelbloodmale nuditythreesomeinterview …male frontal nuditymasturbationmale rear nudityfemale rear nudityfemale full frontal nudityphotographsingingknifeleg spreadingthree word titlesurprise endingvoice over narrationfondlingbeatingdreamfistfightcar accidentslow motion scenepunched in the facearrestundressingbrawlsex in bedbare buttfalling from heightmaskriflecar crashinterrogationhandcuffsbritishvoyeurreference to jesus christmale pubic haircolor in titlecriminalreportersubjective cameracleavagejournalistbound and gaggedwinegangdisguisemansionmontagethroat slittingbridgesuicide attemptprisonerpoliticianfemale pubic hairtied to a chairsnakewhite pantiesno opening creditsanti heroscantily clad femaledouble crosscontroversypublic nuditylibraryauthorblack pantiesbeaten to deathstabbed in the backlocker roomwidowerattackfantasy sequencecharacter's point of view camera shotstatueevil manknocked outkicked in the facebaseball batlightningscreamattempted rapeprankmanipulationconvertiblebodyguardinjectionfemale removes her clothesneck breakingpremarital sexthreatened with a knifecult directortypewriternewspaper headlinesexual fantasyexperimentelectronic music scorehypodermic needleheavy raintape recordersociopathcomared dressloss of loved onesex on floorkicked in the stomachmovie theaterblockbusterwristwatchclassical musicclubirishrape victimmind controlrapistmilkstreet lifesocial commentarythugyogawoman in jeopardyreverse footageprison guardstealing a carministerhatredpool tabletitle appears in writingsculptureblack and white scenetime lapse photographypunched in the chestrivalbilliardsgang rapeaccidental killingfascismrainstormalternate realityhomoeroticismfemale doctorcanesocial workerpublic humiliationgrowing uprelease from prisonsexual assaultalienationpolice inspectorsports carmoral dilemmairreverencefast motion scenedrugged drinkhit with a baseball batclose up of eyespervertchocolatevillain played by lead actorface maskcrucifixionbrainwashingforced to stripspit in the facemisogynisteyebeggarmini dressreference to the beatlesgovernorweightliftinganarchynihilismstrait jacketcrashing through a windowimmaturityvolunteerrehabilitationaudio cassettebritainwhite briefsfight the systemanarchistexperiment gone wrongfamous scorewet t shirtfisticuffsancient romecureharempsychological torturegang membercockney accentimprovised weapongang leaderspaghettimurder of a nude womanprison wardenfamous linejerkbreaking a bottle over someone's headclimbing out a windowsocial decayattempted robberycrime spreerecord storefemale journalistred wineslow motion action scenereference to ludwig van beethovenlibertymarinacult figureflirtationfamily abandonmenthuman experimentationman fights a womandebaucheryvicarspiked drinkconcert hallsex crimedehumanizationabsurd violencepopsiclesubliminal messagebreakfast in bedhoodlumslangreference to draculafemale psychiatristpixelationgrand theft autobeethovenmultiple loverspsychological tormentphalluscountry homebowler hatlasciviousnessfilm with ambiguous titlegovernment officialenglish countrysideinvented languagered pubic hairwaking up from a comapolitical manipulationhanged childextreme filmflick knifereference to pink floydchild executioneye dropsyouth ganglong underwearclothes torn offshock therapywilliam tell overturecenturionjoyridegraphic nuditypet snakecat ladymanservantdriving in the wrong directionforced to watch rapeholding someone's head underwaterludwig van beethovenmilk bottleunprovoked violencehidden weaponsexual imagerynose bandagecensored rape scenetesticles squeezedwife raped in front of husbandclothes cut offerotic 70struncheonultraviolenceaversion therapybottle smashed over someone's headgang brawltorn pantieslistening to classical musicmoral reformationobjectified womanmen beating defenseless manreformed (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Black Snake Moan (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Black Snake Moan (2006)

In rural Tennessee, Lazarus, a former blues musician who survives by truck farming, finds a young girl nearly beaten to death near his home. She's the white-trash town tramp, molded by a life of sexual abuse at the hands of her father and verbal abuse from her mother, who seems to delight in remindi …ng Rae of her mistake in not aborting her. Lazarus, who is also facing personal crisis at the dissolution of his marriage, nurses Rae back to health, providing her with gentle, fatherly advice as well as an education in blues music. Rae's boyfriend, Ronnie, goaded by the man who nearly beat Rae to death, misunderstands the relationship between Lazarus and Rae, and vows to kill him. Lazarus, exhibiting a street-smart understanding of violence and its motives, calls Ronnie's bluff, senses that he is as troubled as Rae, and becomes a guiding force in the young couple's resurrection. (Read More)

Themes:
abuselovefriendshipmarriagedrugspregnancydrinkingdrunkennessweddingdeceptionseductionangerdrug useredemptioninsanity …illnessfaithexploitationabortiontraumafreedom (See All)
Mood:
nightmarearchive footage
Locations:
kitchenbathtubsmall townbarrestaurantchurchbusrural settingmotelstormsex outsidesex outdoors
Characters:
prostitutehusband wife relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattoosingerboydancermusicianlustbiblecousin cousin relationshipex husband ex wife relationship …pimpu.s. soldier (See All)
Story:
sexual abusewhite trashracial slurcigarette smokingfemale frontal nudityfemale nudityviolencefightnuditybloodbare breastsflashbackdoggunsex scene …kissinterracial sexdancingnipplestitle spoken by charactersingingpartyleg spreadingthree word titlepantiestelephone calltopless female nudityfondlingcryingsongbeatingunderwearfoodslow motion scenedrinkundressingkissingvomitingriflebeertearsanimal in titlecafemarijuanahallucinationprayercolor in titleguitarcleavagebrabandconcertdrug dealermontageeatingprisonerwhite pantieschild abusescantily clad femalecoffeebartenderpublic nuditycursevirginprologuemini skirtattempted rapefarmergardenobscene finger gesturekissing while having sexgaragegirl in pantiespickup trucktopless womansupermarketnipples visible through clothingwoundloss of virginitydressrace relationscaptiveguitaristcaucasianwristwatchnaked womanpreacherrear entry sexgrocery storebloody noseu.s. armyministerkickingsex talknippleanxietyfather figurecigarette lighterthunderstormroseblack eyehealingcapturewedding dressnervous breakdownchainholding handssouthern accentpromiscuous womanfarmingshortstractorchild molestationtemptationfarmhousetrailer homesexual promiscuitycowboy bootspharmacytennesseecoughingreverendtopless girlfeverauto mechanicwoman wearing only a man's shirtnymphomaniacbreastfilm starts with sexsalvationhymnblues musicunwanted kissfirst sexual experiencepool hallbride and groombroken bottleclothing storesex from behindzippo lighterguard dogpanic attackamerican southbarber shopsaying gracepharmacistdrugstoresex act reflected in mirrorsex addictmoonshinenymphomaniahot pantsleft for deadrecovering alcoholicgirl toplessunfaithful girlfriendchurch choirwoman in a bathtubsouthern gothicanxiety attackmultiple loversstomachnaked outdoorsblack man white woman relationshippoor white trashreformradiatorbare breastice bathcorn on the cobrose gardenblues singersexual innuendo in titlewickednessanxiety disorderflower gardenwatchdogvegetable farmheavy machinerysex act reflected in a mirrorchained to a radiatorsex reflected in mirrorsexual hysteria (See All)

Critters (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Critters (1986)

A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.

Subgenre:
black comedycult filmindependent filmsuspenseb moviecreature featuresurvival horrormonster movie
Themes:
home invasionsurrealismmurderdeathlovekidnappingfeardrunkennessescapemonsterdeceptionsupernatural powerparanoiapaniccourage …near death experiencespace travel (See All)
Mood:
satirenight
Locations:
kitchensmall townbarchurchhelicopterbicyclepolice stationfarmpolice carrooftopouter spacebicycle accident
Characters:
mother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralienpriesthostagelittle boy …alcoholicsheriffalien monster (See All)
Period:
1980s
Story:
child swearingredneckeccentriccatcigarette smokingone word titleviolencebloodphotographtitle spoken by characterexplosionknifesurprise endingfirecorpse …shot to deathblood splattercar accidentshot in the chestshotgunrescueslow motion scenewatching tvrifleheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomflashlightambushaxeimpalementtoiletradiochild in perilspaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batlightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail cellspacecraftphone boothlasersocial commentarybroken legeaten alivemechanicwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boymutationlaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All)

The Gift (2000) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Gift (2000)

When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto …p her from constantly getting visions of Jessica's fate. (Read More)

Subgenre:
independent film
Themes:
father daughter incestincestmurderdeathsuicideinfidelityghostjealousyadulteryinvestigationdeceptionextramarital affairdeath of fathersupernatural powerunfaithfulness …mental illness (See All)
Mood:
rainnightmare
Locations:
bathtubsmall townschoolcemeterywaterwoodsrural settingwheelchaircourtroomstormbackwoods
Characters:
single mothermother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshiptattooboylawyerlustwitchsheriffsuicide by hanging
Story:
redneckgrandmotherfemale frontal nuditybare chested malefemale nudityfightviolencef ratedbloodflashbackmasturbationmale rear nuditydogtwo word titlegun …dancingphotographexplosionpartyleg spreadingpantiestelephone callfirebeatingdreamcorpsewatching tvthongbare buttsecretliedead bodysex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarmissing personbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Sweet Hereafter (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sweet Hereafter (1997)

A small community is torn apart by a tragic accident which kills most of the town's children. A lawyer visits the victims' parents in order to profit from the tragedy by stirring up the their anger and launching a class action suit against anyone they can blame. The community is paralyzed by its ang …er and cannot let go. All but one young girl, left in a wheelchair after the accident, who finds the courage to lead the way toward healing. (Read More)

Subgenre:
independent filmfairy tale
Themes:
father daughter incestincestdeathfriendshipinfidelitydrugsbetrayaladulterypregnancydrinkingdrunkennessinvestigationdeceptionrobberyextramarital affair …travelangerdivorcetheftdeath of motherdrug useredemptionguiltgriefunfaithfulnessgreeddeath of wifedeath of daughter (See All)
Locations:
small townbartrainschoolsnowairplanebusairportrural settingwheelchairlakemotelschool busbus driverbus accident
Characters:
sister sister relationshipmother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendsingerlawyerthiefartistnative americancanadiansingle father …stepfather stepson relationshipstepmother stepson relationship (See All)
Period:
1990swinter
Story:
sexual abusevideo footagedrug addictnonlinear timelinefemale nuditysexbased on novelbloodinterviewflashbackfemale full frontal nuditynipplesphotographtitle spoken by character …singingknifethree word titlepantiestelephone callsongbeatingfoodcar accidentcomputerdrinkliedead bodyguitarsurvivalbracandlebandbridgefemale pubic hairwhite pantieschilddrowningpainflash forwardumbrelladebtreadingrabbitdeath of sonsadnesscowgaragesingle parentpickup truckicetv newstealawsurvivorbarnguitaristspiderbuttockslossphone boothcommunitycarnivalwatching televisionmourninghippiecharitydead childcellphonesirenflightmusic bandearphonesbreast feedingmetaphorchild molestationpolaroidstewardesstrailer homelawsuithospital bedcar washdrunkardstrokeadopted sonflight attendantloss of childinsurancewheelchair boundneck braceimplied sexretributionhuman immunodeficiency virus positivecalendarfairbedtime storywelfarefairgroundfrozen lakedeath of a childham radiohospital visittaking off pantieslone survivorlearning disabilitydepositionarts and craftsreverse chronologyexpensive giftschool bandchild drowningspider bitetracheotomyidentifying dead bodystroke victimslut shamingclass action lawsuitnegligencereckoningthroatcanada goosetransmogrificationcollect telephone call (See All)

Lock, Stock And Two Smoking Barrels (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lock, Stock And Two Smoking Barrels (1998)

Four Jack-the-lads find themselves heavily - seriously heavily - in debt to an East End hard man and his enforcers after a crooked card game. Overhearing their neighbours in the next flat plotting to hold up a group of out-of-their-depth drug growers, our heros decide to stitch up the robbers in tur …n. In a way the confusion really starts when a pair of antique double-barrelled shotguns go missing in a completely different scam. (Read More)

Subgenre:
black comedycult filmindependent filmgangster comedy
Themes:
home invasionmurderdeathfriendshipdrugsmoneytorturedrunkennessgangsterrobberyangergambling
Mood:
nightambiguous ending
Locations:
barlondon englandelevatorpolice stationstrip club
Characters:
father son relationshipthieftough guy
Period:
1990s
Story:
child swearingdirectorial debutdrug addictcigar smokinggay slurf wordcigarette smokingbare chested malefemale nudityviolencenumber in titlebloodflashbackfemale rear nudity …surprise endingpistoltelephone callvoice over narrationpunctuation in titlecell phoneshootoutbeatingcorpseshot to deathblood splattermachine gunshot in the chestface slapshotgunslow motion scenepunched in the facethongvomitingrifleheld at gunpointcar crashdead bodymarijuananeighborpianobritishalcoholstrippersubjective camerafoot chasebound and gaggedgangambushdrug dealerbridgechild in perilhit by a carvandrowningbartenderorganized crimecharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on firecharacter's point of view camera shotstorytellingrace against timedebtknocked outsplit screensix word titlethreatened with a knifepubeuropesubtitled scenefreeze framecrime bossmachismoeavesdroppinggolfteahead buttpokermachetecagefriendship between menshot in the stomachfaintingphone boothchefhomicidemasked manduct tape over mouthswitchbladenicknamestealing a carburglaryensemble castcard playingaccidental killingknife throwingcomma in titledrug lordfast motion scenemarijuana jointbag of moneyshot in the neckspit in the faceblack manblack marketstonerstabbed in the armdouble barreled shotgunhanging upside downsawed off shotgunrhyme in titleman punching a womanbased on short filmwalkingkicked in the headcarjackingshot in the footpun in titleboxing ringhiding under a bedreference to james bondantiquecockney accentsmoking marijuanasex shopkicking in a doortrenchcoatcocktailhatchetsmoking potcamera focus on female buttslow motion action scenepublic phonereference to winston churchillsnorricamtelling a jokedrink thrown into someone's faceliverpudliancounting moneypassed out drunkdumb criminalhit with a car doorhit with a rifle buttskull crushingduffel bagreference to snow whitedeliberate crueltyhit with a golf clubthrown through a walltanning bedmob enforcerstrip showcheating at cardspoker playerwad of cashpunch into the camerasevered toeaxe in the backhigh stakesantique gunair rifleliverpool accentgrow opcardsharpdildo used as weaponwall of tv screensfixed gamerhyming slang (See All)

In The Land Of Women (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Land Of Women (2007)

L.A. soft-porn writer Carter Webb is frustrated enough, after his actress girlfriend dumps him, to need a serious break. He decides to spend it with his grandmother, who can't really take care of herself and her Detroit suburb house anyway. Helpful Carter soon overcomes mishaps to bond with the foxy … neighbor across the street and her daughters. Helping them actually helps him regain perspective and self-confidence. (Read More)

Themes:
deathlovefriendshipinfidelityadulteryextramarital affairdeath of mothercancerunfaithfulnessillnessbreak updyingradiation
Mood:
rain
Locations:
kitchenhospitalrestaurantforestlos angeles californiataxiwoodssinging in a car
Characters:
sister sister relationshipmother son relationshipfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipteenage girlteenage boygirlwriteractresswaitressolder woman younger man relationship …grandmother grandson relationshiptalking to oneself in a mirror (See All)
Story:
underage smokingbreast cancergrandmothergay slurcatcigarette smokingflashbackdogkisspartyshowertelephone callcryingcell phonemirror …watching tvcomputersecretletterpaintingvomitingtearscafeneighborwomandinerman with glassesprologuetwenty somethingsupermarketlistening to musicice creamjoggingyogashopping mallfather figurescreenwritershaved headearphonesheartbreakmen's bathroomdetroit michiganmichiganporschedeath of grandmotherraccoonsing alongtaxidermyhypochondriacprecociousnesssplit lipherbfatal illnesscamarofan the personkissing in the rainmastectomyteen partyhypochondriapublic break uprunning into a treecutting one's own hairsoftcore porn filmmaking (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Brimstone (2016) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brimstone (2016)

A triumphant epic of survival and a tale of powerful womanhood and resistance against the unforgiving cruelty of a hell on earth. Our heroine is Liz (Dakota Fanning), carved from the beautiful wilderness, full of heart and grit, hunted by a vengeful Preacher (Guy Pearce) - a diabolical zealot and he …r twisted nemesis. But Liz is a genuine survivor; she's no victim - a woman of fearsome strength who responds with astonishing bravery to claim the better life she and her daughter deserve. Fear not. Retribution is coming. (Read More)

Subgenre:
cult filmindependent filmcoming of agesuspenseepicrevisionist westernanti western
Themes:
father daughter incestabuseincestmurderdeathloverevengesuiciderapereligionghostpregnancydrinkingfeartorture …drunkennessvoyeurismpsychopathbrutalityobsessionterrorismdysfunctional familysadismcrueltyvengeancemadnessreligious fanaticism (See All)
Mood:
rainnight
Locations:
bathtubsmall townchurchsnowdesertwoodsfarmbrothelhotel fire
Characters:
prostitutefamily relationshipsfather daughter relationshipteenagermother daughter relationshipteenage girlteenage boyfemale protagonistgirlchristianvillainbiblesnipersheriffamerican …self mutilationsuicide by hangingreligious fanaticsuicide by drowningself flagellationfather beating daughter (See All)
Period:
winter19th century
Story:
sexual abusenonlinear timelineprostitutionfemale frontal nuditybare chested malefemale nuditysexviolencenuditybloodbare breastsflashbackgunsex scene …female rear nuditynipplesphotographknifefirevoice over narrationcryingshootoutbeatingcorpseshot to deathblood splatterhorseface slapshot in the headshotgunpunched in the facedrinkgunfightbare buttrifleheld at gunpointtearsdead bodyvoyeurreference to jesus christprayerrevolversubjective cameragood versus evilcandlestrangulationstabbingwomanthroat slittingwidowstabbed to deathstabbed in the chestfemale pubic hairchild abuseshot in the legshot in the foreheadduelvirgindangerprologuecowboydollattempted rapehangingstreet shootoutshot in the shoulderscarcountrysidestalkinghorse ridingpigwhippingcult directorstylized violenceeavesdroppinggoldkilling an animalrevelationsociopathsurvivorhatcowboy hatmutilationbarnhidinggaggedvirginitypeeping tompreacherwhiskeyrear entry sextarget practicewhipmuteplot twistthunderstormpedophilebathingdisembowelmentblack eyefogsexy womanperversionabusive fatherhorse and carriagemisogynysign languagepipe smokingshot multiple timesphysical abusemudintimidationsermonblood on camera lensintestinesharassmentmultiple storylinemenstruationpedophiliaspit in the facelocal blockbusterassumed identityhuman monsterpubertyadolescencequick drawsexual perversion13 year oldcowboy boots15 year oldsaloondeputyunsubtitled foreign languageman punching a womanepiloguereverendactual animal killedunderage sexbible versenetherlandsextreme violencesitting on a toiletfacial scarhiding placeoutlaw gangchapter headingsin medias respsychological torturesex with a minornon linearangstretributionoff screen murderhouse firedisturbed individualimmolationincestuous desireman with no namesex from behindwinchester rifletear on cheekchurch servicethroat cutstarts with narrationmultiple time frameshorse drawn carriagesex traffickingpassing outidentity theftmisttraffickingwestern townsexual sadismsexual tortureburning housegutsnaked butttitle based on the biblecowboys and outlawsgallowsman punches a womanbolt action riflelemonadewoman in laborbordellohanged womantarget shootingouthouseexodusbiblical quotewashing clothesnameless characterbountycrime gone awrygenesismenstrual bloodmining townspursabused childunderage girlwoman wearing a toweldead horsewater pumpabused womanabusive parentsaying thank youchapterspistol duelknife in chestfrontier townmute charactertongue cut outbeating with a beltreference to jesusleather glovesfeminist moviestranglinghenry rifleshackledwoman flashingwoman in a bathcall for helpviciousnesschange of identityflagellationamerican westpig slaughterwoman wrapped in a towelout of ammunitionstrangledbloody knifecalvinismbuilding a housedragged along the groundlong range riflenaked female corpseauteur cinemarevenge from beyond the gravegun holsterbag of goldtied handsprostitutesretrograde narrativesnow capped mountainsold into prostitutionwoman hangedcaptive bolt gunchapterwise storytellingknife in stomachbutchering pighog farmsheep farmshepard toneshot in the back of the headtoilet scene (See All)

Don't Be A Menace To South Central While Drinking Your Juice In The Hood (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Don't Be A Menace To South Central While Drinking Your Juice In The Hood (1996)

"Don't Be a Menace to South Central While Drinking your Juice in the Hood" is a parody of several U.S. films about being in the 'Hood', for instance "Boyz n the Hood", "South Central", "Menace II Society", "Higher Learning" and "Juice". We follow Ashtray as he returns to the place he grew up in and  …meet his father and his basket-case friends. Crazy stuff happens. For example, Ashtray is older than his father and his best friend Loc Dog's grandmother is a trigger-happy old lady who blames her eccentric-looking kid for not being tough enough. (Read More)

Subgenre:
black comedycult filmindependent film
Themes:
revengemonstergangsterrobberyracismpoetry
Mood:
breaking the fourth wallsatirespoofparodyhip hop
Locations:
hospitalsex in carsex in public
Characters:
single motherfamily relationshipsfather son relationshipafrican americanfriendsnipercousin cousin relationshipgrandmother grandson relationship
Story:
eccentricgrandmotherracial slurplace name in titlebare chested maleflashbackmasturbationmale rear nudityguninterracial sexpistolbeatingcorpsearcade game …shot to deathmachine gunshot in the chestpunched in the faceshootingheld at gunpointcollegejailalcoholshot in the backgangchild abusesevered headhit by a cartalking to the camerapublic nudityperson on firefantasy sequencekicked in the faceskeletonmissileuziwhat happened to epilogueraprace relationskicked in the stomachrocket launcherhaircutstupiditycameonicknameface paintjob interviewjunkieghettoconvictbody landing on a carlong titlerpgcrude humorframed for murderdesert eaglemarijuana jointreference to elvis presleyimperative in titlecomedy teamfilm starts with textforeplayman punching a womanwheelchair bounddrive by shootingmailmanracial stereotypecardinal direction in titlehoodidiotchild with a gunwoman punching a mancrookgangsta griplaundry drying on clothes lineslangbaptist churchbeepersucking toesdriving testdance offcrashing through a wallmail trucklow riderracist copkilled on birthdaycrash test dummy40 ozreference to whoopi goldbergblack slangracist humorchildren with same mother but different fathers (See All)

Ed Wood (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ed Wood (1994)

Because of his eccentric habits and bafflingly strange films, director 'Edward D. Wood Jr. (I)' (qv) is a Hollywood outcast. Nevertheless, with the help of the formerly famous 'Bela Lugosi' (qv) and a devoted cast and crew of show-business misfits who believe in Ed's off-kilter vision, the filmmaker … is able to bring his oversize dreams to cinematic life. Despite a lack of critical or commercial success, Ed and his friends manage to create an oddly endearing series of extremely low-budget films. (Read More)

Subgenre:
cult filmgay interestb movie
Themes:
lovefriendshipfuneralfilmmakingwrestlingcelebrityhollywooddrug addiction
Mood:
breaking the fourth wallbehind the scenesaffectionbiographical
Locations:
barrestaurantchurchcemeterylos angeles californiabustaxiapartmentghost train
Characters:
friendboyfriend girlfriend relationshipactoractressdirectorfilm director
Period:
1950s
Story:
outcasteccentrictransvestitedrug addictcigar smokinggay slurcigarette smokingcharacter name in titletitle spoken by characterhalloweendeath of friendsuicide attemptcoffintalking to the camerabartender …confessionlightningfilm within a filmhandguncult directornewspaper headlinewhat happened to epiloguegothicheavy rainfriendship between menhollywood californiamovie theaterphone boothblack humoramusement parkblack and whitefilm setfilm producerdressing roomwar veteranwrestlergothstock footagebaptismhomagebus stopstage playmisfitsex changehollywood signmovie studioreverendtransvestismfuneral homeslaughterhousemorphineshowbizloudspeakerguillotinemovie posterfunfairman wearing a wigcigarette holdergender benderreference to frankensteintrick or treatfilm reelfilm premierereference to draculadumped by girlfriendmariachi banddentureschiropractordrug rehabreference to orson wellestheremindirector actor relationshipreference to charlton hestonreference to boris karloffwashed outjacobs ladder (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Salò, Or The 120 Days Of Sodom (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Salò, Or The 120 Days Of Sodom (1975)

Nazi-Fascist Northern Italy, 1943-44. Four senior members of government, aided by henchmen and Nazi soldiers, kidnap a group of young men and women. They hold them for 120 days, subjecting them to all manner of torture, perversion and degradation.

Subgenre:
cult filmtragedy
Themes:
murderdeathsuicidekidnappingrapebetrayaltorturedanceweddingvoyeurismpsychopathbrutalityinsanityhumiliation …mental illnesssadismevilexecutioncruelty (See All)
Mood:
avant gardegoresatireambiguous ending
Locations:
churchbicycleitalycatholic church
Characters:
homosexualityprostituteteenagerteenage girlteenage boyvillainmaid
Period:
world war two1940s
Story:
sexual abuseeccentriclong takegay slurplace name in titlefemale frontal nuditybare chested malefemale nuditysexviolencebased on novelnumber in title …bloodmale nuditymale frontal nuditymasturbationmale rear nuditybondagegunkissfemale rear nudityfemale full frontal nudityinterracial sexdancingnipplesmale full frontal nuditysingingknifelesbian kisserectionpantiesfondlingcryingsongdigit in titleshot to deathunderwearblood splatterurinationface slapshot in the headbare buttbeddead bodypianovoyeurmale pubic hairsubjective cameracandlemansionstabbingthroat slittinghousefemale pubic hairjokescantily clad femaleradiocontroversypainpublic nuditybinocularsstrippingscreamingstorytellingevil manscreamhangingcity name in titlebodyguardtraploss of motherwhippingcross dressingteenage sexpowercloseted homosexualburned alivenipples visible through clothingdresshatmutilationbarefoot malevictimsadomasochismrapistsocial commentarysufferingwhipfascismperversioneye gougingwedding dressdisfigurementstabbed in the eyeroomsodomydead girlpervertmale objectificationhysteriaforced to stripspit in the facedefecationhuman monstersexual perversionsexual violencegun held to headvillamasochismdegradationanal rapefascistmale rapenihilismtransvestismbishopextreme violencemacabregraphic violencechapter headingsmatricidesex with a minorquotationforced marriagecity in titlesexual humiliationmurder victimasphyxiationexcrementfetishismbrandingtortured to deathforkdebaucherysexual sadismsexual torturewaltzsexual crueltybanned filmbiblical referencefilicideplace in titleitalian cinemadehumanizationmealmidnight moviescalpingstabbed in the foreheadinfamyviolent sexperversityscatologysickostab woundmisanthropydeviant sexlibertinecoprophiliajumping from a windowbody mutilationcollectivismtorture deviceextreme filmurophiliabowel movementnotorietyhuman brandingfalling from a windowhyperrealismitalian fascismtongue rippingbarbarismscatforced sexual contactburning fleshfrench cinemabranding ironcoprophagiabroken ruleexcrement eatingmarquis de sadereference to danteeye removalsexual victimmental tortureadult actress playing minoranti nazismdeviant behaviorfake weddingcollectivist societyconga linereference to the marquis de sadesodomwash basinsocial masturbationfeces on faceleather obsessionsalobottom feeder (See All)

Near Dark (1987) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Near Dark (1987)

A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.

Subgenre:
black comedycult filmindependent filmcoming of agesuspense
Themes:
murderdeathfriendshiprevengekidnappingbetrayalfeardrunkennessescapeinvestigationdeceptionpsychopathsupernatural powerredemptioninsanity …sadismunrequited lovehomelessnessmurder of a police officernear death experienceregret (See All)
Mood:
goreneo noircar chasenightambiguous ending
Locations:
small townbarbuspolice stationfarmpolice cartruckmotelgas stationtexasroad moviebus stationshedcar fire
Characters:
family relationshipsfather son relationshippolicefather daughter relationshipteenagertattoobrother sister relationshippolice officerhostagethiefvampirewaitresssheriffpolice shootoutsingle father …truck drivershooting a police officer (See All)
Period:
1980s
Story:
hickchild swearingunderage smokingredneckdirectorial debutcigar smokingf wordcigarette smokingbare chested maleviolencefightf ratedblooddoggun …kissexplosionknifechasesurprise endingpistolfireshootouttitle directed by femalebeatingcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewatching tvgunfightbrawlvomitingshowdownrifleheld at gunpointbeersunglassesrunningrevolvercriminalshot in the backgood versus evilfoot chaseflashlightgangstrangulationmassacrethroat slittingstabbed to deathdinerstabbed in the chestexploding cardisarming someonechild in perilhit by a cardouble crosspolice officer killedvanfemme fataleshot in the legtransformationshot in the foreheadbartenderon the runattempted murderscreaminglocker roomperson on firecowboypay phonefugitiveon the roadproduct placementrace against timemissing persondeath of childfarmermanipulationscaramerican flagexploding bodyhorse ridingneck breakingthreatened with a knifecowarsonfreeze framesingle parentpickup truckmachismoropecard gamebulletburned alivepokerelectronic music scoremass murdergothicshot in the stomachsociopathscene during opening creditscowboy hatbarncountry musicphone boothstrangerhitchhikerhitchhikingbar fightfull moonthuggypsyreverse footagestealing a carstarstabbed in the throathit in the crotchmercilessnesspool tablepunched in the stomachlove at first sightimmortalitypunched in the chestsunjumping through a windowoutlawblood on shirthealingdisfigurementknife throwingsiegepolice raidduct tapefemale directorburned to deathmoral dilemmaflat tiresouthern accentshot through a windowdriftermolotov cocktailveterinarianspit in the faceteenage lovehuman monsterpolice officer shot in the chestsuper strengthjukeboxquick drawstandofftrailer homedouble barreled shotgunburnt facehit by a truckdeputyexploding trucksawed off shotgunone linerwrist slittingbitten in the neckburnt bodykiller childstar crossed loversbadgecuremysterious womankansasrecreational vehiclevending machineshot through a doorgang leaderspray paintmass murdereroklahomainnocent person killednomadcamperchild with a gunstabbed in the mouthlassoblood drinkingcowboy shirtmosquitobandaged handinvulnerabilityblood transfusionbalisongjumping from a carmobile homesunlightwhite horsefreight trainchild uses gunscarred facestar spangled bannerspit takestate troopercrisis of conscienceskull crushinginitiation riteamerican midwestdoomed lovebloodlustsee you in helloil wellcivil war veterantumbleweedwinnebagoblood suckingchild vampireface burntooth knocked outreflection in car mirrorconfederate soldierbutterfly knifecar showroomsleeping in a bathtubdriving through a wallsearch for sontinfoilbullet catchingslashed tiretrain trackrooster crowingspurhit with a flashlightslit wristjumping from a truckchild burningjesse jamesroaming (See All)

My Own Private Idaho (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

My Own Private Idaho (1991)

Mike Waters lives on the street and befriends the somewhat older and streetwise Scott Favor who shows him what is necessary to survive. Waters suffers from narcolepsy and can fall asleep at any moment and in almost any circumstance. Favor comes from a rich family and is rebelling against his own bac …kground. They travel together extensively - Waters is driven by the need to find his biological mother - and spend time in Italy. Later in life however, Favor has joined mainstream society and has little time for his old friend. (Read More)

Subgenre:
cult filmindependent filmcoming of age
Themes:
abuseincestsurrealismmurderdeathfriendshipmoneypoliticsdrinkingdrunkennessfuneralmemoryrobberytheftdeath of father …death of motherpovertydrug usedysfunctional familyguiltgriefsexualitygamblingsadismunrequited lovecrueltyhomelessnesstraumawealthcheatinginheritanceregretpsychological traumanarcolepsy (See All)
Mood:
nightmare
Locations:
bathtubsmall townbarrestaurantchurchhotelcarmotorcyclecemeteryairplanetaxiairportrural settingwheelchairurban setting …farmcityitalyfrancetruckrooftopcampfiregay bar (See All)
Characters:
homosexualityprostitutemother son relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshippoliceteenagerfriendsingerbrother brother relationshipboyteenage boygirl …gay sexpolicemandancerpriestthiefartistbest friendreference to godmaidgermangay teenagerboyfriend boyfriend relationshipgay friendself identityhomosexual kissex teacher (See All)
Period:
1990swinter
Story:
accordionnonlinear timelinegay slurprostitutioncigarette smokingbare chested malefemale nudityviolencesexfightmale nuditythreesomeflashbackmasturbation …doggunkissfemale rear nuditydancingphotographsingingknifechasebased on playcryingsongdreamunderwearhorseurinationwatching tvdrinkcondomundressinglettershootingpaintingliebeertearssunglassesbombbedcafehallucinationmale pubic hairbisexualbedroomwinebandconcertfour word titlecocainepoliticianhousefishmodelpaintercoffinbathsearchjourneygraveyardold womandrowningconfessionlimousinesmokingliaron the roadstorytellingstatuetentrabbitbraceletflowerspursuithairy chestcountrysiderock 'n' rollsadnesssleepingfireworksgraffitieuropetwenty somethingitalianpoemropepornographyteen angstrevelationfaintingrome italytitle based on songbarnstealingsanta claussheephome moviehomecompassionburialhitchhikerstreet lifehitchhikingmental institutionwhiskeybarefootmale prostitutehaunted by the pastsufferingshoesintriguerejectionjunkielosttime lapse photographymale male kissattractiondark pastalienationbonfirehustlerseattle washingtonpervertbisexualityhandshakeporn magazineheartbreaksandwichcartoon on tvnecrophiliagun in mouthmen's bathroomleatherblackoutjukeboxmotel roomtrailer homepopcorncoca colaunconsciousnesspocket watchinfatuationfallingbathrobegigolotravelingteethbroken heartluckhandmale prostitutioncowardoregoncleaningsorrowtraumatic experiencereference to john waynespaghettiportland oregonlocksheltersnoringsquatterdepravityfacesurrogate fatherpreachingsoul matestate name in titleboy girl relationshippassing outsleeping bagmetropolisstreetcarmistreatmentrepressed memorytv show in filmwashington statewine bottlesearchingfrench friesidahobreakdownheartbeattwinkloss of innocencemodern day adaptationeffeminacypastamoral corruptionpsychedeliablack leatherseashellrelativecolosseumshavevagrantemotional breakdownpoker the card gameairplane ticketspeeding ticketpatrolmanrich poorporno shopshakespeare in modern dressconfronting the pastgay magazinedrive in movierandom sexsearch for parentcountry roadgreat plainsfarmlandsound of sexfamily disputemale hustlerold buildingrich fathergay prostitutionscrubbingfalling off a chairrighteousnessboise idahowater basinhome sweet homesafe boxdirty clothesspeed the drugteaching englishfake sexreference to sinead o'connorauto partssex for salegunnysackfaltering friendshiphome on the rangehouse occupationprofession of lovesleeping on a sidewalk (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Straw Dogs (1971)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Straw Dogs (1971)

Upon moving to Britain to get away from American violence, astrophysicist David Sumner and his wife Amy are bullied and taken advantage of by the locals hired to do construction. When David finally takes a stand it escalates quickly into a bloody battle as the locals assault his house.

Subgenre:
cult filmindependent film
Themes:
home invasionmurderdeathrevengemarriagerapedrinkingfeardrunkennessvoyeurismseductionangercorruptionbrutalitysadism …evilalcoholismcrueltytraumahunting (See All)
Mood:
gorenight
Locations:
small townbarchurchcarcemeteryvillagerural settingfarmtruck
Characters:
husband wife relationshipsingerbrother brother relationshipteenage girlwriterbullylustalcoholiccousin cousin relationshipamericanuncle nephew relationshipamerican abroad
Story:
sexual abusedead catmental retardationcigar smokingcatcigarette smokingfemale nudityviolencefightsexbased on novelbloodflashbackdoggun …kisssingingpartyknifepantiesfirecryingsongshootoutbeatingshot to deathunderwearblood splattercar accidentmirrorshot in the chestface slapshotgunslow motion scenecomputerdrinkgunfightshootingrifleanimal in titlebedbathroomvoyeurreference to jesus christprayerfightingcombatscientistsubjective camerabedroomcandlegangold manstrangulationwomanmontageman with glassesbirdscantily clad femalehit by a carcontroversybartenderpaingunshotauthorbeaten to deathfired from the jobmini skirtpassionscreamsensualityspeechpianistcountrysidethreatisolationsadnesstrapratstagepubarsonrecord playerchessmachismoeyeglassesfireplacedestructiondesirenipples visible through clothingmass murdershot in the stomachsexual attractionrecordingragemagicianvandalismhidingdysfunctional marriageaccidental deathlossdesperationfemale singerrape victimhomerapistmexican standoffhomicidesexual desirerampagewhiskeyswitchbladebraveryhypocrisyburglarymercilessnessironybroken glassstairsaccidental killingfogswingknife throwingsiegecaneduckliving roomsexual assaultroomalienationexhibitionismshamedead girlintimidationmagic trickclosetbottlebitternesssexual violencemajorfarmhousebroken windowoutsiderold flameanimal crueltyself defenseanal rapedenialexhibitionistgreenhouseblackboardyuppiegun dueldisappointmentreverendbreaking a windowcarnagechewing gumex conshocksoccer ballshot in the footcar radiogravestonemurder by gunshotchild molesterdead birdcaressblack cathypocriteantiquemasculinityhouse firevillagerpet catarm slingcurtainloss of controlexit woundmissing girlchurch bellpunchingclothes rippingbear traphooliganphonograph recordburnmistreatmentbarricaderesentmenthostilitytricyclevicarsexual crueltyexterminatorgrandfather clockpacifistbreaking glassmathematiciandeath of petsex offendersanctuaryflirtloud musicdartsfinger cutmoral corruptionpacifismrefugekilling a catchalkcornwallteaseariamagistrateparty hatunderage girlcountry homefireplace pokerdefianceskipping ropepeace signprovocationburn injurypathologydestroying propertydart boarddiversionnauseanubile womangirl wearing a miniskirtcomplicitynewton's cradlealetree swingangry wifegun combatmentally challenged manfake nosetimiditychurchyardderanged manfoot blown offhand slapchildish behaviorcut telephone linemaking a scenestalled carimmature adultroof repairrooferworking at homehanged catnoise maker (See All)

Girl, Interrupted (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Girl, Interrupted (1999)

Unable to cope with reality and the difficulty that comes with it, 18 year old Susanna, is admitted to a mental institution in order to overcome her disorder. However, she has trouble understanding her disorder and therefore finds it difficult to tame, especially when she meets the suggestive and un …predictable Lisa. (Read More)

Subgenre:
coming of agemelodramaautobiographicalbased on autobiographycoming of age film
Themes:
father daughter incestincestfriendshipsuicideinfidelitydrugsadulteryescapeextramarital affairracisminsanityunfaithfulnesssexualitymental illnesswriting …self harm (See All)
Mood:
high school
Locations:
bathtubtaxiroad triptaxi driver
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipfrienddoctorteenage girlfemale protagonistnursepsychiatristemployer employee relationshipself mutilationdoctor patient relationshipsuicide by hangingteacher student sex
Period:
1960ssummer of love
Story:
eccentricracial slurf wordcatcigarette smokingbare chested malesexf ratednuditymale nuditymale frontal nuditymale rear nuditybased on true storyvoice over narrationcrying …based on bookbookbirthdayguitartelevisionsuicide attemptchild abusescreamingfired from the jobhangingdiarychickenbirthday cakeshavingteen angstsociopathpatientguitaristhidingpsychologyvietnam warschizophreniamental institutionwatching televisionreverse footagehippiesexismmental hospitalpost traumatic stress disordersocial workerclassmatepromiscuityphysical abusepillfemale bondingadolescenceinsane asylumrazorlollipoprehabilitationrainingbourgeoisieeating disorderintimacymedical professionidentity crisisborderline personality disordermemoircamaraderiedouble standardreference to walt disneyauthorityrich snobpsychiatric wardfemale psychiatristaspirindeliberate crueltymilitary draftbarkingdangerous friendice cream parlorreading bookescape from mental institutionpsychiatric nursecat hissingreference to jan vermeerinstitutional life (See All)

The Cook, The Thief, His Wife & Her Lover (1989) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Cook, The Thief, His Wife & Her Lover (1989)

The wife of a barbaric crime boss engages in a secretive romance with a gentle bookseller between meals at her husband's restaurant. Food, colour coding, sex, murder, torture and cannibalism are the exotic fare in this beautifully filmed but brutally uncompromising modern fable which has been interp …reted as an allegory for Thatcherism. (Read More)

Subgenre:
experimental filmblack comedycult filmindependent filmdark comedyabsurdismallegory
Themes:
surrealismmurderdeathrevengeadulteryescapedancegangsterextramarital affairbrutalitysexualitycannibalism
Mood:
breaking the fourth wallavant gardesatireneo noir
Locations:
kitchenbathtubhospitalrestaurantsex in a kitchensex in a toilet stall
Characters:
husband wife relationshipboythief
Period:
1980sfuture
Story:
cigarette smokingfemale frontal nudityfemale nudityviolencesexmale frontal nuditysex sceneshot to deathfoodurinationshot in the headheld at gunpointbathroom …womanman with glassesanti herochild in perilcontroversyattempted murderdomestic violenceglasseshandguncult directorcheating wifesociopathcookchaosbutcheralternate realitylong titlepublic humiliationsexual assaultalienationabusive husbandsymbolismparking lotdefecationmetaphorfreaknihilismmeat cleaverreading a bookstabbed in the facebritish renaissancehandymanwoman with gunhigh societyexcrementfreezerforkabstract artstray dogwife murders husbandurinating on someonescavengerdog fecesgourmetstabbed with a forkextreme filmclassicscene based on paintingclothes torn offexcrement eatingfood as sex metaphorboy sopranochild tortureall seeing eyeforced eatingrefrigerator truck (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Adam's Apples (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Adam's Apples (2005)

Ivan is a priest in a rural church known for the apples that grow on a large tree in front. He's odd: seeing the world through rose-colored glasses, in denial about personal facts, and convinced he's at war with Satan. The rectory is a half-way house for recently paroled convicts. Adam arrives for 1 …2 weeks, a large, tough neo-Nazi, first baffled by Ivan's thick-headed optimism, then angry. He vows to break Ivan's faith. Meanwhile, in exasperation at Ivan's insistence, Adam sets a personal goal: to bake an apple pie. All goes awry for the tree: crows, worms, lightening. The Book of Job gives Adam perverse insight, and his hooligan mates provide the resolution's spring. (Read More)

Subgenre:
black comedydark comedyallegoryparable
Themes:
murderdeathlovesuicidereligionmoneypoliticspregnancydrinkingfeardrunkennessfuneralmemoryrobberyanger …theftdeath of mothercancerredemptionillnessfaithdeath of wifedyingabortionforgivenessdeath in childbirth (See All)
Mood:
rainsatire
Locations:
hospitalchurchbusbicyclerural settingwheelchairgas stationstorm
Characters:
father son relationshipdoctortattoosingerbrother sister relationshippriestthiefchristianreference to godlittle boyalcoholicbiblepregnant woman
Story:
dead catskinheadtennisreference to adolf hitlerracial slurgay slurcatcigarette smokingbare chested maleviolencecharacter name in titlebloodgunsingingpistol …firecryingcell phonesongbeatingunderwearshot in the chesturinationface slapshot in the headdrinkshootingbooklierifletearsbirthdaytelephoneshot in the backgood versus evilflashlightcookinggangold manweaponchild abusebirdvanshot in the legtreewidowerlightningattempted rapetragic eventcrossgardenex convictterminal illnesskilling an animalhead buttlistening to musicfaintingcrucifixstealingdenmarkaccidental deathpart of trilogycommunityrapistapplemale underwearkickinggunshot woundmiraclearabdeath of sisterconvictpastorsexual assaultcrowsermonparalysisbandagebaptismwalletneo nazishot in the eyelistening to radiowormindonesiapiereverendsense of smellbeliefscarecrowmercedes benzdown syndromefilling stationparoledead wifegodhymnpakistanichild rapedragging a bodybakingblasphemybrain tumoroptimismovenchurch bellbloody facemental disorderhostilitytennis playerthird in trilogysaudi arabiacerebral palsyshot in the kneeorchardtennis racketneo nazismcommunity servicekilling a catapple piecynicear bleedinghalfway houseapple treesuicide of wifeiron crosslightning strikeparishconsidering abortioneggplantreformed alcoholicdaneblackbirdbook of jobm&m'snose bandagereference to goebbelsburning treecough syrupspasticrectoryworm in foodburning oneselfcookerface bandagebaking a pie (See All)

Slither (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Slither (2006)

In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman,  …will try to stop him and the plague of worms generated by the creature. (Read More)

Subgenre:
black comedycult filmb moviecreature feature
Themes:
murderdrunkennessmonstercannibalismmurder of a police officer
Mood:
gorehigh school
Locations:
small townbarswimming poolforestpolice station
Characters:
husband wife relationshipteenagerzombiealienmayorcountry singer
Period:
year 2005
Story:
animal abusedirectorial debuttwinbare chested maleone word titleviolencesexbloodflashbackmale rear nudityphotographexplosionpartypistolcorpse …shot to deathblood splattershot in the chestshot in the headshotgunwritten by directorriflecar crashclassroomdecapitationfoot chasebandimpalementstabbed to deathstabbed in the chestmapsevered headchild in perilhit by a cartransformationshot in the foreheadcharacter repeating someone else's dialoguedomestic violenceexploding bodybasementpolicewomancharacter says i love youcowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controlanimal attackeaten alivealien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchmutationfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flamedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All)

Withnail & I (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Withnail & I (1987)

London, 1969 - two 'resting' (unemployed and unemployable) actors, Withnail and Marwood, fed up with damp, cold, piles of washing-up, mad drug dealers and psychotic Irishmen, decide to leave their squalid Camden flat for an idyllic holiday in the countryside, courtesy of Withnail's uncle Monty's cou …ntry cottage. But when they get there, it rains non-stop, there's no food, and their basic survival skills turn out to be somewhat limited. Matters are not helped by the arrival of Uncle Monty, who shows an uncomfortably keen interest in Marwood... (Read More)

Subgenre:
black comedycult filmindependent filmdark comedyautobiographical
Themes:
lovefriendshipmoneypoliticsdrinkingfeardrunkennesspovertyparanoiadrug useillnessunemploymentforgivenesshuntingwilderness
Mood:
raindarkness
Locations:
kitchenbathtubrestaurantlondon englandrural settingfarm
Characters:
homosexualitymother son relationshiphomosexualfather son relationshippolicefriendpolicemanactorwriteralcoholicjewuncle nephew relationship
Period:
1960syear 1969
Story:
eccentriccigar smokingcatcigarette smokingfightcharacter name in titledogphotographthree word titlevoice over narrationpunctuation in titleunderwearfoodurinationshotgun …drinkshootingvomitingriflebedlow budget filmcafemarijuananeighbortelephonenewspapercookingwinecandlestrangulationdrug dealerfishbathroommatecoffeekeyauditiondollrabbitfarmercountrysideratchickenreference to william shakespearerefugeepubcowtwenty somethingampersand in titleeyeglassesshavingpot smokingteawolfathletemedicinecakeflatulencetv showgoatclockhaircutwhiskeybootsconstruction sitebuddyhippieironymillionaireanxietycard playingthirty somethinglanternbriefsgunfirereckless drivingpillhairdressermen's bathroomtv commercialdrunk drivingfarmhousedegradationcottagetheatre productionurineconservativesoupsense of smellbullbumperfumetelegrampark benchreference to shakespeare's hamletbritish renaissancesleeplessnessstarvingovenglobebaldnesspoachergrungecreekplastic bagheart conditioneeltheatrical agentburnt handrubber glovesplierssleeping on a sofaaspiringinvaliumapronthinnessenglish countrysidewrecking ballsteroidfaithfulnesstearoomwindshield wiperpheasantsharing a bedcidermulti millionairejaguar the carsqualorlighter fluidsherrydrama schoolcamden town londonout of work actorthermostat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Amarcord (1973) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Amarcord (1973)

One year in a small northern Italian coastal town in the late 1930s is presented. The slightly off-kilter cast of characters are affected by time and location, the social mores dictated largely by Catholicism and the national fervor surrounding Il Duce aka 'Benito Mussolini' (qv) and Fascism. The st …ories loosely center on a mid-teen named Titta and his household including his adolescent brother, his ever supportive mother who is always defending him against his father, his freeloading maternal Uncle Lallo, and his paternal grandfather who slyly has eyes and hands for the household maid. Other townsfolk include: Gradisca, the town beauty, who can probably have any man she wants, but generally has no one as most think she out of their league; Volpina, the prostitute; Giudizio, the historian; a blind accordionist; and an extremely buxom tobacconist. The several vignettes presented include: the town bonfire in celebration of spring; life at Titta's school with his classmates and teachers; Aurelio, Titta's father, at his beachfront construction worksite and his and his workmates' encounter with Volpina; Titta's confessions to the priest about his burgeoning sexuality; Aurelio being questioned by authorities about his anti-Fascist leanings; a fantasy sequence at the luxurious Grand Hotel; a family outing with Aurelio's institutionalized brother, Teo; many townsfolk embarking on a sail to witness a marine event passing by their town; an annual car race; Titta's fantasy encounter wit… (Read More)

Subgenre:
cult filmsemi autobiographical
Themes:
surrealismfuneralmemoryblindnesspolice brutality
Mood:
breaking the fourth wallsatirehigh schoolsocial satire
Locations:
bathtubsmall townhospitalbeachhotelsnowmotorcyclefarmitalycatholic church
Characters:
prostituteteenage boyphotographercatholicolder woman younger man relationship
Period:
1930s
Story:
multiple narratorsmental retardationaccordionnonlinear timelinefemale nudityone word titlemale nudityflashbackmasturbationdancingnipplesvoice over narrationurinationnunlooking at the camera …talking to the camerafantasy sequencebuxomactor playing multiple rolesprankloss of motherflatulencecrushladderfestivalpicnicmental institutionmovie theatreconstruction sitegrandfathernostalgiafogfascismbonfirewedding receptionsocialismblackoutconfessionalsailboatnihilismbullrallyclimbing a treefamous scoreharemfart jokesexually aggressive womanfirecrackerstreet vendornobilitysnowball fightautomobile racingsheikocean linerconcubinepeacockbell towerextended familyreference to gary cooperitalian fascismbizarre comedyunreliable flashbackplaying with foodmussolinigroup masturbationunreliable narrationbricklayerbenito mussolinilarge ladycrazy uncle (See All)

Clerks (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Clerks (1994)

Dante Hicks is not having a good day. He works as a clerk in a small convenience store and is told to come into work on his day off. Dante thinks life is a series of down endings and this day is proving to no different. He reads in the newspaper that his ex-girlfriend Caitlin is getting married. His … present girlfriend reveals to have somewhat more experience with sex that he ever imagined. His principal concerns are the hockey game he has that afternoon and the wake for a friend who died. His buddy Randal Graves works as a clerk in the video store next and he hates his job just about as much as Dante hates his. (Read More)

Subgenre:
black comedycult filmindependent filmvideo
Themes:
deathfriendshipmoneyjealousydrinkingfuneralangerbreak uppsychological trauma
Mood:
satirenight
Locations:
carrooftop
Characters:
friendboyfriend girlfriend relationshipex boyfriend ex girlfriend relationshipself doubt
Period:
1990s
Story:
anti socialunderage smokingdirectorial debutlong takegay slurf wordcatcigarette smokingone word titlesexfightdogphotographtitle spoken by character …telephone callpunctuation in titlewritten by directordrinksecretlierunningbedlow budget filmbathroomfightingtelephonenewspaperbedroomold manhousejokebrunetteman with glassesjeansargumentkeysuburbwritten and directed by cast memberreadingcult directornewspaper headlinetwenty somethingperiod in titlerevelationdesirestreetdresseggfriendship between menragewatching a moviemagazineproduced by directorhome moviedriving a carmilkembarrassmentstupidityshopliftingnew jerseymisunderstandingironyconvenience storesex talkballfat manfrustrationblack eyesurprisedead manfriendship between boysone daysalesmansexual humorinsultcoinhockeysurprise after end creditst shirtjoypractical jokevideo tapepetconfusionporn magazinefire extinguisherpromiscuous womaninsecuritynecrophiliaspit in the facelong hairvideo storedoubtsarcasmmale friendshipbitternessdisappointmentimmaturitywrathresponsibilityvhsshirtmistakereading a newspaperdisillusionmentsilencereference to star warsdialogue drivenblack catwatching a videoscatological humortalking about sexclumsinessgrudgetoilet paperclerkworkplacedonutvideo cassettequestionemployeesidewalksigncapmorninggeneration xsnowballhostility16mmlazinessbubble gumstore clerkvhs tapesexual jokehockey playertrousersamateur filmirresponsibilityguidance counselorscatologyuncertaintydisgruntled workervideo store clerkpornographic videodisrespecthockey gameconvenience store clerkchild smokingenergy drinkeveningfoolishnesssleeping on the jobamateur filmmakerdisgruntled customerreading a magazineroller bladesafternoonargument between couplecomplainingslurstar wars referenceshop windowamateur filmmakingtirednessawakened by phonelow paid jobemotional shockinsolencepressure at workamateur directorjay and silent bobpersonal responsibilityabsence from workindiscretionlack of responsibilityhating one's jobshoe polish (See All)

Tideland (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tideland (2005)

Pre-teen Jeliza-Rose's parents are hopeless drug addicts. When pa, rocker Noah, finds ma's OD'd, he fears to be charged with homicide and takes Jeliza along to his ma's place, in a desolate country region. With Noah passed out, the girl mentally transfers to a fantasy world she and her doll heads en …ter magically. Jeliza's adventures also star the crazy locals, notably Dell, and Dell's grown but intellectually disabled brother Dickens. (Read More)

Subgenre:
cult filmindependent filmfairy taledark fantasybased on fairy talemodern fairy tale
Themes:
abusesurrealismdeathpregnancydrinkingfearlonelinessdeath of fathersupernatural powerdeath of motherdrug usedysfunctional familyinsanitymental illnessdeath of wife
Mood:
avant gardenightmare
Locations:
kitchenbartrainbusrural settingfarmsubmarineschool bus
Characters:
family relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipsingerboybrother sister relationshipgirlmusicianreference to godgrandmother granddaughter relationshipfrench kiss
Story:
mentally handicapped personmental retardationdead fathereccentricdrug addictcigarette smokingsexbased on novelbloodflashbackkissphotographexplosionsinging …knifefiresongbeatingdreamcorpsefoodmirrorurinationdrinksecretfalling from heightpaintingbookvomitingriflesunglassesrunningbeddead bodypianohallucinationprayerguitarswimmingorphanflashlightbandstabbingeatingrock bandchild in perilritualunderwater scenevoice overtreescreamingpuppetfantasy sequencestorytellingsuitcasedollreadingrabbitdomestic violencescarwigcrossrock 'n' rollisolationloss of fatherloss of mothersleepingcult directorheroinheart attackflirtingpickup truckhypodermic needletalking animalfaintingguitaristdenmarkdrug abuseflatulencesharkskullfalse identitypeeping tomdrug overdoseimaginationrock concertinnocenceshoeswhipjunkiemakeupdynamiteatticlipstickshadowalternate realitywedding dressfamily dinnerlanternfieldpumpkinshaved headbrainsouthern accentminingface maskdinner partymummynecrophiliapedophiliastuffed animalold dark houseeyeabandoned housebeebugfarmhousetween girlsquirrelimaginary friendwhisperinglistening to a radioelectric guitaranttrain trackstrain ridepieseizurecleaningfart jokerock musicianheroin addictaltarman childepilepsyclose up of eyedelivery boyalice in wonderlandwingspillow fightchildhood sweetheartrocking chairwagondutch anglecar wreckdecomposing bodymirror ballpassenger traintreasure chestapplying makeuptaxidermylemonademousetrapprairiefireflygrave diggerpinatapeanut buttershooting uplobotomyspider webcandy bardissectiontrain wreckpretendinggeesechild neglectphalluswatchingapple piereference to alice in wonderlanddesecrationembalmingdeath by overdosetrain derailmentwonderlandtransistor radioexploding trainfeather boajutlandtalking dollreference to barbie the dollscrubbingalonenessplaying dress upshotgun shellurinating on the groundburritodead treerabbit holebroken dollpillow feathersspasticdoll's headribcagehead scarlightning bugcrushed skullfalling off a bedswim fins (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Kalifornia (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kalifornia (1993)

Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)

Subgenre:
cult filmindependent filmpsycho thrilleramerican horror
Themes:
murderdeathkidnappingrapetorturetheftpsychopathinsanitysadismevilphotographywritingmurder of a police officerrape and murder
Mood:
goreneo noirslasher
Locations:
barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car
Characters:
policeboyfriend girlfriend relationshipwriterhostagewaitresskillervillainterrorslasher killerchinese foodserial murderershooting a police officer
Story:
hickwhite trashredneckgay slurcigarette smokingbare chested maleone word titlefemale nuditysexfightviolencenuditybloodmale nuditymale rear nudity …gunphotographtitle spoken by characterpistolshot to deathblood splattercar accidentshot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upjournalistcaliforniastabbed to deathnarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilemurdererkillingarsonmaniactape recorderragemutilationstabbed in the stomachpsychovictimrape victimrapistmale underwearrampagetensionstabbed in the throatgash in the facedark humorbutcherblack brabilliardsperversionrainstormbody countsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertserial murderpsychopathic killerbad guymadmankillpistol whiphuman monsterpolice officer shot in the chestsexual violencehomicidal maniacknocked unconscioushillbillyyuppietrailer parkcactusgraphic violencehit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendlunaticsadistic psychopathmass murdererbreaking a bottle over someone's headbutcherycrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistpsycho terrorexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettingbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All)

Rumble Fish (1983) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rumble Fish (1983)

Rusty James is the leader of a small, dying gang in an industrial town. He lives in the shadow of the memory of his absent, older brother -- The Motorcycle Boy. His mother has left, his father drinks, school has no meaning for him and his relationships are shallow. He is drawn into one more gang fig …ht and the events that follow begin to change his life. (Read More)

Subgenre:
coming of agefish out of waterteen movieerotic fantasy
Themes:
youthmurderfriendshipdrugsghostjealousydrunkennessrobberydrug usedatingbreak upalcoholismtraumaphilosophynear death experience …obsessive compulsive disorder (See All)
Mood:
neo noirhigh school
Locations:
barbeachtrainmotorcyclebuspolice carseaoceanschool busfire escapeschool secretary
Characters:
sister sister relationshipfamily relationshipshusband wife relationshipfather son relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipteenage girlteenage boyteachergirlpolice officerpolicemantough guy …best friendlittle girlalcoholicself destructioncheating on girlfriend (See All)
Story:
loserjuvenile delinquentunderage drinkingdrug addictf wordcatcigarette smokingfemale frontal nuditybare chested malefemale nudityviolencefightbased on novelbloodmale nudity …male rear nuditydogtwo word titlephotographtitle spoken by characterpartyknifepantiesbeatingdreammirrorpunched in the faceanimal in titledead bodyvoyeurclassroomorgyflashlightgangstabbingbridgecocainedinerfishanti herobirdgunshotstabbed in the backattackfantasy sequencedeath of brothertragic eventhigh school studentgiftdeath of soncharacter says i love youobscene finger gesturegraffitiheroinhatemachismonerdteen angstbreaking and enteringwounddrugcagefriendship between mengroup of friendsloss of frienddrug abusemagazinekicked in the stomachbuttocksvisitteenage protagonistcarnivalinterracial friendshipbikerwatching televisionthugstupidityswitchbladenicknamebreakupblood on faceburglaryloss of sonconvenience storejunkiebilliardsslackerhomoeroticismexistentialismgrowing uptank toploss of brothermelancholymale objectificationbarking dogbreak infighterhigh school teacherstreet gangspiral staircasesnorting cocainedrunken manmale friendshipmotorbikebroken windowfish tankgang violenceblood stainschool principalstreet fightbreaking a windowretrobleedingrespectmuggingdisillusionmentidolmurder by gunshotdance sceneheatseductive behaviorundressing someonetraumatic experiencemasculinityhopelessnesswet clothesdeath by gunshotheadmasterfeet on tablephilosopherjuvenile delinquencypool hallabsent motherfairman with no nameseductive womandrinking from a bottlebird cageselfish womanfunfairpassive aggressive behaviorpassive aggressive womanrole modelerotic dreamfemale objectificationbarefoot womanvideo arcadedelinquentbreaking a car windowblack & white to colorfantasizingdopegang warfarepet shopflying man21 year oldvulgar languageout of body experienceestranged wifebreaking indrinking problempet storereference to robin hoodshop ownermurder by shootingchange in lifestylecaged birdexpelled from schoolbrat packestranged motherwrong side of the tracksdeath of family memberheavy smokerviolent behaviorlast wishboyfriend girlfriend conflictriding a motorbikelife lessontruancyriding a motorcycleviolent manbare feet on tableclimbing a wallgreasertulsa oklahomaweeping womanman wearing underwearweeping manbarefoot manexistential crisisanger issuescolor element in black and white filmmalingerertruanttaking notesbroken car windoweye contactpocket mirrorabsent wifejealous ex boyfriendlost causereference to the pied piperaggressivenesshomoerotic friendshipclinical deathfemale voyeurnerdy boyschool truancyselfish motherweeping girlclimbing down a walldisinfecting a woundhydrant (See All)

Cop Land (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cop Land (1997)

Sometime in the 1970's, police officers from New York City wanted a safe haven to live, away from the dangers of the streets of New York City, this is when they established a "Cop Land" in the small New Jersey town of Garrison. Freddy Heflin who was always admired by the New York cops wanted to beco …me one, but because he was deaf in one ear this prevents him from achieving his goal, but has become sheriff of Garrison. Recently there have been a dark omen surrounding the NYPD, and Freddy is now investigating on this case, then Internal Affairs officer Mo Tilden is also on the case and asks Freddy for help, but Freddy could not. Now Freddy suspects that a New York City cop named Ray Donlan might be one of the many cops who is corrupted by the mob and other criminals. Now, Freddy must find a cop who is nicknamed "Superboy" who can testify against Donlan and protect him, before Donlan finds Superboy and kills him. (Read More)

Subgenre:
cult filmindependent filmconspiracy
Themes:
home invasionmurderdeathsuicidekidnappingmarriageinfidelityjealousyadulteryfeardrunkennessescapefuneralgangsterhero …investigationextramarital affaircorruptionbrutalityparanoiamafiaunfaithfulnessjusticecouragepolice brutalitymurder of a police officerpolice corruptionunlikely hero (See All)
Mood:
goreneo noircar chasedarkness
Locations:
small townnew york citybarswimming poolforestcemeterywoodspolice stationpolice carrooftopstrip clubfire truckcar in a lake
Characters:
husband wife relationshippoliceafrican americanpolice officerdetectivepolicemanpriesthostagelawyertough guylove trianglepolice detectivesheriffex husband ex wife relationshipuncle nephew relationship …mayorpolice shootoutpolice chaseaunt nephew relationshipdeafnesspolice funeral (See All)
Period:
1990s
Story:
loserdirectorial debutdrug addictracial slurcigar smokinggay slurf wordcigarette smokingone word titleviolencebloodinterviewflashbacktwo word titlegun …photographtitle spoken by characterpartychasesurprise endingpistolbased on true storyfirevoice over narrationshootoutbeatingcorpseshot to deathblood splattercar accidentshot in the chestshotgunrescueslow motion scenepunched in the facearrestgunfightfalling from heightshowdownlieheld at gunpointbeercar crashhandcuffsrevolvermanhattan new york citystrippershot in the backfoot chaseflashlightambulancedeath of friendbridgecocainedinermapno opening creditsunderwater scenepolice officer killednews reportdrowningbartenderon the runattempted murderone against manyorganized crimedangersuburbpay phoneproduct placementcover upshot in the shouldermanipulationpursuitthreatdeath of husbandsadnesspolicewomansuspicionnewspaper headlinearsoncorrupt copblack americancrime bossmachismouzisabotageshot in the stomachjail cellwalkie talkieworking classkicked in the stomachpress conferenceskateboardfaked deathhonorcarnivalgun battlepresumed deadcrime scenereverse footagehaunted by the pastbraverynew jerseyitalian americanpunched in the stomachconvenience storejunkiefalling to deathdark heroaerial shotdeerturtletough coplonertragic heroethnic slurdead woman with eyes openworld trade center manhattan new york cityburned to deathnewspaper clippingpipe smokingmedia coveragefirefightermob bossheroismex coptestimonyabandoned housejukeboxquick drawparamedicaccidental shootingnewspaper articledeputyferris wheelcarnagedomestic abusemaverick copfight the systemoverweighttimes square manhattan new york citymafia bossbadgefemale copcomebackdistrustdirty coprescue from drowningheroic bloodshedcrime investigationblack copsocial decaycity hallexit woundinsurance fraudslow motion action scenefalling off a roofrookie copfairgroundnypdpinball machineconspiracy theoristjumping off a bridgewater towerinternal affairspolice vigilantismdartcounsellorbomb squadplaying against typeplanting evidencefictional townmedia hypetinnitushudson riverparking meterear bleedingdartboardnose bandageitalian american copcrashing into a cargeorge washington bridgepartial deafnessjunkie copsideswiping a car (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Goodfellas (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Goodfellas (1990)

Henry Hill might be a small time gangster, who may have taken part in a robbery with Jimmy Conway and Tommy De Vito, two other gangsters who might have set their sights a bit higher. His two partners could kill off everyone else involved in the robbery, and slowly start to think about climbing up th …rough the hierarchy of the Mob. Henry, however, might be badly affected by his partners' success, but will he consider stooping low enough to bring about the downfall of Jimmy and Tommy? (Read More)

Subgenre:
cult filmheistepiccrime epic
Themes:
murderfriendshiprevengeinfidelitydrugschristmasbetrayaladulteryprisonweddinggangsterdeceptionrobberyextramarital affairanger …psychopathbrutalityparanoiamafiaunfaithfulnesspolice corruption (See All)
Mood:
breaking the fourth wallgoreneo noir
Locations:
hospitalnew york citybarrestauranthelicopternightclubairportwheelchaircourtroom
Characters:
mother son relationshipfather son relationshipmother daughter relationshipbrother brother relationshipserial killertough guyjewishhitmanpolice surveillancejewish wedding
Period:
1980s1970s1960s1950s
Story:
multiple narratorsjuvenile delinquentactor shares first name with characterlong takeracial slurnonlinear timelinecigarette smokingone word titleviolencebased on noveltitle spoken by characterbased on true storyvoice over narrationcrying …beatingcorpseblood splattershot in the chestface slapshot in the headarrestvomitingrevolvershot in the backcleavageassassinstabbingdeath of friendcocainedinertoilettrialscantily clad femaledouble crosslooking at the cameralatex glovesorganized crimepay phonekicked in the facedomestic violencebusinesstragic eventarsonfreeze framemaniacmachismowhat happened to epiloguenipples visible through clothingpokershot in the stomachbabysitterred dresstold in flashbackvandalismphone boothbrooklyn new york citybar fightdrug dealingcameoconfrontationitalian americansmugglingzoodark humorshot in the facedeath threatshoppingstabbed in the headsexual harassmentliondead maninsultabusive fatherextortiongrowing upethnic slurwedding receptionirish americankillpistol whiphead blown offfirearmtalking to cameragang violencemale protagonistcontrabandshot in the footgraphic violencepostmandumpsterin medias resmailmaninformerfirst person narrationrise and fallwitness protectionmob violencemob hitfake commercialdamagefrozen bodyexhumationtoupeegangster bosspastaperson in car trunkreference to elizabeth taylorcold blooded murderwitness protection programreal life mother and daughter playing mother and daughtershallow gravedouble datecosa nostraitalian foodjewesstampa floridaprison visitationdolly zoomdrug enforcementreference to sammy davis jr.interfaith marriagepov shotstood upfirearm pointed at the cameraracial commentcopacabanafoot blown offfrozen corpsereference to nat king colevertigo shotpolice choppershot at the cameracold openmeat truck (See All)

Monster (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Monster (2003)

The true story of serial killer Aileen Wuernos who was convicted of luring men to their death and eventually executed in 2002. In 1989, she was working as a prostitute and finally makes a friend when she meets and begins a relationship with a young woman, Selby. Determined to straighten out her life …, she tries to find legitimate work but with little education and limited social skills, she fails at every turn. She starts working as a hooker hitching rides along the local interstate highway and after robbing a few clients has an encounter with a vicious client whom she kills in self-defense. After that however she just takes to killing clients taking their money and car. Once arrested she claims self-defense but is eventually convicted. (Read More)

Subgenre:
tragedy
Themes:
murderdeathloveinfidelityrapemoneyadulteryprisonlesbianismdrinkingdrunkennessrobberyextramarital affairtheftdeath of father …depressionunfaithfulnesshumiliationexecutionsuicide of father (See All)
Mood:
rain
Locations:
barbeachrestaurantchurchbusbicyclewheelchairpolice stationcourtroommotelgay barcar theftcar on fire
Characters:
sister sister relationshipprostitutemother son relationshiphusband wife relationshiphomosexualfather son relationshippolicefather daughter relationshipmother daughter relationshiptattoobrother sister relationshipteenage girlteenage boyfemale protagonist …girlserial killerpolicemanlawyerthiefchristianreference to godkillerself hatred (See All)
Period:
1990s2000s
Story:
sexual abuseohioredneckracial slurprostitutioncigarette smokingone word titlefemale nudityviolencef ratedbloodgun …sex scenekissnipplestitle spoken by characterlesbian kisspistolshowerbased on true storyvoice over narrationcryingtitle directed by femalebeatingdreamcorpseunderwearfoodcar accidentface slapwatching tvdrinkarrestshootingvomitingliebeertearsbedcar crashdead bodyhandcuffsrevolvertelephonewinewomaneatingdinerchild abusedrivingjudgetrialpolice officer killedbartenderliaron the roadu.s. presidentattempted rapecourtcrossthreattied uphandguntv newsfloridarape victimburials&mfemale killerhitchhikingwhiskeyhookerattorneymobile phonejob interviewkickinghungerdeath threatmiami floridamakeupamusement parklesbian couplepedophilehighwayundercover copraised middle fingerbroken armsexual assaultkilling spreepajamastriple f ratedveterinarianpistol whiphead woundtrue crimejukeboxsexual violencenaivetycoca colajuryflasknewspaper articledeath rowfactory workerbaseball capferris wheelmailboxdeath penaltyhandcuffedroller skatingcop killerdeath sentencecapital punishmentfemale criminalstutteringwetnessstarvingfreewayvietnam war veteranflashingcourthousemoney falling through the airtruck stopborderline personality disorderhair dryerfemale serial killerevangelicalvillainess played by lead actressegoismmisanthropesex crimehandcuffed womanautomobile accidentdefense attorneymisandryprosecutionlesbian loverabused womanlesbian slurmurder confessioncarnival ridebailiffroller skaterfelonyunderpassarm in a castflorida keysbiker barrollerskating rinkfinger up anuswomen's restroomtorture threatburning a carressentimenttruck stop prostituteself storagedaytona beach floridatape recorded confession (See All)

Dogtooth (2009) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dogtooth (2009)

Three teenagers are confined to an isolated country estate that could very well be on another planet. The trio spend their days listening to endless homemade tapes that teach them a whole new vocabulary. Any word that comes from beyond their family abode is instantly assigned a new meaning. Hence 't …he sea' refers to a large armchair and 'zombies' are little yellow flowers. Having invented a brother whom they claim to have ostracized for his disobedience, the uber-controlling parents terrorize their offspring into submission. The father is the only family member who can leave the manicured lawns of their self-inflicted exile, earning their keep by managing a nearby factory, while the only outsider allowed on the premises is his colleague Christina, who is paid to relieve the son of his male urges. Tired of these dutiful acts of carnality, Christina disturbs the domestic balance. (Read More)

Themes:
father daughter incestincestdeathmoneyfeardancedeceptionparanoiadysfunctional familymental illnesssadismcruelty
Locations:
bathtubswimming poolcarairplane
Characters:
sister sister relationshipprostitutemother son relationshipfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipsingerbrother sister relationshipteenage boydancerhostagesecurity guard …fatherself mutilation (See All)
Story:
dead cattwinprostitutioncatfemale frontal nuditybare chested maleone word titlefemale nudityfightsexviolencenudityblood …male nuditybare breaststhreesomemale frontal nuditymasturbationmale rear nuditydogsex scenekissfemale rear nuditydancingtitle spoken by charactermale full frontal nuditysingingpartyknifeerectionpantiestelephone calltopless female nuditylickingcryingsongbeatingdreamunderwearblood splatterfoodmirrorface slapslow motion sceneundressingbare buttsecretpaintingbooklietearsrunningbedpianomale pubic hairguitarcompetitiontelephonemenage a troisvideo camerawomaneatinghousefemale pubic hairfishchild abusebathritualunderwater scenesearchpantyhosestrippingscreamingliarfactoryreadingscreamflowersscarpianisthairy chestfilm within a filmbrothergardenblindfoldsleepingrecord playertopless womaneyeglassesapplausegamekilling an animallooking at oneself in a mirrorcakelistening to musictape recorderrecordingexercisehammerplanetvideotapebarefoot maleswimsuitbrother sister incestsharkhome movieteenage protagonistsocial commentarymale underwearsubmissioncelebrationrear entry sexboxer shortsblood on facegreecehit on the headsibling rivalrysuperstitionknife fightalternate realitylooking at self in mirrorfamily dinnerunsimulated sextrophyalienationolder woman younger man sexexplicit sexceremonypiano playermale objectificationsexual awakeningearphonesbarking doggategreekdead animalfencefilm in filmvacuum cleanerguitar playingmasochismsex educationfantasy worldman in swimsuitmercedes benzperfumeslappinggame playingwatching a videotaking off clotheshit with a hammersaltshared bathignorancecreationismpencildressingspeedowedding anniversarykeyboardwalkmanhide and seekvcrguard dogsex with socks ontoothsister sister incestreference to frank sinatrabody part in titleperson in a car trunkbottled waterfemale objectificationheadbandcountry estateorange juicecprharpoonneurosisoverprotective fatherdictionarydobermankeyholefake bloodlooking through a keyholeknife attackperson in car trunktouching someone's breastskilling a cattaking off pantstaking off underwearseclusiondog traininggarden shearserect penismale bare feetbrother sister sexdoor lockbarkingthrowing a rockwashing a carisolated housecar washingcartwheelwatching a porn videoanestheticblood on handarm woundface woundhiding in a car trunktoy airplaneattacked with a knifedog trainerholding one's breath underwaterartificial respirationdeath of catsocial isolationtape measurepost punksleepmaskstomachachenordicmemorizationwatering a planthair gelpolishing shoesswimming gogglesstickermouthwashanother planetdog cagelistening at a doorfemale security guardarm bandageisolationismclipping toenailsmisinformationbroken toothpretending to drownarm cutcutting one's armhome securitybreath holding contestlearning to fightmutilated doll (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Pink Floyd: The Wall (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Pink Floyd: The Wall (1982)

The movie tells the story of rock singer "Pink" who is sitting in his hotel room in Los Angeles, burnt out from the music business and only able to perform on stage with the help of drugs. Based on the 1979 double album "The Wall" by Pink Floyd, the film begins in Pink's youth where he is crushed by … the love of his mother. Several years later, he is punished by the teachers in school because he is starting to write poems. He slowly begins to build a wall around himself to be protected from the world outside. The film shows all this in massive and epic pictures until the very end where he tears down the wall and breaks free. (Read More)

Subgenre:
cult filmadult animationrock musical
Themes:
youthsurrealismdrugsrapeadulteryweddingdeath of fatherdepressioninsanitygriefpoetrypolice brutality
Mood:
avant gardegorenightmare
Locations:
trainschoolswimming poolhotelcarlos angeles californiaenglandcatholic churchtrain tunnel
Characters:
mother son relationshiphusband wife relationshipdoctorteacherself mutilation
Period:
world war two
Story:
anti socialskinheadracial slurnonlinear timelinecatviolencesexbloodmale nudityflashbacktelephone callfirewatching tvmask …rock musichallucinationcolor in titletelevisionname in titlejudgetrialpuppetfantasy sequenceprankcourtcrossisolationsadnessloss of fatherratflowerriotshavingdestructionbullethammerpart animationrock starremote controlrock concertplaygroundhippieanimated sequencebackstagebigotrycartoon on tvcorporal punishmentvery little dialoguefemale genitaliawallneo nazipsychedelicmegaphonescorpionwormpart live actionair raidbritish renaissanceangstgroupiemiserygroup name in titlesome scenes animatedlootingbrickconformitygallowsleafmidnight movieanti conformityprogressive rockpart animatedneo nazismanti fascismoverprotective motherpsychological tormentdead ratphallustraumatic childhoodanti racismmeat grinderanti authoritybased on albumhallucinogenic drugrock operajukebox musicalwindow smashinggenital monstergenitalsinsane mankangaroo courtpink floydanimated segmentsphantasmagoriaabusive teacheranti nazismbody shavingtalking vaginatelevision smashingtalking anus (See All)

Chinatown (1974)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Chinatown (1974)

JJ 'Jake' Gittes is a private detective who seems to specialize in matrimonial cases. He is hired by Evelyn Mulwray when she suspects her husband Hollis, builder of the city's water supply system, of having an affair. Gittes does what he does best and photographs him with a young girl but in the ens …uing scandal, it seems he was hired by an impersonator and not the real Mrs. Mulwray. When Mr. Mulwray is found dead, Jake is plunged into a complex web of deceit involving murder, incest, and municipal corruption all related to the city's water supply. (Read More)

Subgenre:
black comedycult filmsuspenseconspiracypolitical conspiracy
Themes:
home invasionincestmurderdeathfriendshipmoneybetrayalpoliticsadulteryfeartorturedrunkennessgangsterinvestigationdeception …extramarital affairracismcorruptionbrutalityparanoiadysfunctional familysurveillance (See All)
Mood:
neo noircar chasenight
Locations:
bathtubbeachrestaurantlos angeles californiadesertwaterapartmentpolice stationfarmofficerooftopmexicousayachtfollowing someone in a car
Characters:
sister sister relationshipfamily relationshipshusband wife relationshippolicefather daughter relationshipmother daughter relationshippolice officerdetectivehostagelawyerhitmansecurity guardpolice detectivemaidsecretary …employer employee relationshipmayorpolice chasefishermanengineercoronerchinese american (See All)
Period:
1930s
Story:
long takeracial slurplace name in titlecigarette smokingbare chested malefemale nudityone word titleviolencefightmale nudityphotographtitle spoken by characterknifesurprise endingpistol …showertelephone callbeatingcorpseshot to deathfistfighthorsecar accidentshot in the chestface slapshot in the headrescuepunched in the facecamerabrawlsecretshowdownrifleheld at gunpointcar crashdead bodyinterrogationhandcuffsrevolvertelephoneshot in the backambushmansionwomanbridgewidowmapfalse accusationanti herofishingdouble crossfemme fataledrowningattempted murderbinocularscharacter repeating someone else's dialogueprotestcover upevil manknocked outfarmerdomestic violenceconvertibletragic eventthreatpremarital sexsuspicionthreatened with a knifeshot in the armhandgunnewspaper headlinehenchmanprivate detectivescandaleyeglasseseavesdroppingshavingsabotagevandalismmorguekicked in the stomachnosebleedimpersonationrape victimfollowing someonescammexicanthugcrime scenehaunted by the pastswitchbladeimpostormillionaireplot twistrowboatescape attemptaquariumbutlerpunched in the chestdark heroautopsyaccidental killingwisecrack humordisfigurementdark pastlieutenantloss of husbandethnic slurmelancholypolitical corruptionprivate investigatorsouthern accenttaking a photographdirector cameoex copset uphomageassumed identitybarbergardenerreal estatelawsuitretirement homeknocked unconsciousshot in the eyepocket watchkiss on the lipsgreat depressiondambusiness cardman kills a womanpalm treealtered version of studio logopondfamous scoreorchestral music scoretragic pasttragic endingdistrustchinatownimplied sexbarbershopfade to blackfamous linetrespassingtycoonsocial decaycocktaildroughtman slaps a womansecret pastbarber shopcity hallorangegovernment corruptionprotective malebloody facecrutchcorrupt businessmansnoopingobituarytelling a jokebeaten uphidden truthlandownerscapegoatorchardends with deathcaught in a liedishonestypolitical cover upmystery womancity councilincestuous relationshipjazz scoremusic score features pianoyawningreservoirsad endingnaked dead mansevered noselos angeles storm drainhard boiledshocking truthphoto labtelephoto lenschinatown los angelessalt waterreference to confuciusmale slaps femalenose bandageyawnbandaged nosewater rightskilled in a carlighting cigarette for womanlos angeles riverco worker co worker relationshiphall of recordsreal estate fraudshot while trying to escapecatalina island californiahanging up without saying goodbyecatalinareal estate scam (See All)

American History X (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American History X (1998)

Derek Vineyard is paroled after serving 3 years in prison for brutally killing two black men who tried to break into/steal his truck. Through his brother, Danny Vineyard's narration, we learn that before going to prison, Derek was a skinhead and the leader of a violent white supremacist gang that co …mmitted acts of racial crime throughout L.A. and his actions greatly influenced Danny. Reformed and fresh out of prison, Derek severs contact with the gang and becomes determined to keep Danny from going down the same violent path as he did. (Read More)

Subgenre:
cult filmfamily tragedy
Themes:
abusemurderdeathfriendshiprevengerapepoliticsprisonfearangerracismpsychopathdeath of fatherbrutalityparanoia …dysfunctional familyguilthumiliationprejudiceregretmurder of father (See All)
Mood:
high schooltearjerker
Locations:
carlos angeles californiaprison rapeprison shower
Characters:
mother son relationshipfamily relationshipsfather son relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipteenage boytough guyjewishbully …jewish americangay rape (See All)
Story:
skinheadjuvenile delinquentreference to adolf hitlerdirectorial debutracial slurf wordcigarette smokingbare chested malefemale nudityviolencenuditybloodmale nuditybare breastsflashback …male frontal nuditymale rear nuditygunphotographtitle spoken by characterthree word titlesurprise endingpistolvoice over narrationcryingwoman on topbeatingshot to deathunderwearblood splattershot in the chestpunched in the facecomputerarrestthongbare buttshootingheld at gunpointbathroomjailmale pubic hairbedroombasketballwidowcontroversygunshotattackkicked in the facedeath of brotherhigh school studentthreatex convicthandgunobscene finger gestureblood spatterhatesingle parentbulletcountry name in titlewoundfriendship between menrace relationspropagandaragebuttrape victimcrying maninterracial friendshipmale underwearmoralityanti semitismrear entry sexgrocery storeboxer shortshypocrisyblood on facehatredkickingliteraturedeath threattitle appears in writinggang rapeblood on shirtracistbigotrysexual assaultethnic slursodomygunfireloss of brothershaved headfiremaninterrupted sexspittingmexican americanvideo tapetaking a showerstorelaundryswastikamen's bathroomremorserestroomloud sexneo nazigang violenceanal rapemale rapehate crimestrong languageracial prejudicecrushed headurinaln wordxenophobiaspitdirector also cinematographercamcorderbloodshedracial tensionreference to abraham lincolnfilm starts with sexsociologyhypocriteracial discriminationkiss on the cheekbasketball playerjuvenile delinquencymanslaughtervillain turns goodreference to hillary clintonracial issuesthreat to killhooligangroup showermoral ambiguitykorean americanwoman smoking cigarettedelinquenthigh school principalnarration from the graveracialblack & white to colorteen violencegoateegang warfareincarcerationwhite supremacistlittle brotherspitting on someoneracial violenceskull crushinganti fascismreference to martin luther kingjuvenilevenice beach californiaprison gangangry mancharismablood on clothesoverweight manbloodysheetplaying basketballill motherblowing smoke in someone's faceanti semitic slurflash mobiron crossschool projectwhite powercrack houseracial intolerancegirlfriend boyfriend relationshipaffirmative actionbreaking into a carracial hatredreference to rodney kingaryan brotherhoodjellybeandisarming a person with a gunswastika tattoobasketball ballmale on male rapereference to the los angeles lakerschelsea smileblood on bodyboy smoking a cigarettebloody messmein kampfprison releaseson dislikes mother's boyfriendstudent principal relationshipthreats and intimidationnazi paraphernaliaoffensiverape survivorrapedbasketball hoopsimulated rapeteen delinquentbleeding anusbrutal rapekorean grocerracial epithetreference to cesar chavez (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Color Purple (1985) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Color Purple (1985)

This film follows the life of Celie, a young black girl growing up in the early 1900's. The first time we see Celie, she is 14 - and pregnant - by her father. We stay with her for the next 30 years of her tough life...

Subgenre:
melodrama
Themes:
father daughter incestabuseincestlovefriendshiprapechristmasdrunkennessescapeweddingfuneralextramarital affairracismpsychopathterrorism …povertyalcoholismadoptioninheritance (See All)
Locations:
kitchenbathtubtrainchurchrural settingfarmafrica
Characters:
sister sister relationshipfather son relationshipfather daughter relationshipafrican americansingerfemale protagonistgirlstudentmayorself discoverysexistpregnant from rapeself worthpregnant by incest
Period:
1930s1920s1910s1900s
Story:
sexual abuseracial slurbased on novelsex scenephotographtitle spoken by characterlesbian kissthree word titlevoice over narrationbeatinghorsemirrorface slapletterpiano …prayercolor in titlebisexualcookingwomanchild abusebathsearchimmigrationcursewidowerevil manflowersfarmerdomestic violencechildbirthloss of fatherreunionfeminismloss of motherblack americanshavingrace relationscatfightperformanceslaveryassaultblockbusterfemale singerbirthreconciliationgrandfathersexismblack eyerainstormmarital separationfieldrelease from prisonmisogynyphysical abuseunhappy marriagewedding ceremonyhit in the facestereotypefamily reunionchild molestationstepfatherfriendship between womenrepressionperformerstepmothertennesseemailboxracial prejudiceilliteracyeastergeorgiadocumentsexual repressionhiding placeracial tensionmailmanadopted daughternewlywedsewinglearningracial discriminationchild rapestraight razorunwed pregnancywoman punching a mandriving lessonafrican american protagonistwife abusefather daughter estrangementgeneral storepulitzer prize sourceatonementseparation from familytranscendencemementoboutiqueincest raperacial injusticechild bridepantschild born of rapehand clapping gamepurplerepatriationmother child reunionspousal abusesexual discriminationbloody hand printroadhousewife beatingdragged along the groundyear 1909juke jointgrowtholiver twistfront porchriver raftsong dedicationintercepted letterlovelessracial mistrustsubjugationhusband abuseserfdomwood stoveactress shares last name with characterhoochchild pregnancy (See All)

Mr. Woodcock (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mr. Woodcock (2007)

Fatherless John Farley's youth frustration, even trauma, like many his school kids' in his Nebraska small town home, was the constant abuse and humiliation in sadistic Jasper Woodcock's gym class. After college, doting son John became a motivational bestseller author and returns during a book signin …g tour to receive the backwater's highest honor. To John's horror, his devoted mother Beverly announces her plans to marry the hated coach and he's to be celebrated on the same event as John. Only ridiculous fatso Nedderman and his strange brother try to help Farley stop Woodcock, but that keeps backfiring. (Read More)

Subgenre:
screwball comedy
Themes:
abuseyouthchristmasdivorcewrestlinghumiliation
Locations:
kitchensmall townrestaurantswimming poolairplanewheelchair
Characters:
single mothermother son relationshipfather son relationshipboyfriend girlfriend relationshipteacherbullyfiance fiancee relationshipold friendevil teacher
Period:
1990s2000s
Story:
white trashgay slurcharacter name in titleflashbacktwo word titlesex scenetitle spoken by characterpunctuation in titlebeatingunderwearurinationbookvideo cameraambulancewidow …apologyritualprologuestripteaselocker roomscene during end creditspremarital sexfreeze framesupermarketfireplacebreaking and enteringjoggingparadecarnivalhaircuthit in the crotchsex talkawardengagementblack eyechildhood memoryhiding in a closetforced to stripwhistleasthmaretirement homeman in underwearpush upswhite briefsgurneyhiding under a bedscoldinggrudgejunior high schoolbarbershopcorntreadmillschool lifeswimwearbroken engagementbook signingnebraskareference to oprah winfreywork outgym classgym teacherbook burningpizzeriachildhood homelive televisionspying on couple having sexpep talkpizza parlorparty hatliterary agenteating contestasthmaticoverweight childcomedic sex sceneman forced to striphigh school coachbench pressself help gurufilming people having sex (See All)

Do The Right Thing (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Do The Right Thing (1989)

This film looks at life in the Bedford-Stuyvesant district of Brooklyn on a hot summer Sunday. As he does everyday, Sal Fragione opens the pizza parlor he's owned for 25 years. The neighborhood has changed considerably in the time he's been there and is now composed primarily of African-Americans an …d Hispanics. His son Pino hates it there and would like nothing better than to relocate the eatery to their own neighborhood. For Sal however, the restaurant represents something that is part of his life and sees it as a part of the community. What begins as a simple complaint by one of his customers, Buggin Out - who wonders why he has only pictures of famous Italian-Americans on the wall when most of his customers are black - eventually disintegrates into violence as frustration seemingly brings out the worst in everyone. (Read More)

Subgenre:
black comedyindependent filmdark comedypunkblack independent filmtragicomedy
Themes:
murderdeathmoneyracismcelebritypolice brutality
Mood:
breaking the fourth wallsatire
Locations:
new york cityrestaurant
Characters:
father son relationshippoliceafrican americanboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshippolicemanmusicianlatino
Period:
1980ssummer
Story:
reference to michael jordanmental retardationlong takeracial slurf wordfemale nudityviolencefightnipplesphotographtitle spoken by characterfirevoice over narrationfistfightbeer …sunglasseslow budget filmneighborman with glassesradiocontroversypay phonewritten and directed by cast membercharacter's point of view camera shotbaseball battragic eventarsonhateblack americanpizzariotitalianstreetrace relationsragevandalismassaultculture clashbrooklyn new york cityitalian americanconvenience storeheadphonesensemble castfrustrationghettomexican americanharassmentimperative in titleblack mankoreanself defenseurban decayfamily businessradio showxenophobiapizza deliverycadillacheatracial tensionstutteringpuerto ricanvotinghobogarbage canasphyxiationbroomboom boxdutch anglegeneration xreference to martin luther king jr.batterymilitantjoke tellinghawaiian shirtitalian restaurantpizzeriacounting moneypizza parlorfire hoseboycottblack powermulti ethnicconvenience store clerkreference to nelson mandelalistening to the radioreference to princereference to malcolm xspeaking spanishreference to louis armstrongpizza boychoke to deathcivic activistheadlockblacks versus italiansreference to miles davisunintended consequencesspeaking italianbrownstoneethnic neighborhoodblack militantreference to ray charlesreference to janet jacksonbedford stuyvesant brooklyn new york citypizza cutteropen hydrantreference to john coltranereference to roger clemens (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

New Jack City (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

New Jack City (1991)

The gangster Nino has a gang who call themselves Cash Money Brothers. They get into the crack business and not before long they make a million dollars every week. A cop, Scotty, is after them. He tries to get into the gang by letting an ex-drug addict infiltrate the gang, but the attempt fails miser …ably. The only thing that remains is that Scotty himself becomes a drug pusher. (Read More)

Subgenre:
black comedycult filmindependent filmmartial artsblack independent film
Themes:
home invasionmurderdeathfriendshiprevengeinfidelitydrugschristmasmoneybetrayaladulteryfeartortureescapewedding …funeralgangsterinvestigationdeceptionangercorruptionbrutalityobsessionpovertyparanoiamafiasadismsurveillancecrueltyvengeancedrug addictionjusticepolice brutalitypolice investigationnear death experienceamerican gangster (See All)
Mood:
goreneo noirhip hoppoetic justice
Locations:
new york citybarbeachrestaurantswimming poolsnowmotorcyclecemeterynightclubbicycleurban settingapartmentpolice stationcourtroomabandoned factory
Characters:
prostitutehusband wife relationshippoliceafrican americanfriendboyfriend girlfriend relationshiptattoosingerpolice officerdetectivepolicemanpriesthostagelawyertough guy …action herohitmanpolice detectiveasian americanpolice shootoutpolice chasehomeless manex soldierpolice funeral (See All)
Period:
1980s1990s
Story:
racist commentdrug addictracial slurgay slurf wordbare chested malefemale nuditysexfightviolencebloodflashbackmale rear nuditygunfemale rear nudity …dancingnipplestitle spoken by characterexplosionpartyknifechasesurprise endingpantiespistoltelephone callfirecell phoneshootoutbeatingcorpseshot to deathunderwearblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facecameraarrestgunfightbrawlthongbare buttfalling from heightshootingrifleheld at gunpointhand to hand combatsunglassesbomblingerieinterrogationhandcuffsrevolvermanhattan new york citycriminaltelephoneshot in the backsubjective cameraflashlightbragangambushold manstrangulationmassacredisguisemansionbasketballdeath of frienddrug dealermontagethroat slittingcocainestabbed in the chesttied to a chairfalse accusationjudgetrialanti herodisarming someonedrawingchild in perildouble crosspolice officer killedpublic nuditylimousineorganized crimecharacter repeating someone else's dialoguebeaten to deathdangerumbrellacharacter's point of view camera shotundercovercover upevil manbaseball batlightningcourtmanipulationbodyguardthreatsuspicioncharacter says i love youthreatened with a knifevigilanteheroinarsonpowerhenchmanak 47crime bossmachismouziundergroundfalling down stairsassassination attemptstreetjeepheavy rainsociopathsecurity camerawalkie talkiemobsterkicked in the stomachswat teamimpersonationgrindhousegenocidestreet lifedrug dealingthugcameoswitchbladetensionrap musicexplosiveitalian americanhatredpartnerevacuationjunkiefalling to deathpsychotronicaquariumcigarette lighterpunched in the chestsafejumping through a windowghettobooby trapwisecrack humorrainstormundercover copbulletproof vesttough copgasolinepolice raidethnic slurlasersightworld trade center manhattan new york citylandlorddrug lordcrowdmain character diesthanksgivingmob bossdjbriberyvillain played by lead actoradulterous wifebag of moneystabbed in the handbonggang wartimebombbrooklyn bridgemegalomaniacinformantfish tankdegradationfemale lawyerurban decaypolice captainnarcissismman kills a womanstatue of liberty new york citywrathreverendski maskshot point blankwoman kills a mandomestic abusemaverick coptop secretdrive by shootingmafia bossshot in the footbettingblaxploitationcrack cocainetragic endingstutteringinfiltrationmain character shotturkeytommy gunmob violenceblack copdreadlockssocial decayharlem manhattan new york citymob hitworld war two veteranchrysler building manhattan new york cityhostile takeoverex marinetragic villaindutch anglehitwomanc4 explosivessuitcase full of moneymob of reportersbalisonghomeless womansafecrackerpolice vigilantismdrug rehabilitationlugergangsta gripgangster bossnew york city skylineenforcerreference to star trekstrapped to a bombwearing a sound wirespeech impedimentnew year's dayprofessional hita cappellacourtyarddirected by co starrise to powerhuman shieldfloppy diskmeth labracist insultrastafarianabandoned apartmentsuspended copwar on drugsblack boyracist jokehuman bombgangsta rapdisarming a bombafrican american musiclack of trustblack slangafrican american filmmakerman with ponytailfilm ends with text (See All)

The Mirror (1975) is one of the best movies like Gummo (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Mirror (1975)

Tarkovsky mixes flash-backs, historical footage and original poetry to illustrate the reminiscences of a dying man about his childhood during World War II, adolescence, and a painful divorce in his family. The story interweaves reflections about Russian history and society.

Subgenre:
coming of age
Themes:
surrealismdeathmoneyghostpregnancymemorynaturedivorcegriefillnesspoetrychildhooddying
Mood:
avant garderainarchive footage
Locations:
forestsnowairplanewoodsrural settingfarmrussiaspainmilitary school
Characters:
single mothermother son relationshipfamily relationshipshusband wife relationshipfather son relationshipdoctorsingerbrother sister relationshipsoldierstudentdancerbabywriterchristianmother …chinesegrandmother grandson relationshipstepfather stepdaughter relationship (See All)
Period:
world war two1940s1930swinter
Story:
reference to adolf hitlerlong takenonlinear timelinecatcigarette smokingone word titlefemale nuditynuditybloodmale nudityinterviewflashbackdogdancingphotograph …singingshowertelephone callfirecryingdreamfoodmirrorslow motion scenebare buttbookrifletearsrunningbeddead bodyrivertelephoneswimmingnewspaperorphandream sequencebirdcontroversyold womanactor playing multiple rolesreadingsoviet unionchickensleepingpoemhand grenadebarndemonstrationbuttockshomereverse footagetarget practicewindbombingspanishevacuationtvhypnosismedical examinationabsent fatherlanternfieldbonfiresymbolismcoinmoscow russiamudactress playing multiple roleslevitationstock footagefenceatomic bombwellindependencefallingdying manbleedingspanish civil warhammocklook alikelighting a cigarettehot air balloonstutteringtelevision setussrdeath of parentspotatofloodingflamencomissing fathersledmemoriesgrievingburning houseprinting presswashing hairbullfighterinstructorrussian historyminimal dialoguematadorreference to leonardo da vincimarshreference to mao tse tungbullfightreference to anton chekhovmosesstream of consciousnessdaily life20th century historysepiadostoevskyyear 1935memoirskilling a chickenart bookshellingtarkovskywind stormatomic explosionsoviet historyflashback to images of memoriesfloating in the airpower of suggestionclock tickingproofreaderburning barnlevitatingprinting shopsoviet union historytattletaleburning bushcorridavoice over poetry (See All)

Strange Days (1995)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Strange Days (1995)

Set in the year 1999 during the last days of the old millennium, the movie tells the story of Lenny Nero, an ex-cop who now deals with data-discs containing recorded memories and emotions. One day he receives a disc which contains the memories of a murderer killing a prostitute. Lenny investigates a …nd is pulled deeper and deeper in a whirl of blackmail, murder and rape. Will he survive and solve the case? (Read More)

Subgenre:
cult filmmartial artsconspiracydystopiavideocyberpunktech noir
Themes:
surrealismmurderdeathrevengesuiciderapechristmasbetrayaldeceptionmilitarymemoryrobberyracismcorruptionpsychopath …paranoiasurveillancepolice brutality (See All)
Mood:
rainneo noircar chasehip hop
Locations:
kitchenbarbeachrestauranttrainchurchswimming poolhotelhelicoptermotorcyclelos angeles californianightclubelevatorapartmentrooftop
Characters:
prostitutemother son relationshippolicesoldierinterracial relationshippolice violence
Period:
1990sfutureyear 1999
Story:
long takeracial slurprostitutioncigarette smokingfemale frontal nudityfemale nudityviolencefightsexbloodflashbackdogtwo word title …explosionpartyknifechasesurprise endingpantiespistolfirecell phoneshootouttitle directed by femalebeatingcorpseshot to deathblood splatterfistfightmachine gunmirrorshot in the chestface slapshot in the headshotgunpunched in the facecomputerbrawlthongfalling from heightvomitingshowdownheld at gunpointhand to hand combatbathroomhandcuffsrevolversciencetelevisionshot in the backfoot chaseflashlightstrangulationsubwayexploding carno opening creditsdisarming someonedouble crossunderwater scenepolice officer killedfemme fatalenews reportshot in the foreheadlatex gloveslimousineblack pantiesstabbed in the backelectrocutionpay phoneundercoverproduct placementtankopening action sceneshot in the shoulderwigsemiautomatic pistolblindfoldsilencerfireworkscorrupt copstrong female charactersexual fantasyprivate detectiveriotrockmass murdersecurity cameracrucifixvillainessvideotapeswat teamvirtual realitynew year's everapistinterracial friendshippump action shotguninterracial romanceswitchbladetelescopechaosblood on shirtbulletproof vestbody landing on a cargasolinehustlerberettaex coptasergun in mouthspiral staircaselizardflareinterracial kisshate crimesnuff filmcorrupt policeshot through the mouthcar set on firewoman fights a manmimedirty copbagpipescocaine snortingman hits a womanbreaking a bottle over someone's headrock singerrevolving doorpolice commissionermacedriver's licensejumping from a rooftopcrotch shothit with a chairwhite male black female relationshipmusic producercompact disckicked in the chestfirst personrap starracial violencelock pickrollerblading8 trackchoked to deathkiller coppanties slipend of the millenniumcolor blindnesspsycho copsousveillancekiller wearing a ski masknew year's eve show (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Gummo?
<< FIND THEM HERE! >>