Best popular movies like Halloween II:

Do you need specific genre & keyword selection to find films similar to Halloween II?
<< FIND THEM HERE! >>

Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
psycho thrillerslasher flickholiday horroramerican horrorsuspensecult film
Themes:
psychological traumamurder of a police officermurder investigationmadnesstraumablindnessinsanityparanoiaobsessionbrutalitypsychopathseductionmemoryvoyeurismtorture β€¦fearjealousymurderdeath (See All)
Mood:
darknessslashernightgore
Locations:
hospital firepolice carwheelchairsmall towncarhospital
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemandetectivepolice officernurseteenage girlboyfriend girlfriend relationshippoliceteenager
Period:
year 19781970s
Story:
cigarette lighterhomicidal maniacpsycho terrorbath towelpsycho killerstalking by nightnurse uniformbutcher knifescalding waterhand on shoulder scarewalking through a glass doorlighting a cigarette for someonelighting cigarette for womanstabbed with a scalpellighting a cigarette for a woman β€¦lighting someone's cigarettesmoking a cigarettefragments of glassneedle in eyestore roomzippo lighterlighting a cigarettehit on the head with a hammermurdered with a hammerpsycho filmmultiple homicidebroken glasspool of bloodgrindhouse filmserial teen murdererstalking victimhypodermic needlemurder witnesscar accidentsmall town sheriffvillain not really dead clichemasked villainserial teen killerdark killerdeath by strangulationmultiple stabbingpsychopathic killermasked killersadistic psychopathdental masksurgical maskmedical maskdark secretdead nursenurse hatnurse outfitcar won't startcar troubledriving a carblood splatterset on fireman on firehit by a carknife murderperson on fireteenager in dangerpolice officer throat slithospital patientblood draininghead dunked in waterdouble murdersleeping girlself survivalcharred bodydead doctorscalded facerecap segmentsequel to cult filmopening creditsslipping and fallingclosing eyes of dead personhot waterexsanguinationvulnerablehomicidalpush buttonsecurity guard killedboiling waterslipoctoberscaldinghittingsleeping womanhidetemperaturechildhood flashbacklocked upwoman stabbedmelting faceyelling for helpjumpsuitdrive in classiccalling someone an idiot21 year oldcigarette smokingfiendboogeymanmurder spreemichael myersdemonictorturerroman numbered sequelbloody violencedisturbingsearchingdeeply disturbed personmultiple murdermidwestpassing outescaped mental patientmurder attemptgraphic violenceboom boxcuriosityextreme violencecutearringsdying wordsburningnude bathingsinisterdripping bloodfemale victimbutcherykiss on the lipssilhouettescareblood stainflameadult actress playing teenage girlbleedinghand over mouthrobeshot in the eyeglassburnt facecigarettescalpelstethoscopeparamedicclinic17 year oldserial murderslashingearringsuithuman monsteralonelightermysterious manbandageneedlestorebad guyfemale stockinged feetmadmanconfusiondead girlflat tirecharacters killed one by onedead woman with eyes opennude woman murderedsmokebloodbathneighborhoodlightbody countstabbed in the eyedark pasteye gougingaccidental killingdead mandisfigurementslaughterhot tubshadowautopsyhit on the headfrustrationstabbed in the throatbutchermutemercilessnessmanhuntcamera shot of feetpresumed deadback from the deadrampagemasked mandead womanhomicidetowelbuttpsychologistgrindhousepsychopoolstabbed in the stomachbuttockscaucasianwalkie talkielifting someone into the airhidinghammercowboy hatsexual attractionmutilationelectronic music scoredestructionsyringetv newsmaniacsplattermurderertrapwitnessglassesstalkinginjectioncollege studentscreamcharacter's point of view camera shotproduct placementpoisonbeaten to deathuniformstabbed in the backattempted murderscreamingprologuestrippingstalkerold womannews reportnecklacepantyhosesearchbathpart of seriesbrunetteaccidentstabbed to deaththroat slittingstabbingambulancestrangulationold manflashlightgood versus evilsubjective camerahalloweenrevolvervoyeurneighborsecond partshootingmasksecretbrawlkissingwatching tvblondeshot in the chestcryingfiretelephone callchaseknifeexplosionnipplesfemale rear nuditymale rear nudityfemale nuditymale nuditynumber in titletwo word titlebare breastsbloodsexsequelnudityviolencekiss (See All)

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror
Themes:
insanitybrutalitypsychopathtorturemurderdeathsupernatural powersadismevil
Mood:
slashergorebreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlbrother sister relationshipteenage boymysterious villainmysterious killer
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killergrindhouse filmserial teen murderervillain not really dead clichemasked villainserial teen killerpsychopathic killermasked killersadistic psychopathcar troubleblood splatterknife murdersequel to cult film β€¦drive in classicboogeymanmurder spreetorturerdisturbingbloody violencedeeply disturbed persongraphic violenceextreme violencebutcheryshot in the eyeserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebody countdisfigurementslaughterbutcherback from the deadrampagemasked mantowelgrindhousepsycholifting someone into the airsexual attractionmutilationmaniacmurdererstalkingcharacter's point of view camera shotstabbed in the backstabbed to deathstrangulationsubjective cameramaskfemale rear nuditymale rear nudityfemale nuditymale nuditynumber in titlebare breastssexviolencebloodsequelfemale frontal nuditymasturbationsurprise endingpantiescorpseunderwearlow budget filmdecapitationimpalementsevered headchild in perillooking at the cameraskinny dippingevil manpremarital sexcabinloss of motherobscene finger gesturekillingragemorguefourth partrednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentbody landing on a carkilling spreestabbed in the handkillsummer camphillbillymeat cleavernaked dead womanstabbed in the facedeformitylunaticmurder of a nude womandisturbed individualcrime spreehockey masklifting a female into the airruralgiallo esquestabbedskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the necktrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainslaughteredmurder in a shower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β€¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
psycho thrillerslasher flickholiday horroramerican horrorcult filmindependent filmteen movieteen horror
Themes:
paranoiapsychopathfeardeathmurdercorruptionevilmurder of family
Mood:
slashernighthigh school
Locations:
small towncarcar theftkitchen knife
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlteenagerhusband wife relationshipboyteenage boyfemale protagonistgirllittle girllittle boy β€¦psychiatristdoctor patient relationship (See All)
Period:
year 19781970s1960syear 1963
Story:
homicidal maniacpsycho terrorpsycho killerbutcher knifesmoking a cigarettepsycho filmgrindhouse filmsmall town sheriffvillain not really dead clichemasked villainpsychopathic killermasked killersadistic psychopathblood splatterknife murder β€¦teenager in dangeroctoberwoman stabbedjumpsuitdrive in classic21 year oldcigarette smokingboogeymanmurder spreemichael myersdemonicmidwestescaped mental patientfemale victimcigarette17 year oldserial murderhuman monsterbad guymadmandead woman with eyes opennude woman murderedbody countmanhuntmercilessnessmasked mandead womangrindhousepsychostabbed in the stomachlifting someone into the airmutilationelectronic music scoremaniacmurdererstalkingcharacter's point of view camera shotattempted murderprologuestabbed to deaththroat slittingstabbingstrangulationgood versus evilsubjective camerahalloweenneighbormaskwatching tvshot in the chestknifefemale nudityviolencenudityone word titledogguntitle spoken by charactersurprise endingshot to deathfalling from heightrunninglow budget filmmarijuanatelevisiontelephonechildgunshotsuburbfirst of seriespay phoneevil manhalloween costumelong takefirst parthandgunkillingpot smokingteen angstbulletbabysitterblockbusterwatching televisionwoman in jeopardycouchunderage drinkingburglarytvtitle at the endkilling spreepumpkinphonedead doggothmental patientyellingclosethiding in a closetkillsuit and tiefenceautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpenterknittingoff screen murderwetnessno endingpayphonelight bulbghost costumeweirdowoman smoking cigarettecreepytrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childphone conversationcuttingpumpkin carvinghorror movie remadelifting a male into the airlaundry roomcarrying a dead bodysororicideescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needlehouse of horrorsgiant pumpkinteenager murdered (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
psycho thrillerslasher flickamerican horrorsuspensecult filmindependent filmteen moviemurder mysteryteen horror
Themes:
traumainsanitybrutalitypsychopathvoyeurismfearmurderdeathrevengecorruptionhumiliationsadismevilcrueltymysterious death
Mood:
darknessslashernightgoreblood and gore
Locations:
police carcarmotorcycleboatwaterwoodsrural settinglaketruck
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemanpolice officerteenagerpolicefriendteenage boyartistmother β€¦truck drivermysterious villain (See All)
Period:
1970s1950ssummer
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmmultiple homicidegrindhouse filmmurder witnessvillain not really dead clicheserial teen killerpsychopathic killersadistic psychopathcar troubleblood splatterknife murderdrive in classic β€¦murder spreebloody violencedisturbingmultiple murdergraphic violenceextreme violencedripping bloodfemale victimbutcheryrobeserial murderslashinghuman monstermysterious mancharacters killed one by onebody countdead manslaughterstabbed in the throatbutchermutemercilessnessrampagedead womangrindhousepsychostabbed in the stomachhammerelectronic music scoremaniacmurdererstalkinginjectionscreamingprologuestrippingaccidentstabbed to deaththroat slittingstabbingold mansubjective cameravoyeurblondenipplesfemale rear nuditymale rear nudityfemale nuditymale nuditynumber in titlebare breastsviolencekisssexbare chested malethree word titlesurprise endingpantiesbeatingcorpsedigit in titlefistfightslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationguitardecapitationbedroombracandleaxemassacrewomandinersnakecultdream sequenceskinny dippingdangerfirst of seriesmoaningdeath of childprankdeath of sonfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingdressjeepgothicheavy rainmachetehatvillainessswimsuitvictimfull moonbra and pantieslow budgetnew jerseyobesitypower outagepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversionlens flareaxe murderroomkilling spreearrowdeath of loved onetank toppsychoticphysical abuset shirtjoysexual awakeningbeheadingshortsdead animalsummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathjacketdying manactual animal killedday in titlesummer vacationfemale villainshirtevil womanfamous scoreanthropologydisfigured faceorchestral music scoresexual repressionmenacemurderessgame playingbowboard gamepillowsole survivortraumatic experiencewet clothesgrudgeoff screen murdermurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmistreatmentfemale serial killerweirdoawakeningdate in titledead teenagerlost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gameknife through the neckcanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Halloween (2007) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
psycho thrillerslasher flickamerican horrortragedy
Themes:
murder of a police officerinsanitybrutalitypsychopathtorturedeathmurdersuicidekidnappingrapedysfunctional familysadismevilhome invasionpolice investigation β€¦mysterious death (See All)
Mood:
darknessslashernightgoreblood and gore
Locations:
small townstrip club
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerboyfriend girlfriend relationshipteenagerafrican americanboyhostagepsychiatrist
Period:
1970s
Story:
psycho terrorpsycho killerbutcher knifepsycho filmmultiple homicidevillain not really dead clichemasked villainpsychopathic killermasked killersadistic psychopathblood splatterknife murderjumpsuitboogeymanmurder spree β€¦michael myerstorturerdisturbingbloody violencedeeply disturbed personmidwestmultiple murderescaped mental patientgraphic violenceextreme violencedying wordsdripping bloodfemale victimbutcheryserial murderslashinghuman monsterbad guymadmancharacters killed one by onebloodbathbody countdark pastbutchermanhuntrampagemasked manpsychologistpsycholifting someone into the airelectronic music scoremaniacsplattermurdererstalkingcharacter's point of view camera shotbeaten to deathuniformstabbed in the backstabbed to deaththroat slittingstabbingstrangulationsubjective camerahalloweenmaskchaseknifefemale rear nudityfemale nuditymale nuditysexviolencebloodfemale frontal nudityfemale full frontal nudityphotographtitle spoken by characterpistolwoman on topbeatingcorpseremakeshot in the headfalling from heightdead bodytelevisionstrippershot in the backf wordmassacreimpalementstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorattackevil manbaseball bathangingshot in the shoulderpremarital sexloss of motherprofanitykillingteenage sexblood spatterkilling an animalmass murderrageloss of friendvictimhome moviebroken legcrime scenetensionshot in the facemental hospitalheadphonesperversionmurder of a childbroken armduct tapekilling spreepumpkinpsychoticswearinghit with a baseball batpervertmexican americanporn magazinedead animaltrick or treatingabandoned housesexual violencetombstoneschool principalautumnstrong languagewhite trashbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitaldisfigured facematricideloss of familydying during sexanimal killingmass murdererjack o'lanterncrime spreecreepchild killedthroat rippinghigh school friendmental asylumforkweirdocreepydeath of petlifting a female into the airloss of boyfriendchild murders a childhanged boysadisticreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent film
Themes:
insanitybrutalitypsychopathfearmurderdeathrevengesadismevilexploitationpolice investigation
Mood:
darknessslashernightgorerainnightmare
Locations:
small towncemeterywoodsamericabackwoods
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenagerpolicemother son relationshipbrother brother relationshipmysterious villainmysterious killercountry boy
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killermultiple homicidegrindhouse filmserial teen murderersmall town sheriffmasked villainserial teen killerpsychopathic killermasked killersadistic psychopathcar troubleblood splatterknife murder β€¦sequel to cult filmjumpsuitdrive in classicmurder spreebloody violencegraphic violenceextreme violencefemale victimbutcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebody countstabbed in the eyeeye gougingslaughterbutcherrampagemasked mangrindhousepsychostabbed in the stomachlifting someone into the airmutilationmaniacmurdererstalkingcharacter's point of view camera shotstalkerthroat slittingsubjective camerachasefemale nuditynumber in titlebare breastsbloodkisssequelsexviolencefemale frontal nuditydancingsurprise endingpantiesdigit in titledead bodylow budget filmnumbered sequeldecapitationsword fightaxemassacreimpalementchild in perilgraveevil mandeath of brotherdeath of sonobscene finger gesturekissing while having sexchainsawmachetebarnvictimmental institutionrednecknew jerseyitalian americanpsychotronicaxe murderfifth partsequel to cult favoritepsychoticlaundrydefecationsummer campcomic relieftombstonehillbillyeyeballmeat cleavercrushed headorchestral music scorestabbed in the facecut into pieceslunaticpsychotronic filmmurder of a nude womandisturbed individualdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headweirdobreakdancingdate in titlehockey maskdark and stormy nightcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterpopular musicfriday the thirteenthgrave robbermachete mutilationcopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotlifting a woman into the airspike in the head (See All)

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspensecult filmb horrorindependent horror
Themes:
insanitybrutalitypsychopathfeardeathmurderevilexploitation
Mood:
darknessslashergore
Locations:
police carwheelchairwoodslakecampfirebackwoodsrunning through the woodschase in the woods
Characters:
slasher killerserial murdererserial killerterrorvillainkillerboyfriend girlfriend relationshipteenagermysterious villainmysterious killer
Period:
1980ssummeryear 1984
Story:
homicidal maniacpsycho terrorpsycho killerhand on shoulder scaremultiple homicidegrindhouse filmserial teen murderervillain not really dead clichemasked villainpsychopathic killermasked killersadistic psychopathcar troubleblood splatterknife murder β€¦sequel to cult filmdrive in classicmurder spreeboogeymantorturerbloody violencedisturbingmultiple murderbutcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebody countslaughterbutcherrampagemasked mangrindhousepsycholifting someone into the airmutilationmaniacsplattermurdererstalkingcharacter's point of view camera shotprologuestalkerthroat slittingstrangulationsubjective camerasecond partmaskblondetelephone callnipplesfemale nuditynumber in titlesequelkissviolencebloodsexfemale frontal nudityflashbackfightsurprise endingpantiescorpsedigit in titleslow motion scenecatbikinidead bodynumbered sequelswimmingdecapitationbramassacreimpalementjokesevered headcontroversyskinny dippingevil manopening action sceneconvertibleobscene finger gesturelove interestkissing while having sexkillingchesschainsawfireplacespearnipples visible through clothingmass murdergothicmacheteragevillainessphone boothvictimredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headbetrefrigeratorlens flarekilling spreepsychoticnude swimmingreturning character killed offsummer campfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scorepitchforksole survivorlunaticpsychotronic filmmurder of a nude womandying during sexcrime spreecreepkilled during sexmystery killershackweirdolifting a female into the airtrailhanged boygiallo esquesadisticeast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catkilled by machetemenstrual cycledefy authorityfalse scarelatex mask (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
suspensecult filmparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
traumainsanityparanoiabrutalitypsychopathjealousymurderdeathsurrealisminfidelityrapechristmasghostdrinkingdrunkenness β€¦funeralinvestigationangercorruptiondeath of fatherblackmailillnesssadismhome invasiontheatrepanicdyingclaustrophobiachristmas past (See All)
Mood:
darknessslashernightgore
Locations:
police carwheelchaircarhospitalbarrestaurantschoolcemeterybathtubbicyclewaterelevatorkitchenaustraliapolice station β€¦cityitalytruck (See All)
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicemanboyfriend girlfriend relationshippolicehomosexualfather son relationshipmother son relationshipfather daughter relationshipdoctor β€¦singerboygirlmusicianactresspsychiatristmaidprofessorjewgermangay friendmysterious villainself pity (See All)
Period:
1970s
Story:
homicidal maniacbutcher knifefragments of glassbroken glasspool of bloodgrindhouse filmmurder witnesspsychopathic killersadistic psychopathdark secretdriving a carblood splatterhit by a carhot waterpush button β€¦locked upmelting facedrive in classiccigarette smokingmurder spreetorturerdisturbingdeeply disturbed persongraphic violenceextreme violencecutdripping bloodfemale victimbutcherysilhouetteblood stainglassburnt faceserial murderslashinghuman monstermysterious mandead girlcharacters killed one by onedead woman with eyes openlightbody countdark pasteye gougingdisfigurementdead manslaughtershadowhit on the headfrustrationbutchermutemercilessnessrampagedead womangrindhousestabbed in the stomachtv newsmaniacmurderertrapwitnessstalkingattempted murderstabbed in the backscreamingprologueold womannecklacesearchbrunettestabbed to deathstabbingstrangulationold manflashlightsubjective camerarevolverneighborshootingsecretwatching tvfiretelephone callchaseknifetwo word titlebloodkissviolenceflashbackgunphotographsingingsurprise endingsongshootoutbeatingcorpsemirrorface slapcameradrinkpaintingbookvomitingrunningdead bodycafebathroompianohallucinationcolor in titletelevisiontelephonereporterdecapitationsurvivalgay slurnewspaperbedroomjournalistbandaxeimpalementdinerhousejokedrivingsevered headbirddrawinggraveyarddrowningpainlibraryvirgindangerpuppetprotestkeydollstatuechristmas treeskeletonhangingpianistthreatdarkbasementsuspicioncult directorpsychiceuropekillingarsonrecord playerfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagiciantoyarchitectpsychologycomposerdesperationhomeviolinfemale killerembarrassmentwatching televisionwhiskeycrime scenecouchpaststabbed in the neckmental hospitalshoveltheatre audiencestairsenglishbutterflyfemale reportergay stereotypeliving roomkilling spreevoodooplaying pianopsychotictelepathycrowclose up of eyesdrumsapparitionkillgloveslong hairmen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathwhodunittheatre productiontape recordingmessagemind gamejacketgreenhousehit by a trucksaxophonefallingdisappointmenteyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetburnt bodyclueevil womanfamous scoremacabrepsychic powerbourgeoisiedeskmenacemurderesssilencedead birdarm wrestlingdogfightgiallopsychotronic filmhouse firehouse on fireclose up of eyefingerprinthatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floormystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowitalian cinemapiano teachercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womangruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightunknown killermutilated bodyattacked from behindknife in backforeignparapsychologycult favoriteproletarianleather glovesbrutalchildren's songscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Jason Lives: Friday The 13th Part Vi (1986) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
psycho thrillerslasher flickamerican horrorcult filmsupernaturalparanormal phenomenateen horror
Themes:
murder of a police officerinsanitypsychopathmurderdeathprisonmonstersupernatural powerevil
Mood:
darknessslashergorecar chasebreaking the fourth wall
Locations:
small townforestcemeteryboatwoodslakeamerica
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpoliceteenagerzombie
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmserial teen murderervillain not really dead clichemasked villainpsychopathic killermasked killersadistic psychopathblood splatterknife murderdrive in classicmurder spreedemonic β€¦bloody violencebutcheryfemale victimserial murderslashingbad guymadmanbloodbathbody countslaughterbutcherback from the deadrampagemasked manpsycholifting someone into the airmutilationmaniacsplattermurdererstalkingstabbed to deathstabbingambulanceflashlightmasknumber in titlesexviolencesequelcharacter name in titleflashbacksurprise endingnumbered sequeldemondecapitationmassacresevered headchildlooking at the cameradrowningelectrocutionevil manneck breakingunderwatersevered armdismembermentkillingundeadblood spattermass murdergothicmachetevictimnew jerseyshovelstabbed in the headsevered legsequel to cult favoritekilling spreebeheadingkillsummer campactual animal killedsixth partstabbed in the facerecreational vehiclecut into piecesheart ripped outoff screen murderghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey masklifting a female into the airdark and stormy nightgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerkilled by machete (See All)

Halloween H20: 20 Years Later (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β€¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
psycho thrillerslasher flickamerican horrorcult filmindependent filmteen horror
Themes:
insanityparanoiapsychopathdeathmurderdrugsevilabductionalcoholism
Mood:
slasherhigh schoolnightmare
Locations:
small townschoolelevatorkitchentruck
Characters:
slasher killerserial killerterrorvillainpolicemannurseteenage girlboyfriend girlfriend relationshippoliceteenagerfamily relationshipsmother son relationshipbrother sister relationshipteenage boygirl β€¦security guardalcoholicsecretarymysterious villain (See All)
Period:
1990syear 1998
Story:
homicidal maniacpsycho terrorpsycho killerbutcher knifecar accidentvillain not really dead clichemasked villainserial teen killerpsychopathic killermasked killersadistic psychopathcar troubleknife murderjumpsuitboogeyman β€¦murder spreemichael myersbloody violencegraphic violencefemale victimserial murderslashingmysterious manbad guymadmancharacters killed one by onebody countrampagemasked manpsycholifting someone into the airhidingmaniacsplatterstalkingcharacter's point of view camera shotuniformstabbed in the backattempted murderprologuestalkerstabbed to deaththroat slittingstabbingambulanceflashlightgood versus evilsubjective camerahalloweenneighbormaskchaseknifenumber in titleviolencebloodsequelpistolfalling from heightbirthdaydead bodyhallucinationtelephonedecapitationwinecandlecaliforniaaxedeath of friendtoiletstabbed in the chestweaponsevered headkeymistaken identityevil manactor shares first name with characterreunionflowerbreaking and enteringheroinesurvivorrageloss of friendvictimfaked deathtrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinnewspaper clippinghockeyreflectionstolen caranniversarybeheadingfire extinguisherreturning character killed offhiding in a closetgatebody bagstabbed in the facehiding placesittingseventh partdead teenagerdoor belllifting an adult into the airsadisticlifting a male into the airsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposaltrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
psycho thrillerslasher flickamerican horrorsuspensecult filmindependent filmsupernaturalparanormal phenomenacanadian horror
Themes:
traumainsanitybrutalitypsychopathmemorytorturefearmurderdeathrevengesuicidekidnappingghostdrunkennessdeath of father β€¦supernatural powerdeath of motherevilabductionfear of water (See All)
Mood:
slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore
Locations:
small townforestcemeterypolice stationlakeschool nurse
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenage girlboyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage boyzombielittle girl β€¦mysterious villain (See All)
Period:
2000s
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmserial teen murderervillain not really dead clichemasked villainserial teen killerpsychopathic killermasked killersadistic psychopathblood splatterperson on firemurder spreedemonic β€¦torturerbloody violencemidwestescaped mental patientgraphic violencedripping bloodbutcheryfemale victimburnt faceserial murderslashingmysterious manbad guymadmancharacters killed one by onebody counteye gougingslaughterbutcherrampagemasked manpsycholifting someone into the airmutilationmaniacsplattermurdererstalkingcharacter's point of view camera shotprologuestabbingmaskbrawlfireexplosionsequelviolencebloodcharacter name in titleflashbackphotographpartysurprise endingpistolshowervoice over narrationdreamcorpseslow motion scenefalling from heightcar crashdemondecapitationfoot chaseimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginelectrocutioncover upevil mandeath of childdeath of brotherhigh school studentneck breakingpremarital sexcabinsevered armdismembermentkillingundeadchild murderburned aliveheroinemass murdermachetecomaragesevered handvictimgoatcrushed to deathsevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realitydemonic possessionkilling spreegeekburned to deathnewspaper clippingtorso cut in halfblood on camera lensbeheadingfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downcornfielddeputywrist slittingkidnapperchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalclawdeformitypsychotronic filmbreaking through a doormass murdererghoulchild abductionfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partchild killerobituarychild murdererhand through chestdead teenagerhockey maskboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realitykilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
slasher flickamerican horrorcult film
Themes:
psychopathdeathmurderabductionexploitation
Mood:
darknessslashergore
Locations:
lake
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshipteenagerteenage boylow self esteemmysterious killer
Period:
1980s
Story:
homicidal maniacpsycho killergrindhouse filmmasked villainserial teen killerpsychopathic killermasked killersadistic psychopathcar troublesequel to cult filmdrive in classicmurder spreedisturbingextreme violenceshot in the eye β€¦serial murderslashinghuman monsterbad guymadmancharacters killed one by onestabbed in the eyeslaughterstabbed in the throatrampagemasked mangrindhousepsycholifting someone into the airmaniacsplattermurderercharacter's point of view camera shotsubjective cameramasknumber in titlebloodsequelnuditysexshowerdigit in titlebikininumbered sequelaxeimpalementthird partevil mancabinsevered armdismembermentmass murdermacheteragebarnroman numeral in titlesevered handstupiditynew jersey3 dimensionalconvenience storepsychotronicsequel to cult favoritekilling spreetorso cut in halfdefecationsexual violencehillbillyeyeballhammockfamous scoreknittingpitchforksole survivordeformitypsychotronic filmbiker gangmass murdererdisturbed individualcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titlehockey maskgiallo esqueyo yoskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoritebrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

Henry: Portrait Of A Serial Killer (1986) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmindependent horror
Themes:
insanitybrutalitypsychopathtorturedeathmurderdrugsrapeincestevilexploitationmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipprostitutemysterious villainmurder of a prostitute
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killergrindhouse filmpsychopathic killersadistic psychopathblood splatterknife murdermurder spreeextreme violencebutcheryserial murderslashinghuman monstermysterious man β€¦bad guymadmanbody countstabbed in the eyeslaughterbutcherrampagepsychostabbed in the stomachmutilationmaniacsplatterstalkingstalkerpantyhosestabbed to deathstabbingstrangulationshot in the chestfemale nuditybare breastsbloodnudityviolencecharacter name in titlegunsurprise endingshot to deathlow budget filmmarijuanacriminaldecapitationbisexualvideo cameradrug dealerstabbed in the chestchild abusesevered headcontroversyevil manattempted rapeneck breakingdismembermentkillingfemale stockinged legsragerapistlow budgetdark humorpsychotronicperversionmurder of a childabusive fatherkilling spreepervertvillain played by lead actorkillsexual violencenaked dead womanvideo footagematricidecut into piecesoff screen murderchild rapemurder of a nude womanbroken neckdisturbed individualexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
psycho thrillerslasher flickamerican horrorcult filmindependent filmparanormal phenomenateen horror
Themes:
murder of a police officerpsychopathdeathmurderrevengemonstersupernatural powerevildrug addiction
Mood:
slashergorerainhigh school
Locations:
new york cityboatwoodsseacityamericasewer
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolice officerteenage girlteenage boyzombieteacher student relationshipmysterious villain
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killerserial teen murdererhypodermic needlemasked villainpsychopathic killermasked killersadistic psychopathblood splatterknife murdermurder spreebutcheryserial murderbad guy β€¦madmancharacters killed one by onebody countstabbed in the eyeslaughterbutcherback from the deadrampagemasked manpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotnecklacestabbed to deaththroat slittingstabbingstrangulationflashlightexplosionfemale nuditynumber in titlesequelbloodviolencecharacter name in titlebare chested malepantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york citydecapitationgangnew yorkaxevideo cameraimpalementsubwaywhite pantiesexploding cardrowningon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadmale underwearnew jerseyblack bradead childdisembowelmentsequel to cult favoritebeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shiptoxic wastedeformitylunaticmetrooff screen murdermurder of a nude womanmass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseybig applegirl strangling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
psycho thrillersuspensesupernaturalparanormal
Themes:
insanityparanoiapsychopathmemorytorturefeardeathmurdersuicidekidnappingmarriagerapeghostprisonescape β€¦supernatural powerdrug usemental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessslashernightgorerainneo noirnightmare
Locations:
police carcarhospitalswimming poolbathtubtaxipolice station
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemannursepolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationship β€¦doctortattoofemale protagonistlawyerreference to godsecurity guardpsychiatristself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmhypodermic needlecar accidentpsychopathic killersadistic psychopathblood splatterman on fireperson on firedemonicbloody violencedisturbinggraphic violence β€¦extreme violencefemale victimblood stainscalpelstethoscopeserial murderslashingbad guymadmandead girlpsychobuttockssyringemaniacmurdererstalkinginjectionattempted murderscreamingaccidentthroat slittingflashlightsubjective camerashootingwatching tvcryingfiretelephone callchaseknifeexplosionfemale nuditysexkissviolencebloodf ratedfemale frontal nudityinterviewflashbackbare chested malegunfightphotographsurprise endingpistolshowercell phonedreamcorpsemirrorshotguncomputerrifletearsrunningcar crashhallucinationreporterswimmingsurvivalfoot chaseaxevideo camerawomanbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadmicrophonefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapepursuitdeath of husbandtrustkillingtherapypizzagothicheavy rainbarnsecurity camerajail cellpatientdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murdermemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismspreadeagledenialhearing voiceslistening to a radiofallingwrist slittingroadblockseizurepsychiatric hospitalshockcamcorderinmatetrapdoorpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gownbreaking glassfingerprintsnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
psycho thrilleramerican horrorsuspensecult filmindependent filmpsychological horror
Themes:
madnessinsanitypsychopathvoyeurismfeardeathmurdermarriagemoneyfuneraldeceptiondivorcetheftguiltdating β€¦mental illnessunrequited love (See All)
Mood:
darknessslasherrainbreaking the fourth wall
Locations:
police carsmall townchurchhotelbathtubdesertrural settingmotelcar in water
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemanfamily relationshipsmother son relationshipfriendsister sister relationshipthiefpsychiatristsecretary
Period:
1960syear 1960
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmgrindhouse filmpsychopathic killersadistic psychopathdriving a carknife murderdrive in classicmurder spreedisturbingbloody violencedeeply disturbed personfemale victim β€¦butcherysilhouetteserial murderslashinghuman monstermysterious manstorebad guyfemale stockinged feetmadmancharacters killed one by onedead woman with eyes openbloodbathbody countbutchercamera shot of feetgrindhousepsycholifting someone into the airmutilationmaniacmurderertrapwitnessscreamcharacter's point of view camera shotstalkerold womanbathstabbed to deathstabbinggood versus evilsubjective cameravoyeursecrettelephone callviolencebloodbased on novelone word titleinterviewflashbackbare chested malephotographsurprise endingshowervoice over narrationcorpseunderweararrestundressingbathroomjailhallucinationnewspaperbracaliforniadisguisewomanwidowtoiletstabbed in the chestbirdwidowerfirst of seriesmistaken identitymissing personlong takefemale removes her clothescountrysidebasementfirst partthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintingblockbusterimpersonationphone boothvictimskullpeeping tomapartment buildingimpostorgash in the facedeath threatblack braswamparizonarainstormextortionnervous breakdowncellarmeetingdead motherphonefemale in showerpsychoticimpotencevillain played by lead actordirector cameoold dark housefemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricidereclusemurder of a nude womanfade to blackpeep holedisturbed individualcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storesafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexcult favoriteirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodymurdered in a showerarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

Halloweenviii: Resurrection (2002) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β€¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
slasher flickamerican horrorcult filmindependent filmteen horror
Themes:
murder of a police officerpsychopathfeardeathmurderrevengedeceptionsurveillanceevil
Mood:
slashergoresatire
Locations:
wheelchairforestwoodskitchenrooftopfire truck
Characters:
slasher killerserial killervillainkillernurseteenage girlteenage boysecurity guardpsychiatristcoroner
Period:
2000s
Story:
homicidal maniacbutcher knifeserial teen killerpsychopathic killermasked killersadistic psychopathblood splatterman on firepolice officer throat slitjumpsuitboogeymanmichael myersmurder attemptserial murderhuman monster β€¦bad guycharacters killed one by onebody countstabbed in the throatrampagemasked manlifting someone into the airmaniacmurderercollege studentcharacter's point of view camera shotproduct placementstabbed in the backnews reportstabbed to deaththroat slittingambulancestrangulationflashlightgood versus evilsubjective camerahalloweenmaskbrawlwatching tvfirechaseknifefemale nuditytwo word titlesequelbloodviolenceflashbackfightsurprise endingcell phonecorpsefistfightmirrorcomputercameraundressingfalling from heightshowdownf worddecapitationfoot chaseaxemontageimpalementstabbed in the chestinternetsevered headpolice officer killedelectrocutionevil mankicked in the facelightningskeletondisappearanceneck breakingthreatened with a knifesevered armobscene finger gesturekillingchainsawheavy rainsecurity cameraloss of loved onemorgueskullfatebroken legmental institutionstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreenewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetold dark houseabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killinglocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partdead teenagerlifting a female into the airdeath by electrocutionskull crushingsee you in hellcult film referencedecomposed bodybutt grabclown maskovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
suspenseindependent filmb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
madnessinsanitybrutalitypsychopathtorturefeardeathmurderfriendshipsurrealismkidnappingrapedeath of fatherdeath of mothersadism β€¦evilunrequited lovehome invasionexploitationdeath of wifemurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessslashernightgorenightmarecar chaseblood and gore
Locations:
hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriend β€¦boybrother sister relationshipfemale protagoniststudentbest friendfrenchbest friendsmysterious villainmysterious killerdeath of boy (See All)
Story:
homicidal maniacpsycho killerbutcher knifebroken glassgrindhouse filmcar accidentpsychopathic killersadistic psychopathblood splatterjumpsuitcigarette smokingmurder spreebloody violencedeeply disturbed persongraphic violence β€¦extreme violencefemale victimbutcheryserial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countslaughterbutcherrampagegrindhousepsychostabbed in the stomachmutilationmaniacsplattermurdererstalkingthroat slittingstabbingflashlightsubjective cameravoyeurneighborshootingtelephone callchaseknifefemale nuditybare breastsviolencebloodf ratedfemale frontal nudityflashbackmasturbationdoggunphotographlesbian kisssurprise endingshowerdreamcorpsemirrorurinationshot in the headshotgunslow motion sceneriflesunglassesbedcar crashdead bodylow budget filmbathroomtelephoneshot in the backdecapitationsurvivalbound and gaggedaxemassacreimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitdeath of sondeath of husbandsleepingeuropekillingblood spatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivorsevered handstrangerrape victimfollowing someonerapistfemale killerrednecktensionsurveillance cameramobile phonegash in the facemental hospitalplot twistperversionmurder of a childswingclassmateaxe murdersexual assaultkilling spreeparrotdead dogbeing followedpervertblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a dogfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanmurder of wifefilling stationmurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextvineyardchainsdriving at nightdisturbed individualbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murderershower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Wolf Creek (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β€¦are after the backpackers find a way to escape. (Read More)

Subgenre:
slasher flicksuspensecult filmindependent filmaustralian horrorsadistic horror
Themes:
insanitybrutalitypsychopathtorturefeardeathmurderkidnappingrapedrinkingdrunkennessescapesadismevilabduction β€¦exploitationcruelty (See All)
Mood:
darknessslashernightgorecar chaseblood and gore
Locations:
carbarbeachrestaurantswimming poolhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β€¦australian outbackcar on fireshed (See All)
Characters:
slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilationmysterious villainmysterious killer
Period:
year 1999
Story:
homicidal maniacpsycho terrorpsycho killerbroken glassgrindhouse filmcar accidentvillain not really dead clichepsychopathic killersadistic psychopathcar troubleblood splatterknife murdercigarette smokingmurder spreebloody violence β€¦deeply disturbed persongraphic violenceextreme violencebutcheryfemale victimserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebloodbathbody countslaughterbutchermercilessnessrampagehomicidepsychomutilationmaniacmurdererstabbed in the backattempted murderprologuestabbed to deathstabbingflashlightvoyeurshot in the chestchaseknifeexplosiontwo word titlekissviolenceblooddoggunphotographtitle spoken by charactersingingpartybased on true storysongcorpseshot to deathmirrorurinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomguitarshot in the backf wordswimminggay slurbound and gaggedmassacrevideo cameraimpalementfalse accusationcontroversyvanpainflash forwarddangerumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigfirst partobscene finger gesturedismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangervictimhome movierapistrednecksufferingsevered fingergunshot woundfallblood on shirtperversionrainstormcapturecliffminetied feetopening a doorsexual assaultkilling spreedrugged drinkreflectionpervertbarking dogcrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on firemeteorcamcorderfilling stationoverturning carbriton abroadcaravantied up while barefootwaking upsole survivorkangaroocar rollovermass murdererdriving at nightdisturbed individualexploitation filmsoutherncaptivitycreepguard dogends with texttauntingcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Split (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
psycho thrilleramerican horrorsuspenseblack comedysuperherotragedysurvival horrorteen horrorpsychological thriller
Themes:
insanityparanoiabrutalitypsychopathvoyeurismfearmurderdeathfriendshipsurrealismkidnappingrapebetrayalescapefuneral β€¦monsterdeceptiondeath of fathermental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
police cartrainforesttaxiwoodskitchenapartmenttaxi drivermuseumtunneltrain stationart museum
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolice officerteenage girlteenagerfather daughter relationshipafrican americandoctorhostagesecurity guardpsychiatrist β€¦uncle niece relationshippolice dog (See All)
Period:
2010s
Story:
homicidal maniacpsycho terrorpsycho killerhypodermic needlepsychopathic killersadistic psychopathbloody violencedisturbingboom boxsinisterfemale victimserial murderhuman monsterbad guycharacters killed one by one β€¦body countdark pastmercilessnessrampagepsychocaucasianwalkie talkiemaniacmurdererstalkinginjectioncharacter's point of view camera shotattempted murderstalkerold womannews reportnecklaceambulanceflashlightsubjective cameravoyeurneighborsecond partwatching tvshot in the chestchaseknifeviolencebloodsequelone word titleflashbackdogbare chested maledancingtitle spoken by characterpartysurprise endingpantiescell phonecorpseshot to deathshotgunrescuecomputerwritten by directorpaintingrifleheld at gunpointbirthdayriversurvivalorphanbedroomdeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partytransformationtrainingdangermissing persontentevil manknocked outbaseball batflowersscartragic eventhigh school studentbasementlaptoploss of fathersuspicionkillingrevelationheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivehuntertherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskpump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalpower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerkilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actormental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite braschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualcreepabusive mothervideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayweirdoflesh eatingdead teenagercaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
slasher flickamerican horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationbody horrorurban fantasy
Themes:
traumainsanitybrutalitypsychopathfeardeathmurderfriendshiprapeghostpregnancymonsterinvestigationsupernatural powerdepression β€¦sadismevil (See All)
Mood:
slashergorenightmare
Locations:
carhospitalchurchswimming poolmotorcyclewatercar on firedeath in a car accident
Characters:
slasher killerserial murdererserial killerterrorvillainkillernurseboyfriend girlfriend relationshipteenagerfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriend β€¦doctorboyfemale protagonistgirlbabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmgrindhouse filmcar accidentserial teen killerpsychopathic killersadistic psychopathblood splatterhit by a carsequel to cult filmdrive in classicmurder spreeboogeyman β€¦demonicbloody violencemidwestdripping bloodserial murderslashingmysterious manbad guymadmancharacters killed one by onebody countdark pastdisfigurementslaughterhot tubback from the deadrampagelifting someone into the airmutilationmaniacsplattermurdererstalkingscreamscreamingpart of seriesaccidentstabbingambulanceflashlightgood versus evilshootingwatching tvcryingtelephone callchaseknifefemale rear nudityfemale nuditybare breastssexviolencenuditysequelbloodf ratedflashbackbare chested malegunphotographpartysurprise endingpistolshowertopless female nuditydreamfoodslow motion scenebare buttfalling from heightplace name in titlebedcar crashdemonhallucinationfoot chasedisguisedeath of friendimpalementdinerweaponapologynunchilddream sequencedrawingunderwater scenetransformationpaingunshotlibrarydangerlocker roomfantasy sequencechampagnepossessiondollevil manskeletonautomobilepremarital sexsevered armhaunted housedismembermentkillingredheadundeadfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicniccelebrationmental institutiondamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardingmurder of a childbarefoot femalegay stereotypeasylumfifth partkilling spreepsychoticnewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthmental patienttaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipoplocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerpsychotronic filmwet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of loverultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facemidnight moviestreet in titleboiler roomsadistichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathkilled in a car accidentriding a motorcyclechild born of rapesleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

The Texas Chain Saw Massacre (1974)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
psycho thrillerslasher flickamerican horrorsuspensecult filmindependent filmblack comedytragedysurvival horrorteen horrorindependent horror
Themes:
madnessinsanityparanoiabrutalitypsychopathtorturefeardeathmurderfriendshipkidnappingescapedysfunctional familysadismevil β€¦exploitationpaniccannibalisminheritancenear death experience (See All)
Mood:
darknessslasheravant gardeambiguous ending
Locations:
wheelchaircarcemeterykitchenfarmroad triptruckgas stationtexascountryback country
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipsbrother brother relationshipbrother sister relationshipteenage boyhostageself mutilation β€¦truck driverself inflicted injury (See All)
Period:
1970syear 1973
Story:
cigarette lighterhomicidal maniachit on the head with a hammerpsycho filmgrindhouse filmmasked villainpsychopathic killermasked killercar troubleblood splatteryelling for helpdrive in classicmurder spreetorturerbloody violence β€¦disturbingsinisterfemale victimbutcheryscareserial murderslashinghuman monsterbad guymadmancharacters killed one by onebloodbathbody counthit on the headbutchermutemercilessnessrampagemasked mangrindhousepsychohammerlifting someone into the airmutilationmaniacsplattermurdererglassesstalkingproduct placementbeaten to deathscreamingnews reportflashlightmaskblondechaseknifeviolencebloodphotographsurprise endingvoice over narrationbeatingcorpseurinationcamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chasebound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardfive word titlegravedangerattackfirst of seriesevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventpigtied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingfreeze framepickup truckchainsawropegothicgroup of friendsbarnloss of friendcookvandalismbeardspiderblockbustercovered in bloodvictimproduced by directorskullhitchhikerhitchhikingfull moonredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibaldark humorpsychotronicescape attemptjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brothersouthern accentclose up of eyeshysteriayellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditsmeatestatetexanabandoned housefarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerapsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womanstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagergeneratorstate in titleboneslifting a female into the airruralhuman skullgrave diggermidnight moviehenremadesadisticscreaming in horrorfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queensickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivedesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
slasher flickamerican horrorcult filmindependent filmteen movieteen horrorindependent horror
Themes:
psychopathmurderrevengesurrealismfuneralsupernatural powerevil
Mood:
slashergorehigh schoolnightmareavant garde
Locations:
cemeterybathtubpolice station
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenage girlboyfriend girlfriend relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipalcoholicpolice chaseself mutilation β€¦mysterious villainpolice lieutenant (See All)
Period:
1980s
Story:
homicidal maniacpsycho terrorgrindhouse filmvillain not really dead clicheserial teen killerpsychopathic killersadistic psychopathblood splatterperson on firedrive in classiccigarette smokingdemonicdisturbinggraphic violencedripping blood β€¦butcheryburnt faceserial murderbad guymadmancharacters killed one by onebody countdisfigurementbutchergrindhousepsycholifting someone into the airelectronic music scoremaniacstalkingcharacter's point of view camera shotstrangulationgood versus evilsubjective cameraviolencebloodbare chested malesurprise endingdreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonefoot chasedeath of friendstabbed in the chesthousecoffeefirst of seriesevil manhangingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female characterfalling down stairsburned alivegothichatcrucifixvictimstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapcellaralarm clockvigilantismloud sexclimbing through a window15 year oldfinger cut offbody bagdeath of boyfriendmaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous lineplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerhanged boysevered facestreet in titleboiler roomremadeevil deadserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween II (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (2009)

Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off  β€¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)

Themes:
murder of a police officerinsanitybrutalitypsychopathdeathsuicideghostdrunkennessevilexploitationhomelessnessdeath of daughter
Mood:
darknessslashergorerainnightmare
Locations:
hospitalhelicopterstrip club
Characters:
serial killermother son relationshipfather daughter relationshiptattoosingerpsychiatristsniper riflecoroner
Story:
homicidal maniaccar accidentserial teen killerpsychopathic killersadistic psychopathdental masksurgical maskmedical maskblood splatterhit by a carjumpsuitmichael myersboogeymandemonicbloody violence β€¦graphic violenceextreme violencefemale victimserial murderslashinghuman monsterbad guycharacters killed one by onebody countrampagehidingmaniacmurdererglassesstalkingstabbed in the backstalkerstabbed to deaththroat slittingstabbingstrangulationflashlighthalloweensecond partmaskshot in the chestchasefemale rear nudityfemale nuditynumber in titlesequelviolencebloodfemale frontal nudityinterviewflashbacksingingpartypistolbeatingdreamcorpseurinationshotgunslow motion scenecamerabookvomitingheld at gunpointcar crashcafehallucinationstripperf worddecapitationbanddeath of friendimpalementstabbed in the chestexploding carlatex glovesflash forwardmicrophoneportraitclownattackevil manhalloween costumescarneck breakingprofanitypizzasurgerykilling an animalwoman with glassescovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthcorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murderkilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexbeheadinggroupg stringreturning character killed offsexual violencehead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseoverturning carstabbed in the facepentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandyshaky camwhite horsethrown through a windshieldsadisticpublic speakinggory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All)

Freddy's Dead: The Final Nightmare (1991) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormalindependent horror
Themes:
insanitypsychopathtorturedeathmurdersurrealismdrugsghostsupernatural powerdeath of mothersadismevilamnesia
Mood:
darknessslashergorerainhigh schoolnightmare
Locations:
small townairplaneroad trip
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfamily relationshipsfather son relationshipfather daughter relationshipteacherself mutilationyounger version of characterdeafnessgerman american β€¦evil father (See All)
Period:
1970s1990s1960s1940s1950s
Story:
homicidal maniacpsycho terrorpsycho killerserial teen killerpsychopathic killersadistic psychopathblood splattersequel to cult filmdrive in classicboogeymanmurder spreedemonictorturerdisturbingbloody violence β€¦midwestbutcheryburnt faceserial murderhuman monsterbad guymadmanbody countdark pastdisfigurementslaughterbutcherback from the deadrampagepsychomutilationmaniacmurdererbeaten to deathstrangulationgood versus evilsubjective camerafireknifebloodsequelviolencef ratedcharacter name in titleflashbackbare chested maletitle spoken by characterpunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguestatueevil manknocked outkicked in the facescene during end creditsexploding bodykillingundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothvictimorphanagerapistcameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childknife throwingraised middle fingerabusive fatherkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actorstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonercameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterlunaticanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a busboiler roomsadisticabusive stepfatherburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
slasher flickamerican horrorcult filmsupernaturalparanormalparanormal phenomenateen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
paranoiabrutalitypsychopathvoyeurismfeardeathmurderfriendshiprevengesurrealismkidnappingghostescapemonstersupernatural power β€¦sadismevilpanicmysterious deathshower murder (See All)
Mood:
darknessslashergorerainhigh schoolnightmarepoetic justice
Locations:
small townbarschoolswimming poolbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicemanteenage girlboyfriend girlfriend relationshipteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationship β€¦mother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipteenage boyteachergirlstudentlittle girlself mutilationdrivergay teacher (See All)
Period:
1980syear 1985
Story:
homicidal maniacpsycho terrorpsycho killergrindhouse filmserial teen murderervillain not really dead clichepsychopathic killersadistic psychopathblood splatterperson on firesequel to cult filmmelting facedrive in classiccigarette smokingmurder spree β€¦demonicboom boxbutcheryburnt faceserial murderslashingbad guymadmanbody countdisfigurementhit on the headbutcherback from the deadrampagegrindhousepsychostabbed in the stomachlifting someone into the airmutilationelectronic music scoremaniacmurdererscreamcharacter's point of view camera shotstabbed in the backscreamingstabbed to deathstabbingsubjective cameravoyeurneighborsecond partwatching tvcryingfiretelephone callchaseknifemale rear nuditymale nuditynumber in titleviolencesequelbloodnuditycharacter name in titlebondagedogbare chested malefightpartysurprise endingshowerdreamdigit in titleunderwearface slapshotgunslow motion sceneundressingbikinibare buttsunglassesplace name in titledead bodynumbered sequeldemonhallucinationclassroomcriminalf wordfoot chasename in titlemassacrebasketballimpalementfootballstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendlocker roompossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodybasementratcharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingwoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musicjoggingmousebarefoot malevisitcovered in bloodsadomasochismteenage protagonistcrying mans&mmale underwearfull moondamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attemptmurder of a childrainstormraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankbroken mirrorbus stopsplit personalitypush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodybreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facestreet in titleboiler roomsadisticclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (2009)

A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β€¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)

Subgenre:
psycho thrillerslasher flick
Themes:
murder of a police officerbrutalitypsychopathtorturemurderdeathrevengedrunkennessdeath of motherevil
Mood:
darknessslashergorehorror movie remake
Locations:
police carforestmotorcycleboatbathtubbicyclewaterwoodslakecampfiretunnelschool busbackwoodssex in a tent
Characters:
serial murdererterrorsheriffvillainkillerteenage girlboyfriend girlfriend relationshippoliceafrican americantattoobrother sister relationshipasian americanmysterious villainblonde girlgirl nudity
Period:
1980s
Story:
homicidal maniacpsycho terrorpsycho killerpool of bloodserial teen murderervillain not really dead clichemasked villainpsychopathic killermasked killersadistic psychopathblood splatterknife murdergraphic violencedripping bloodfemale victim β€¦silhouetteblood stainserial murderslashinghuman monsterbad guycharacters killed one by onebody countstabbed in the eyedisfigurementhit on the headstabbed in the throatrampagemasked manpsychobuttockswalkie talkiemutilationelectronic music scoremaniacstalkingstabbed in the backscreamingprologuestalkerstabbed to deaththroat slittingstabbingstrangulationflashlightmaskblondefiretelephone callchasenipplesfemale rear nudityfemale nuditynumber in titlebare breastsnudityviolencebloodfemale frontal nuditymasturbationdogbare chested malesex scenesurprise endingpistoltopless female nuditywoman on topcorpsedigit in titleurinationremakeshot in the headbare buttdead bodymarijuanahallucinationalcoholswimmingdecapitationbracandletoplessaxemassacrevideo cameradeath of friendimpalementstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingmini skirtmoaningmissing persontentevil manopening action scenedisappearancepremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned alivemachetescene during opening creditscaptivecampcovered in bloodrear entry sexgrocery storenew jerseybackpackpower outageconvenience storenipplestabbed in the headstabbed in the legjumping through a windowperversioncellphonebody landing on a caraxe murdersevered legarrowburned to deathpsychoticmannequinplantvillain played by lead actorbeheadingporn magazinestabbed in the handbongcanoestaircaseabandoned houserear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexno title at beginningbroken mirrornude girlbaseball capheld captiveday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removingopen endedcheating boyfriendmurderessspitting blooddeformitytelevision setold housenakedstupid victimjerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All)

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β€¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
american horrorsuspenseindependent filmindependent horrorsadistic horrorslasher horrorhorror b movie
Themes:
murder of a police officerinsanitybrutalitypsychopathtorturedeathmurderescapesadismevilhome invasionexploitationcruelty
Mood:
slashernightgoreblood and gore
Locations:
strip clubtrying to escape
Characters:
serial killerterrorvillainkillerteenage girlteenagerhusband wife relationshipfather daughter relationshipmother daughter relationshiphostagethiefself mutilationtalking to oneself in a mirrormysterious villainthe family β€¦mysterious killerkiller dogdirector of photography (See All)
Story:
homicidal maniacpsycho killermultiple homicidegrindhouse filmmasked villainpsychopathic killermasked killersadistic psychopathblood splatterhit by a carcigarette smokingmurder spreedeeply disturbed personbutcherycigarette β€¦serial murderslashinghuman monsterlightermysterious manbad guycharacters killed one by onebloodbathbody countstabbed in the eyeslaughterbutchermercilessnessrampagemasked manhomicidepsychohidinghammermutilationmaniactrapscreamscreamingstabbed to deathstabbingflashlightgood versus evilknifenipplesfemale nuditytwo word titlebare breastsviolencebloodcharacter name in titlefemale frontal nudityflashbackfightlesbian kisssurprise endingpistolbeatingcorpsemirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffssurvivalfoot chasegay slurimpalementstabbed in the chesthousetied to a chairscantily clad femalechild in perildangerelectrocutiondebtevil manactor shares first name with characterisolationneck breakingfirst partthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackeaten alivewoman in jeopardyburglartrappedsevered fingermobile phoneburglarygash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endknife throwinggasolineboxpsychoticdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirewifestabbed in the handset upconstruction workerpistol whipvery little dialogueacidclimbing through a windowself defensehead bashed inpredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodsheddead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firedragging a bodyviolent deathex wifeexploitation filmcrime spreecaptivityclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

Halloween 5 (1989) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween 5 (1989)

It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation  β€¦at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)

Subgenre:
slasher flickamerican horrorindependent film
Themes:
fearmurderdeathfriendshipescapeevilself sacrifice
Mood:
darknessslasher
Locations:
police carcarhospitalforestbathtubbuspolice stationrunning in the forest
Characters:
slasher killerserial killervillainpolice officernursepolicefrienddoctorgirlpsychiatristuncle niece relationship
Period:
1980s20th century
Story:
masked villainserial teen killermasked killerjumpsuitboogeymanmichael myersscareglassserial murderhuman monsterbad guylightbody countdead manpresumed dead β€¦masked manlifting someone into the airhidingsplattermurderertrapstalkingscreamcharacter's point of view camera shotattempted murderscreamingstabbingambulancegood versus evilsubjective camerahalloweenmaskcryingchaseknifeexplosionnumber in titlesequelkissbloodviolencecharacter name in titledoggunphotographpartysurprise endingmirrorcatfalling from heightrunningcandledeath of friendweaponexploding carchildanimalcoffinchild in perilpolice officer killedtreedangercostumebracelethangingautomobilethreatneck breakingrathateholidayropehuggingheroinelooking at oneself in a mirrorslow motionbarnloss of frienddeath threatpsychotronicscissorsstairsfieldlaughingfifth partsequel to cult favoritekilling spreepumpkinsirendead dogreflectionpetpresentyellingtablereturning character killed offlaundrydead animalold dark housediscoveryclimbingkittenlocked doorhanged mancapepitchforkscythemass murdererliquidstabbed with scissorssittingemergencydustlight bulbpolice officer knocked unconsciouscarrying someonelifting a female into the aircrawlingpleadingcrying childunmaskingopening a windowstringcult film referencestrawpink dresstrailer narrated by don lafontaineattempted child murderpolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween 4: The Return Of Michael Myers (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween 4: The Return Of Michael Myers (1988)

It's October 30, 1988 and Michael Myers has been in a coma since his pursuit of Laurie Strode, 10 years ago, was finally stopped (events of H1 and H2). However when he is transfered from Richmond Mental Institute to Smith's Grove he awakes when he hears that he has a niece in Haddonfield and after k β€¦illing the transfer crew he escapes. In Haddonfield, the niece, Jamie, has been adopted by the Carruthers family but keeps having nightmares about Michael (but she doesn't know who he is). On Halloween night, Jamie goes out trick and treating, little knowing that her murdering Uncle is following her and her step-sister Rachel. Rushing to her aid is Dr. Loomis and with the help of Sheriff Meeker starts to search the town for Michael and to find Jamie to protect her. But can anything stop Michael this time? (Read More)

Subgenre:
slasher flickholiday horroramerican horrorcult filmindependent film
Themes:
psychopathmurderevilpanic
Mood:
slashernightgore
Locations:
small towncarschoolpolice stationrooftop
Characters:
slasher killerserial killerteenage girlteenagergirlsister sister relationshipmysterious villaincrying girl
Period:
1980syear 1988
Story:
homicidal maniacpsycho killersmall town sheriffvillain not really dead clichemasked villainpsychopathic killermasked killerhit by a carknife murderteenager in dangeroctoberjumpsuitmichael myersboogeymanmurder spree β€¦escaped mental patientkiss on the lipsserial murderhuman monstermadmancharacters killed one by onebody countmanhuntrampagelifting someone into the airmaniaccharacter's point of view camera shotsearchpart of seriesthroat slittingambulanceflashlightgood versus evilsubjective camerahalloweenmaskshot in the chestknifenumber in titlesequelbloodcharacter name in titledoggunsurprise endingdigit in titlefalling from heightnumbered sequelimpalementanimalpolice officer killedelectrocutionevil manhalloween costumepickup truckfalling down stairsfourth parthitchhikingpump action shotgunchild's point of viewseven word titlepower outageattickilling spreedead dogreturning character killed offtrick or treatingalarmelementary schoolteasingmatchillinoisoff screen murdercrime spreelifting female in airfalling off a rooffoster childlifted by the throatwalking stickniecechild murdererlifting male in airscarred facehalloween prankdeath by electrocutionskull crushingpiggy back ridescreaming girl7 year oldthrown through a glass doorexploding gasoline stationdolly zoomfather dislikes daughter's boyfriendtrailer narrated by don lafontainetrapped in a housereturn to hometownnightmare sequencelimping mannumber 4 in titlegirl in dangersmashing a windowkilling the wrong personsanitorium31 year oldpurposely hit by a car10 years latersprayed with fire extinguisherejected from a moving vehiclefoster sistergirl hits a boygas station explosionhit on the head with a gun buttteenager murderedhitching a rideejected from a moving carpunch catch (See All)

Child's Play 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play 2 (1990)

Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β€¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)

Subgenre:
psycho thrilleramerican horrorblack comedysupernatural
Themes:
psychopathdeathsupernatural powerevil
Mood:
slashergoreraincar chase
Locations:
chicago illinoisschool buswater gun
Characters:
slasher killerserial murdererserial killerterrorvillainkillerpolicehusband wife relationshipboyteachernew student
Period:
1990s
Story:
homicidal maniacpsycho terrorpsycho killerpsycho filmcar accidentvillain not really dead clichepsychopathic killersadistic psychopathcigarette smokingbloody violencemidwestdripping bloodbutcheryburnt facebad guy β€¦madmanbody countstabbed in the eyeeye gougingbutcherpsycholifting someone into the airmaniacmurdererbeaten to deathstabbed to deaththroat slittingambulancestrangulationsecond partbloodsequelsingingpunctuation in titlecorpsedigit in titleslow motion scenefalling from heightheld at gunpointapostrophe in titlefoot chasebound and gaggedstabbed in the chesttied to a chairfalse accusationchild in perillimousineelectrocutionpossessiondollevil manlightningdeath of husbandbasementneck breakingthreatened with a knifeobscene finger gesturefalling down stairsburned alivegothictied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windowswingraised middle fingersocial workersevered legsequel to cult favoritevoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downhead bashed inactress shares first name with characteryuppiesewing machineorchestral music scorehiding under a beddigging a gravelocked in a roomliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homethrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All)

The Dead Zone (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
psycho thrilleramerican horrorsuspensecult filmindependent filmsupernaturaltragedyparanormalparanormal phenomenacanadian horror
Themes:
murder investigationmadnessparanoiapsychopathfearmurderdeathlovesurrealismsuiciderapechristmasinvestigationdeceptionsupernatural power β€¦death of motherblackmaildeath of wifepanicapocalypsedisabilityunlikely heronuclear holocaust (See All)
Mood:
slasherneo noir
Locations:
police carwheelchaircarhospitalschoolchurchsnowtrucktunnelschool teacherfire truck
Characters:
serial murdererserial killersheriffvillainpolice officernurseboyfriend girlfriend relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorteacherphotographerbaby β€¦little boypsychiatristsnipergermanex boyfriend ex girlfriend relationshipsniper rifleself mutilation (See All)
Period:
1970sworld war two1980swinterseeing the future
Story:
homicidal maniacgrindhouse filmserial teen murderercar accidentpsychopathic killerblood splatterdrive in classickiss on the lipsserial murderslashingbad guybody countslaughtermercilessnesspresumed dead β€¦rampagegrindhousemutilationelectronic music scoremaniacmurdererproduct placementattempted murdernews reportaccidentambulanceflashlightgood versus evilrevolverwatching tvshot in the chestfirechaseexplosionfemale nuditybloodkissbased on novelflashbackphotographtitle spoken by charactersurprise endingpistolshootoutdreamcorpseshot to deathrescueslow motion scenebattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffstelephonef wordreportermansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killedmarriage proposaldrowningflash forwarddangerprotestwidowerpay phonedeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexcharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmancold waricedestinydesireassassination attemptreference to adolf hitlergothicheavy rainsociopathcomaexploding buildingloss of wifepress conferencesevered handambitioncrime scenevisionevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentteachingswastikacrutchesroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputyreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebobased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipsecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Wrong Turn (2003) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
slasher flicksuspensecult filmindependent filmblack comedyfish out of waterteen moviesurvival horrorteen horrorpsychological thriller
Themes:
murder of a police officerinsanityparanoiabrutalitypsychopathtorturefearmurderdeathfriendshiprevengekidnappingescapehome invasionpanic β€¦cannibalismcouragehuntingwildernessnear death experience (See All)
Mood:
slashergore
Locations:
police carforestbathtubwoodstruckcavegas station
Characters:
slasher killerpolice officerteenage girlboyfriend girlfriend relationshipteenagerteenage boyhostageinterracial relationshipself mutilation
Period:
2000s
Story:
pool of bloodcar accidentvillain not really dead clichecar troubleblood splatterhit by a carperson on firecigarette smokingsinistershot in the eyehuman monsterflat tirecharacters killed one by onesmokebody count β€¦disfigurementmercilessnessstalkingcollege studentstabbed in the backscreamingprologuestalkerstabbed to deathflashlightcryingfirechaseknifeexplosionbloodsexviolencesurprise endingpistolcell phonebeatingcorpseshot to deathshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chasebound and gaggedambushaxemountaindeath of friendtoiletstabbed in the chestmapexploding carsevered headdisarming someonepolice officer killedshot in the legtreedangerfirst of seriesdollscene during end creditsprankfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalpolice officer shotengagementbooby trapaerial shotblood on shirtone daygasolineaxe murdersevered legarrowtank topsouthern accenthit with a baseball batbarbed wiremolotov cocktailjunkyarddead animalold dark housemental retardationarcherydeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadrock climbingstupid victimclimbing out a windowpolice officer shot in the headextreme close upleg woundshot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

Suspiria (1977)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Suspiria (1977)

Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β€¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)

Subgenre:
suspensecult filmindependent filmcoming of ageconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror
Themes:
blindnessparanoiabrutalityvoyeurismfearmurderdeathfriendshipsurrealismdrunkennessescapedancedeceptionsupernatural powerillness β€¦sadismevilunrequited lovecrueltypanicself sacrificemysterious death (See All)
Mood:
darknessslashernightgorerainavant gardestylization
Locations:
schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver
Characters:
killerpolice officerteenage girlteenagerfrienddoctorboyfemale protagonistteachergirlstudentsister sister relationshippsychiatristprofessorwitch β€¦germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All)
Period:
1970syear 1977
Story:
cigarette lighterfragments of glasszippo lighterbroken glassgrindhouse filmhypodermic needlepsychopathic killerblood splatterknife murderdrive in classiccigarette smokingfienddemonicbloody violencegraphic violence β€¦sinistersilhouetteslashingdead woman with eyes openlightdisfigurementshadowstabbed in the throatmutemercilessnessdead womangrindhouseelectronic music scoremurdererinjectioncollege studentscreamcharacter's point of view camera shotattempted murderscreamingprologuestabbed to deaththroat slittingstabbingstrangulationgood versus evilsubjective cameravoyeursecretfiretelephone callchaseknifeexplosionbloodviolenceone word titleflashbackdogdancingsurprise endingvoice over narrationcorpseslow motion scenefalling from heightshowdownbathroompianodemonhallucinationtelephoneswimmingfoot chasewineambushdeath of friendimpalementtoiletstabbed in the chestcoffinrituallegendcharacter repeating someone else's dialoguedangerlocker roommissing personcover uplightninghangingdisappearancesuspicionfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothinggothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodvictimanimal attackschizophreniafull moonreverse footagebloody noseblood on facefemale leadpower outagestabbed in the neckpsychotronicescape attemptheartaerial shotatticblood on shirttitle at the endrainstormnotedressing roomblind manopening a doorroombatpiano playerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaymaggotcoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on fireanimal killingfade to blackghoulglowing eyesnoiseextreme close upwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerhanged womanitalian cinemamale dancerremadestabbed in the heartknife woundprogressive rockwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorsuspensecult filmindependent filmmartial artsblack comedysupernaturalparanormal
Themes:
psychopathmurderrevengefuneralsupernatural powerevil
Mood:
slashergorerainhigh schoolnightmare
Locations:
small townhospitalbeachcemeteryelevatorschool nurseblood in water
Characters:
slasher killerserial murdererserial killerterrorvillainkillerteenagerfather son relationshipfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshiptough guylittle girlwaitress
Period:
1980s
Story:
homicidal maniacpsycho killerserial teen killerpsychopathic killersadistic psychopathblood splatterperson on firesequel to cult filmdrive in classiccigarette smokingmurder spreedemonictorturerdisturbingdripping blood β€¦butcheryburnt faceserial murderslashingneedlebad guydisfigurementbutcherback from the deadrampagestabbed in the stomachlifting someone into the airmutilationelectronic music scoremaniacmurdererglassesstabbed to deathambulanceneighborfirenumber in titlebloodsequelfemale frontal nuditydogbare chested malephotographsurprise endingdreamcorpsedigit in titleurinationface slappunched in the faceplace name in titlerock musiccar crashnumbered sequeldemondeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerpay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of sonunderwatersevered armsleepingkillingundeadpizzasurgeryteen angstslow motionwoman with glasseskicked in the stomachfourth partmovie theatercrushed to deathseriesresurrectionstabbed in the headblack and white scenedaydreamsoulabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorreturning character killed offjunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmabody in a trunkafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestafrican american manoverprotective fatherstreet in titleboiler roomsadisticreference to aristotleserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β€¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
psycho thrillercult filmindependent filmblack comedysadistic horror
Themes:
murder of a police officermadnessinsanityparanoiabrutalitypsychopathseductiontorturefeardeathmurderfriendshiprevengesuicidekidnapping β€¦rapebetrayalescapedeceptionangerdeath of fatherdeath of motherhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitynear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
serial killerterrorsheriffvillainpolice officernurseboyfriend girlfriend relationshippolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshiptattoo β€¦brother brother relationshipbrother sister relationshipprostitutehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
year 19781970s
Story:
cigarette lighterhomicidal maniacmultiple homicidegrindhouse filmpsychopathic killerblood splatterknife murdercigarette smokingmurder spreegraphic violencebutcheryfemale victimserial murderhuman monsterbad guy β€¦madmanbody countdisfigurementslaughterstabbed in the throatbutchermercilessnessrampagemasked mangrindhousestabbed in the stomachcowboy hatmaniacmurdererbeaten to deathstabbed in the backscreamingnews reportstabbed to deaththroat slittingstrangulationrevolversecond partshot in the chestfirechaseknifeexplosionfemale rear nuditymale rear nuditysequelviolencebloodflashbackdogbare chested malesex scenefemale full frontal nudityphotographtitle spoken by characterpantiespistolshowershootoutwoman on topbeatingdreamcorpseshot to deathmachine gunhorseface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeerdead bodylow budget filminterrogationmarijuanajailhandcuffscriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushaxedeath of frienddrug dealerimpalementcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killedcigar smokingshot in the legshot in the foreheadracial sluron the runclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencehead buttmass murderlooking at oneself in a mirrorscene during opening creditsragekicked in the stomachphone boothcovered in bloodrapistfemale killerinterracial friendshipgas maskwatching televisionredneckcrime scenestealing a carhatredhit in the crotchcannibalstabbed in the neckescape attemptreference to satanstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterhighwaybulletproof vesttough copknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackingexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticcocaine snortinghouse on firemass murdererevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtcmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation
Themes:
insanitypsychopathmurderdeathghostfuneralmonstersupernatural powersadismevil
Mood:
slashergorenightmare
Locations:
hospitalbarchurchcemeteryschool boy
Characters:
slasher killerserial murdererserial killerterrorvillainkillernurseteenagerfather daughter relationshipmother daughter relationshipdoctortough guylittle girlsingle motherself mutilation β€¦alcoholic fatherevil nurse (See All)
Period:
1980s
Story:
homicidal maniacpsycho killervillain not really dead clicheserial teen killerpsychopathic killersadistic psychopathblood splatterteenager in dangerdrive in classiccigarette smokingboogeymanmurder spreedemonicbloody violencedisturbing β€¦butcheryburnt facescalpelserial murderslashingbad guymadmancharacters killed one by onesmokebody countstabbed in the eyedisfigurementbutchermuteback from the deadrampagelifting someone into the airelectronic music scoremaniacsplattermurdererstabbed in the backscreamingstabbed to deathstabbingfirefemale nuditynumber in titleviolencesequelbondagebare chested malesurprise endingdreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperdeath of friendimpalementsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguepuppetpay phonedollevil manskeletonisolationbasementcharacter says i love youkillingundeadfalling down stairsteen angstcomaragetied to a bedcrucifixvictimclockdrug overdoseswitchbladetrappedwindfalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogkilling spreepajamasalleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyboy with glassesbody in a trunkone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerboneslifting a female into the airbad motherhanged boysedativestreet in titleboiler roomforced suicidesadisticsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Scream 2 (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 2 (1997)

Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list  β€¦of suspects goes down. (Read More)

Subgenre:
slasher flicksuspensecult filmblack comedyconspiracypost modernteen movieteen horrorhorror spoof
Themes:
murder of a police officerinsanityparanoiapsychopathvoyeurismfearmurderdeathloverevengebetrayaldrunkennessescapeinvestigationdeception β€¦sadismtheatrenear death experience (See All)
Mood:
slashergoresatire
Locations:
police carhospitalbicyclepolice stationfire truck
Characters:
serial killerkillerdetectivepolice officerboyfriend girlfriend relationshipteenagerpolicefemale protagonisthostagepolice detectiveex boyfriend ex girlfriend relationshipself referential
Period:
1990s
Story:
car accidentvillain not really dead clichemasked killerblood splatterhit by a carcigarette smokingcharacters killed one by onebody countstabbed in the throatmercilessnesspresumed deadmasked manstabbed in the stomachtv newsstalking β€¦college studentscreamproduct placementstabbed in the backattempted murderscreamingstalkernews reportnecklacestabbed to deaththroat slittingstabbingambulanceflashlightgood versus evilvoyeursecond partmaskbrawlwatching tvshot in the chestchaseknifenumber in titlekissbloodviolencesequelf ratedinterviewbare chested malesingingpartysurprise endingpistolcell phonebeatingcorpsedigit in titleshot to deathurinationface slapshot in the headrescueslow motion scenepunched in the facecomputershowdownheld at gunpointsunglassescar crashcollegehallucinationtelevisiontelephonef wordreportersurvivalfoot chasegay slurbedroomjournalistambushaxevideo cameradeath of friendimpalementstabbed in the chestinternetfalse accusationno opening creditsdisarming someonedouble crosspolice officer killedvanshot in the legshot in the foreheadracial slurlibraryauthorcharacter repeating someone else's dialoguemicrophonecostumeattackpay phonestatuecover upknocked outkicked in the facelightningprankscarbodyguardfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendscrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentaryfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction siteevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplayethnic slursequel to cult favoritekilling spreemedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

P2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

P2 (2007)

The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.

Subgenre:
psycho thrillerslasher flickholiday horrorsuspenseindependent filmblack comedypsychological thrillerchristmas horror
Themes:
madnessinsanityparanoiaobsessionpsychopathfearmurderdeathrevengekidnappinginfidelitychristmasbetrayaldrunkennessescape β€¦investigationdeceptionlonelinessmental illnesssurveillanceabductioncrueltypanicnear death experience (See All)
Mood:
darknessslashergoreneo noircar chaseone night
Locations:
police carcarnew york citysnowwatertaxielevatorurban settingcityoffice
Characters:
slasher killerpolicemanpolice officerpolicefemale protagonisthostagesecurity guardpolice detectivemysterious villain
Period:
winter
Story:
murder witnesscar accidentcar troubleblood splatterhit by a carperson on firesleeping womandeeply disturbed personfemale victimflat tirecharacters killed one by onebody countstabbed in the eyedead manmaniac β€¦stalkingcharacter's point of view camera shotproduct placementattempted murderstabbed in the backscreamingstalkerstabbingambulancestrangulationflashlightsubjective cameravoyeurbrawlcryingfiretelephone callchaseknifeexplosionnumber in titleviolencebloodone word titledogfightpartysurprise endingcell phonehigh heelsbeatingcorpsedigit in titlefistfightmirrorpunched in the faceplace name in titlerunningcar crashhandcuffsmanhattan new york cityf wordcleavagesurvivalfoot chasenewspaperbound and gaggedwineaxevideo camerawomantied to a chairnonlinear timelineexploding carfalse accusationapologydouble crossduelargumentorganized crimeelectrocutionattackknocked outkicked in the facechristmas treeattempted rapebodyguardexploding bodyisolationdie hard scenarioobscene finger gesturerecord playerholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtone daybuildinggasolinelonerduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abusedead dogintimidationintestinesreference to elvis presleyaccountantyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldersexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturewhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forkclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All)

Jason X (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason X (2001)

Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks  β€¦the colonists in a whole new environment. (Read More)

Subgenre:
suspenseindependent filmmartial artsblack comedydark comedyb movieabsurdismfish out of waterteen horror
Themes:
paranoiabrutalitypsychopathfeardeathmurderescapemonstermilitarysupernatural powerself sacrificeartificial intelligencespace travelclaustrophobia
Mood:
slashergoreambiguous ending
Locations:
woodslakeouter spacelaboratoryspace stationresearch stationship explosion
Characters:
terrorvillainboyfriend girlfriend relationshipteenagerdoctorteachersoldiertough guyteacher student relationshipprofessorengineerbabe scientist
Period:
2000s
Story:
hypodermic needlevillain not really dead clichemasked villainpsychopathic killermasked killerblood splattersequel to cult filmroman numbered sequelextreme violencefemale victimslashinghuman monstermadmancharacters killed one by onedisfigurement β€¦slaughterautopsypresumed deadback from the deadrampagemasked manstabbed in the stomachcowboy hatmutilationelectronic music scorestalkinginjectionbeaten to deathstabbed in the backprologuestalkerstabbed to deaththroat slittingstrangulationflashlightmaskshot in the chestfirechaseknifeexplosionnipplesfemale nuditynumber in titlekissbloodviolencesequelcharacter name in titlefemale frontal nudityflashbackbare chested malesex scenefightsurprise endingpistolbeatingcorpseshot to deathfistfightmachine gunface slapshot in the headshotgunrescuepunched in the facecomputerfalling from heightshowdownrifleheld at gunpointhand to hand combatnumbered sequelrobotkung fuscientistshot in the backdecapitationsurvivalambushmassacreimpalementmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotdangerkarateelectrocutionrace against timeevil mankicked in the facetough girlexploding bodyneck breakingthreatened with a knifemercenarysevered armlove interestkissing while having sexdismembermentundeadsurgerysabotagemass murdermacheteroman numeral in titlespacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityandroidcyborgnew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowwisecrack humorblood on shirthologramknife throwingfemale doctorsevered legtank topgatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierface maskfemale fightersummer campcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shouldermicroscopewoman fights a manman wearing glassesmorphinearm cut offmurder of a nude womanarmy basemass murdererstupid victimscience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All)

The Final Girls (2015) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Final Girls (2015)

When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β€¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)

Subgenre:
slasher flickindependent filmteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody
Themes:
brutalityseductionvoyeurismfeardeathmurderfriendshiprevengesurrealismkidnappingescapedeath of mothertime travelbullyingpanic β€¦self sacrificenear death experience (See All)
Mood:
slashersatirespoofhigh schoolparodyambiguous ending
Locations:
hospitalforestwoodssinging in a car
Characters:
slasher killerserial killerkillernurseteenage girlteenagerhomosexualmother daughter relationshipdoctortattooteenage boyfemale protagonistgirlhostagemother β€¦ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All)
Period:
1980syear 1986year 1987
Story:
cigarette lighterzippo lighterlighting a cigarettegrindhouse filmcar accidentmasked killerhit by a carperson on fireopening creditscigarette smokingcigarettecharacters killed one by onebody countdark pastdisfigurement β€¦mercilessnesspresumed deadmasked manelectronic music scorescreamattempted murderstabbed in the backscreamingprologuebrunetteaccidentstabbed to deathgood versus evilvoyeurblondeshot in the chestfirechaseknifeexplosiontwo word titleviolenceflashbackbare chested maledancingthree word titlesurprise endingpantiescell phoneshot to deathrescueslow motion sceneundressingvomitingshowdowncar crashf worddecapitationcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementdinerstabbed in the chestwhite pantiesexploding cardrivingsevered headscantily clad femaledouble crossvanflash forwardvirgindangerstripteaserace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowmacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitytarget practiceplayboy magazineescape attemptblack and white scenejumping through a windowblack and whitebooby trapknife fightfogknife throwinggasolinegeekteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedone linerman kills a womanretrowoman kills a manjocksole black character dies clicheopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowwalkmanfirecrackervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Maniac (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maniac (2012)

Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession  β€¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)

Themes:
psychological traumainsanityobsessionbrutalitypsychopathtorturefearmurderdeathlonelinessdepressiondrug usesadismunrequited lovephotography β€¦childhood trauma (See All)
Mood:
slashergoreneo noir
Locations:
restaurantlos angeles californiasex in public
Characters:
serial killerterrorvillainkillerhomosexualmother son relationshiptattooprostitutephotographermysterious villain
Period:
1980s2010s
Story:
psychopathic killerblood splatterhit by a carknife murdermurder spreeextreme violencedripping bloodfemale victimserial murderslashinghuman monsterstorebad guyconfusiondead woman with eyes open β€¦dark pastrampagemaniacstalkingstabbed in the backnews reportnecklacestabbed to deathstrangulationsubjective cameravoyeurneighborknifefemale rear nudityviolencebloodone word titlethreesomeflashbackphotographcell phonecorpseurinationremakecomputercameravomitingcar crashbathroomhallucinationfoot chasebound and gaggedwinecocainestabbed in the chestsubwaychild abusebreast fondlingvanlooking at the cameratalking to the cameracharacter repeating someone else's dialogueevil mankicked in the facetragic eventthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingpillsrejectiondeath of protagonistdisembowelmentwedding dresstied feetnervous breakdownsevered legmisogynymannequinwoman in bathtubvillain played by lead actorsuffocationstabbed in the handhiding in a closetsubway stationsexual perversionbroken mirrorwoman in bra and pantiesballerinatattooed womanmeat cleavertied up while barefootstrangled to deathschizophrenicbreaking through a doormurder of a nude womanonline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All)

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedydark comedysurvival horror
Themes:
insanitypsychopathmurderdeathkidnappingdeceptionincestmental illnesssadismevilhome invasiongreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
darknessslashergoresatiresocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
homicidal maniacpsycho terrorpsycho killerscalding watergrindhouse filmpsychopathic killersadistic psychopathblood splattercigarette smokingmurder spreedeeply disturbed personserial murderslashinghuman monsterlighter β€¦bad guymadmanbody countstabbed in the throatrampagemasked mangrindhousepsychostabbed in the stomachmutilationmaniacflashlightsecretshot in the chestknifeviolenceblooddogtitle spoken by characterpistolcorpseshot to deathface slapshotgunbirthdaymansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragespidersevered handskullsadomasochismsevered fingerhit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordgothperverthiding in a closetold dark houseschemeevictionfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mandisturbed individualstarvingmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogskull ring (See All)

Scream (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream (1996)

1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β€¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)

Subgenre:
slasher flicksuspensecult filmcoming of ageblack comedyconspiracypost modernteen movieteen horrorpsychological thrillerhorror spoof
Themes:
paranoiabrutalitypsychopathfearmurderdeathfriendshiprevengeinfidelitybetrayaldrunkennessescapeinvestigationextramarital affairdivorce β€¦death of motherhome invasionnear death experiencedeath of daughter (See All)
Mood:
darknessslashergoresatirehigh school
Locations:
small townforestwoodskitchenpolice stationschool bus
Characters:
slasher killerserial killersheriffvillainkillerteenage girlboyfriend girlfriend relationshippoliceteenagerfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationship β€¦teenage boyfemale protagonistsingle fatherself referential (See All)
Period:
1990s
Story:
car accidentvillain not really dead clichemasked killerblood splattercigarette smokingrobecharacters killed one by onepresumed deadmasked manhomicidelifting someone into the airstalkingscreamcharacter's point of view camera shotproduct placement β€¦stabbed in the backstalkernews reportbrunettestabbed to deaththroat slittingambulanceflashlightsubjective cameramaskwatching tvblondeshot in the chestfirechaseknifeviolencebloodf ratedone word titlebare chested maletitle spoken by characterpartysurprise endingpistolcell phonecorpseshot to deathface slapshot in the headrescueslow motion scenepunched in the facecomputercatarrestfalling from heightshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsurvivalfoot chasebound and gaggedcaliforniadisguisedeath of friendstabbed in the chestweapontied to a chairfalse accusationno opening creditsdisarming someonevanshot in the foreheadvirgindangersuburbwidowerelectrocutionfirst of serieshangingprankshot in the shoulderamerican flaghigh school studentcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinegroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reporterframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hills Have Eyes 2 (2007) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β€¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
insanitypsychopathtorturedeathmurderrevengesuiciderapeevilcannibalismrape and revenge
Mood:
slashergore
Locations:
desertwaternew mexico
Characters:
slasher killerserial killerterrorvillain
Period:
year 2007
Story:
homicidal maniacpsycho killergrindhouse filmpsychopathic killersadistic psychopathblood splatterbloody violencegraphic violenceextreme violenceserial murderhuman monsterbad guymadmannude woman murderedbody count β€¦accidental killingrampagepsychomaniacsplatterbeaten to deathstabbed in the backstabbed to deathstabbinggood versus evilshot in the chestfireexplosionfemale nuditybare breastsnuditysequelfightsurprise endingpistollickingcorpseshot to deathremakeshot in the headfalling from heightriflenumbered sequelf wordsurvivalgay slurarmyimpalementstabbed in the chesttrainingevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentropeclaim in titlemutantrageassaultaccidental deathbroken legguardsevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamitemineaxe murderkilling spreetorso cut in halffemale soldierblood on camera lensintestinesgiving birthstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathstabbed in the facedrillunwanted pregnancydeformitypsychotronic filmsledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

Bride Of Chucky (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bride Of Chucky (1998)

Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.

Subgenre:
cult filmblack comedyconspiracysupernatural
Themes:
murder of a police officerparanoiabrutalitypsychopathseductionfearmurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayal β€¦pregnancyescapeweddingdeceptionrobberysupernatural powerredemptionsadismunrequited lovepanicpolice brutalitypolice corruptionnear death experienceregret (See All)
Mood:
slashergorecar chasepoetic justice
Locations:
police carhotelcemeterybathtubwaterkitchenpolice stationroad tripmotel
Characters:
serial killerdetectivepolice officerteenage girlboyfriend girlfriend relationshipteenagerpolicehomosexualtattooteenage boypriesthostagethiefpolice detective β€¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All)
Period:
1990s
Story:
cigarette lighterhomicidal maniacfragments of glasscar accidentvillain not really dead clichemultiple stabbingblood splatterhit by a carknife murdercigarette smokingmurder spreemultiple murderburnt facelighterdead woman with eyes open β€¦disfigurementpresumed deadback from the deadmutilationmaniacstalkingattempted murderstabbed in the backscreamingstalkernews reportthroat slittingstrangulationflashlightrevolverwatching tvshot in the chestcryingfirechaseknifesexsequelviolencebloodkisscharacter name in titlebare chested malegunfightphotographsurprise endingpistolcell phonebeatingcorpseshot to deathmirrorrescueslow motion scenebare buttlettershowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffstelephonef wordorphanambushmansionmontagebridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawingdouble crossritualpolice officer killedvanfemme fatalegraveyardmarriage proposalon the runargumentcharacter repeating someone else's dialoguedangerlocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outbaseball batlightningskeletonringscarfishnet stockingsfilm within a filmchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragetoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killermale underwearwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormknife throwingraised middle fingertrailertied feetsequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturepolice chieftelling someone to shut updisposing of a dead bodytrailer homeframedmasturbation referencebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated lineamuletrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victiminnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murderrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All)

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β€¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
american horrorcult filmindependent filmsadistic horror
Themes:
madnessinsanitybrutalitypsychopathseductionvoyeurismtorturedeathmurderrevengesuicidekidnappingrapeescapeinvestigation β€¦humiliationsadismevilabductioncrueltyvengeancerape and revengerape and murder (See All)
Mood:
slashernightgorehigh schoolnightmare
Locations:
carswimming poolforestcemeterylakerunning through the woods
Characters:
slasher killerserial murdererserial killerterrorsheriffvillainkillerteenage girlpolicefamily relationshipsfather son relationshipreference to godself justice
Period:
1970s
Story:
homicidal maniacserial teen murdererserial teen killerpsychopathic killersadistic psychopathblood splatterhidedrive in classicbloody violencedisturbinggraphic violenceserial murderhuman monsterbad guymadman β€¦dead girlbloodbathneighborhoodgrindhousemutilationmaniacmurdererstabbed in the backscreamingnecklacebathstabbed to deaththroat slittingstabbingvoyeurshootingknifefemale rear nudityfemale nudityviolencebloodfemale frontal nuditydoggunfightfemale full frontal nuditypantiesshowershot to deathurinationremakebeerbirthdaymarijuanafoot chasebound and gaggedgangconcerttoiletfemale pubic hairwhite pantiesscantily clad femalecontroversycigar smokinglatex glovespublic nuditydrug addictsuburbelectrocutionevil manringconvertiblefemale removes her clotheschickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamvictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showershot multiple timespervertprayingcannabisforced to striprunning awayspit in the facemisogynistphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthreading a newspaperchild molesterbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmsex offenderforced suicidesadisticstabbed in the bellyhands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hills Have Eyes (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes (2006)

While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β€¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)

Subgenre:
psycho thrillertragedy
Themes:
madnessbrutalitypsychopathtorturedeathmurderrevengesuicidekidnappingrapedeath of fatherdeath of mothersadismevildeath of wife β€¦cannibalismself sacrificemurder of familyghost town (See All)
Mood:
slashergorehorror movie remake
Locations:
desertcavegas stationsuv
Characters:
serial killerterrorvillainkillerteenage girlfamily relationshipsbrother sister relationshipteenage boybaby
Period:
year 2006
Story:
homicidal maniaccar accidentvillain not really dead clichepsychopathic killerblood splatterperson on firebloody violencegraphic violenceextreme violencecutserial murderhuman monsterbad guymadmanbody count β€¦stabbed in the throatrampagehomicidewalkie talkiemutilationmaniacsplattermurdererglassesstabbed in the backrevolvershot in the chestviolenceblooddogsurprise endingpistolshot in the headshotgunfalling from heightcar crashfoot chaseaxeimpalementstabbed in the chestexploding carsevered headcontroversyshot in the foreheadvacationevil manbaseball batamerican flagfirst partsevered armdismembermentkillingclaim in titleburned alivekilling an animalmutantragevictimrapistsevered fingercannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailermineaxe murdermutationsevered legkilling spreedeath of loved onemannequinhysteriacrucifixionex copkilldead animalkilling a doghead blown offgerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyminersiblingstabbed in the facecut into piecesdeformitystupid victimheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All)

Scream 3 (2000) is one of the best movies like Halloween II (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 3 (2000)

A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.

Subgenre:
independent filmmartial artsblack comedypost modernhorror spoof
Themes:
paranoiabrutalityvoyeurismfearjealousydeathmurderrevengekidnappingbetrayaldrunkennessescapefilmmakinginvestigationdeception β€¦theftcelebrityhome invasioncourage (See All)
Mood:
slashergoresatirenightmare
Locations:
police carbarswimming poolhelicopterlos angeles californiaapartmentpolice station
Characters:
serial killerkillerdetectivepolice officerboyfriend girlfriend relationshippolicefather daughter relationshipbrother sister relationshipfemale protagonistactorhostageactresssecurity guardpolice detectivefilm director β€¦ex boyfriend ex girlfriend relationshipdeath of girlfriendself referentialpregnant from rape (See All)
Period:
1990s2000s
Story:
car accidentvillain not really dead clichemasked killerblood splattersequel to cult filmcigarette smokinglightercharacters killed one by onestabbed in the throatmercilessnesspresumed deadmasked manstabbed in the stomachstalkingscream β€¦beaten to deathstabbed in the backscreamingstalkernews reportstabbed to deaththroat slittingambulancestrangulationflashlightrevolvervoyeurmasksecretbrawlwatching tvshot in the chestchaseknifenumber in titlesequelbloodviolencef rateddogbare chested malefightphotographpartysurprise endingpistolshowercell phonebeatingcorpsedigit in titleshot to deathfistfightshot in the headrescuepunched in the facefalling from heightshowdownheld at gunpointsunglassesbirthdaycar crashhallucinationhandcuffsshot in the backf wordreportersurvivalfoot chasejournalistbound and gaggedambushmansiontoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partshot in the legmarriage proposalshot in the foreheadracial slurcharacter repeating someone else's dialoguecostumerace against timecover upknocked outkicked in the facetough girlbaseball batprankshot in the shoulderbodyguardfilm within a filmexploding bodyisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dresshollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standofffemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonepartnermovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportersequel to cult favoritekilling spreenewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clubquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimwrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapecounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All)

New Nightmare (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

New Nightmare (1994)

It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β€¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)

Subgenre:
suspensecult filmindependent filmfairy talepost modernpsychological thriller
Themes:
paranoiabrutalityfeardeathmurdersurrealismkidnappingescapefuneralmonsterfilmmakingdeceptiondeath of fathersupernatural powercourage β€¦near death experience (See All)
Mood:
slashergorenightmare
Locations:
wheelchaircarhospitalswimming poolcemeterylos angeles californiawatertrucksinging in a cartruck accident
Characters:
serial killervillainpolice officernursehusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboyactorpriesthostageactresssecurity guarddirector β€¦maidfilm directorself referentialcoroner (See All)
Period:
1990s
Story:
hypodermic needlecar accidentblood splatterhit by a carperson on firehuman monsterstabbed in the eyeeye gougingdisfigurementstabbed in the throatlifting someone into the airelectronic music scorestalkinginjectioncharacter's point of view camera shot β€¦attempted murderscreamingstalkernews reportbrunetteaccidentstabbed to deathstabbingstrangulationgood versus evilblondefirechaseknifeexplosionbloodsequelviolenceinterviewsurprise endingcell phonedreamcorpserescueslow motion scenefalling from heightpaintingvomitingshowdownsunglassesrunningbedcar crashdemonhallucinationtelevisiontelephonefoot chaseambushcaliforniamansiondeath of friendwidowstabbed in the chestsnakeno opening creditsdream sequencechild in periltonguetransformationcoffeeparklimousinecharacter repeating someone else's dialogueactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineburned alivewoundslow motioninjurybabysittermorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundmovie setstabbed in the legfilm settitle at the endalternate realityfemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Halloween II?
<< FIND THEM HERE! >>