Best popular movies like Harry Potter And The Order Of The Phoenix:

Do you need specific genre & keyword selection to find films similar to Harry Potter And The Order Of The Phoenix?
<< FIND THEM HERE! >>

Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry Potter And The Order Of The Phoenix (2007)

The rebellion begins! Lord Voldemort has returned, but the Ministry of Magic is doing everything it can to keep the wizarding world from knowing the truth – including appointing Ministry official Dolores Umbridge as the new Defence Against the Dark Arts professor at Hogwarts. When Umbridge refuses … to teach practical defensive magic, Ron and Hermione convince Harry to secretly train a select group of students for the wizarding war that lies ahead. A terrifying showdown between good and evil awaits in this enthralling film version of the fifth novel in J.K. Rowling’s Harry Potter series. Prepare for battle! (Read More)

Subgenre:
high fantasysupernaturalcult film
Themes:
bullyingevilmagictortureghostchristmasfriendship
Mood:
nightmare
Locations:
englandkitchenelevatorforestschooltrain
Characters:
evil witchevil teacherwitchprofessorteacherteenage boyteenage girlhusband wife relationshipteenager
Period:
year 1996year 1995
Story:
evil wizardchristmas giftfifth in seriesteenage witchfemale professoranimal crueltygood versus evilblack magicmale teacherstrict teacherfemale teachertrain platformboarding schoolchristmas presentflashback sequence …sequel baitingfamily treegodfather godson relationshipscar on the foreheadactor reprises previous roledisciplinary hearinglong haired womanshared universeflying creatureabusive unclecreature attackgovernment ministerprivate lessongreat hallfictitious sportwinged creatureman killedmagical broomstickopening creditsharry pottersecret headquarterstape measurelong haired manrescue operationtwin brotherswoman murders a manshape shiftingsteam locomotivecontrol freakbased on young adult noveltraining montagestudio logo segues into filmchild herocrystal ballcult figurelong haired malesecret roomhalf brotherpsychotronic filmkiss on the lipsnight timeinterracial kisseight word titlesorceryopen endedidentical twinsmale protagonistfemale psychopathsecret societytelephone boothspiral staircasereturning character killed offteleportationfifth partowlfirst kisshandheld camerayoung lovefather figureensemble castbroken glassprophecywizardscotlandplaygroundvisionseriesmasked manteenage protagoniststrong female leadmind controlrebellionphone boothgiantblockbusterloss of loved onewitchcraftenemylifting someone into the airteen angstfireplaceeavesdroppingoccultstrong female characterhatefireworksratschoolgirldarkgifttough girlsuitcasepossessionanimalbirdfalse accusationtrialsnakeprisonerbedroomorphannewspaperclassroominterrogationshowdownbookbattlecatface slapdreamfirephotographcharacter name in titlekissdogflashbacksequel (See All)

Harry Potter And The Half-blood Prince (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry Potter And The Half-blood Prince (2009)

In the sixth year at Hogwarts School of Witchcraft, and in both wizard and muggle worlds Lord Voldemort and his henchmen are increasingly active. With vacancies to fill at Hogwarts, Professor Dumbledore persuades Horace Slughorn, back from retirement to become the potions teacher, while Professor Sn …ape receives long awaited news. Harry Potter, together with Dumbledore, must face treacherous tasks to defeat his evil nemesis. (Read More)

Subgenre:
cult filmteen romancedark fantasy
Themes:
evilmagicchristmasfriendshipmurderdeathloverevengebetrayaljealousydrunkennessdeceptionmemoryguilt
Mood:
rain
Locations:
snowlondon englandvillagecaveoceanschool of magic
Characters:
professorteacherhusband wife relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshiplove triangleteacher student relationshipyounger version of characterboy hero
Period:
year 19961990schristmas partyyear 1997
Story:
evil wizardgood versus evilfictitious sportharry potterbased on young adult novelcult figureinterracial kissopen endedreturning character killed offteleportationbroken glassprophecywizardstrong female leadlifting someone into the air …teen angstfireplaceeavesdroppingstrong female charactertough girlnewspaperbookfirephotographcharacter name in titleflashbackkissbased on novelbloodsurprise endingcorpseslow motion scenefalling from heightfoot chasedeath of friendno opening creditsunderwater scenenecklacelibrarycursepoisondragonkicked in the faceringdiarymanipulationscardisappearancetragic eventpubwerewolfburned alivekilling an animalrevelationlooking at oneself in a mirrororphanageappleinterracial romancehealingdrugged drinkspellinvisibilitylevitationdinner partysports teamsubway stationremorseboy with glassestwin brotherchandelierdripping bloodpotionseizureluckbroken noseorchestral music scoresixth partdead birdheadmastercut handhouse on firelocketevil childgiant spidermagic wandhourglassmagical potionlifting a female into the airsteam traincliffhangerinfirmaryfalse memoryvowbreaking up with girlfriendcabinetfoaming at the mouthwet jeanslove potionclosing credits sequencedrugged foodclosing eyes of dead personring of firebox of chocolateshereditary gift of witchcraftbad guys winfavoritismburnt down housebildungsromanblack male white female relationshipdestroyed bridgeevil markmagic shopwalking up a wall (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Harry Potter And The Sorcerer's Stone (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry Potter And The Sorcerer's Stone (2001)

This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro …unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)

Subgenre:
cult filmfairy taleepicdark fantasy
Themes:
magicghostchristmasfriendshipmoneymonsterherosupernatural powerdysfunctional familycelebrity
Mood:
night
Locations:
forestschooltraintrain stationschool of magic
Characters:
witchprofessorhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfriendgirlbest friendlittle girlbullyteacher student relationshipuncle nephew relationshipaunt nephew relationship
Period:
1990syear 1991year 1992
Story:
evil wizardgood versus eviltrain platformboarding schoolmagical broomstickfictitious sportharry pottersteam locomotivebased on young adult novelchild herocult figuresorceryidentical twinsowlwizard …strong female leadblockbusterwitchcraftlifting someone into the airoccultstrong female characterratschoolgirltough girlsnakeorphancharacter name in titledogbased on noveltitle spoken by charactersurprise endingmirrorrescueslow motion sceneswordletterbirthdayhalloweenchild abuseno opening creditschild in perilcreaturetransformationkeyuniformfirst of seriesmissiondragonbankscarfirst partpowerchesseyeglassesdestinygametalking animalhatfrogbreakfastdwarfreverse footagebraverycrossbowzooimmortalitystadiumfamily secretelfspellinvisibilitylevitationparalysissorcererfantasy worldpotiontrollorchestral music scorestutteringtrapdoorschool lifeunicornbroomhuman becoming an animalmagic wandwoman in uniformmysticfemale ghostgiant creaturegrandfather clockinfirmarycloaknew homelifting a male into the airmagical mirrorcentaurmirror does not reflect realityflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivebad parentsbad parentingbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifemagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All)

Harry Potter And The Deathly Hallows: Part 2 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry Potter And The Deathly Hallows: Part 2 (2011)

Harry, Ron, and Hermione continue their quest of finding and destroying the Dark Lord's three remaining Horcruxes, the magical items responsible for his immortality. But as the mystical Deathly Hallows are uncovered, and Voldemort finds out about their mission, the biggest battle begins and life as  …they know it will never be the same again. (Read More)

Subgenre:
cult filmcoming of agedark fantasy
Themes:
magictortureghostfriendshipdeathbetrayalfearherodeceptionmemorycorruptionterrorismredemptionself sacrificeunlikely hero
Locations:
foresttraincastleschool of magic
Characters:
witchteacherteenagerteacher student relationshipchildhood friend
Period:
1990s2010s20th centurynear future21st centuryyear 1997year 1998
Story:
evil wizardgood versus evilblack magicmagical broomstickharry potterbased on young adult novelcult figurereturning character killed offteleportationwizardstrong female leadgiantstrong female charactertough girlsnake …showdownbattlefirecharacter name in titlesequelflashbackkissbased on novelnumber in titlebloodviolenceexplosionrescueswordfalling from heightdead bodycombatspyambushterroristdisguisedeath of friendfictional wardouble crossduellegendcurseattackdragonrace against timebankscarthreatwaterfallarsonbattlefieldpowerwerewolfdisasterdestinyloyaltydestructionrevelationloss of friendroman numeral in titleexploding buildingspiderfrograilway stationback from the deadpresumed deadbraveryimpostorresurrectionimmortalitydark pastdead woman with eyes openelfheroismfinal showdowndark secretassumed identityyoung version of characterboy with glassessorcererartifactfemale heroepiloguefinal battlevaultinfiltrationsnake bitechosen oneforce fielddouble agentteenage herodying wordsdead woman on floorbroomgiant spidercupbank vaultpretending to be deadmagic wandeighth partlast of seriesmass destructionfire breathing dragonlimboenglish subtitles in originalgiant snakepythonevil sorcereryear 2017wet jeansdeath by firewandaftermathexploding bridgehereditary gift of witchcraftthroat slashedkilling a snakebitten by a snakesoaked clothesmain characters killed offdeath of relativeanimate statuebildungsromaneighth in serieshobgoblininspirational speechmoving statuelife and death battleduel to the death (See All)

Harry Potter And The Deathly Hallows: Part 1 (2010) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry Potter And The Deathly Hallows: Part 1 (2010)

Voldemort's power is growing stronger. He now has control over the Ministry of Magic and Hogwarts. Harry, Ron, and Hermione decide to finish Dumbledore's work and find the rest of the Horcruxes to defeat the Dark Lord. But little hope remains for the Trio, and the rest of the Wizarding World, so eve …rything they do must go as planned. (Read More)

Subgenre:
cult filmdark fantasyautobiography
Themes:
magicchristmasfriendshipfearweddingracismcorruptionparanoiaprejudice
Locations:
elevatorforesttrainbeachchurchsnowmotorcyclecemeterylondon englandcaveschool of magic
Characters:
husband wife relationshipfather son relationshipmother son relationshipfriendboyfriend girlfriend relationship
Period:
1990syear 1997year 1998
Story:
evil wizardgood versus evilharry potterbased on young adult novelcult figureopen endedreturning character killed offteleportationowlwizardstrong female leadstrong female charactertough girlsnakeshowdown …bookfirecharacter name in titleflashbacksequelkissbased on novelbloodbare chested maledancingchasesurprise endingcryingrescueswordsecretbirthdaycafedemonhallucinationsurvivalfoot chaseambushstabbed in the chestno opening creditsradiounderwater scenesearchold womanon the runlegendargumentcurseportraitprologueattackfugitivemissionmistaken identityrace against timetentdisappearancehairy chestisolationpowerwerewolfloyaltyjail cellroman numeral in titledesperationmale underweartensionbraverymourningchaosimmortalitycapturedark pastmeetingwedding receptionimprisonmentheroismtombdoppelgangerhit in the faceold dark houseteenage loveassumed identityboy with glasseschandelierpotionaltered version of studio logopersecutionplansubterraneaninfiltrationchosen oneforce fieldlocketteenage heroprotectionseventh parttragic villainswimming in underwearmagic wandruthlessnessfrozen lakesecrecyfalling through icecliffhanger endinggrave robbingwandloss of petcrusadecaught kissinghereditary gift of witchcraftbitten by a snakeartifactswerewolf biteimax versionnarrow escapebroomstickbildungsromanhobgoblinjumping into a lake (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Thor: Ragnarok (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor: Ragnarok (2017)

Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.

Subgenre:
martial artssuperheroabsurdismepicslapstick comedydark fantasyscience fantasylive action and animation
Themes:
murderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessescapemonsterdeceptionbrutalitysupernatural powerredemptioncelebrity …sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All)
Locations:
elevatorforestnew york citybarchurchvillagewoodsouter space
Characters:
father son relationshiptattoobrother brother relationshipbrother sister relationshipzombiesoldieralienhostagetough guywarrioraction heroalcoholicvillaincousin cousin relationshipfather …alien monster (See All)
Story:
good versus evilsequel baitingactor reprises previous roleshared universelong haired womanopening creditslong haired manwoman murders a manstudio logo segues into filmlong haired malepsychotronic filmopen endedmale protagonistreturning character killed offteleportation …prophecyvisionrebellionblockbusterstrong female characterfireworkstough girlprisonershowdownbookbattlefirecharacter name in titleflashbacksequelviolencetwo word titlebare chested malefighttitle spoken by characterexplosionknifechasesurprise endingshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the faceswordgunfightbrawlfalling from heightbased on comicheld at gunpointbeerhand to hand combatdemonriverfightingcombatdecapitationsurvivalfoot chasesword fightbased on comic bookambushname in titleaxemassacremountainbasketballbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestweapontied to a chairsevered headdisarming someoneone man armyfictional wardouble crossspaceshipunderwater scenecreaturefemme fatalethird parttransformationtalking to the cameraon the runduelattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facelightningopening action sceneskeletonbraceletscene during end creditsmanipulationspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallsubtitled sceneundeadbattlefieldprincestylized violencehenchmanapplausedestinywolfdestructionbow and arrowflyingracehead buttspearelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplaneteccentriccamprebeljumping from heightclubskullknightlaserhomeaction heroinesocial commentaryback from the deadbald manfemale warriorhaircutreverse footageshieldcameohaunted by the pastbootsbraveryfight to the deathdual wieldimpostorsonmercilessnesschaosresurrectiondeath threatevacuationescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault rifleknife fightwisecrack humorhologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling guncrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdowndirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessfemale villainfight the systemfinal battlecrotch grabpart computer animationshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armyforce fieldanti heroinegiant animalalien creaturealien raceepic battlefemale antagonistslow motion action scenesurprise during end creditsblond manhuman aliensuper speedman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silenceadopted brotherbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunterglowing eyethrowing stonesaerial battleevil sisterflying shiphalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponreference to duran duranship's logthe other sidewar hammerdoctor strange (See All)

Night Watch (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Night Watch (2004)

Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)

Subgenre:
supernaturalcult filmindependent filmdark fantasyurban fantasy
Themes:
murderdeathrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerbrutalitysupernatural powerdeath of mother …paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All)
Mood:
gorenightdarkness
Locations:
elevatortrainswimming poolairplanebathtuburban settingapartmenttruckrooftoprussiatunnelyachtfire escape
Characters:
witchfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherlittle boyrussian …pregnant womanself mutilation (See All)
Period:
1990s2000s20th century21st centuryyear 1992
Story:
good versus evilblack magicopening creditsshape shiftingpsychotronic filmmale protagonistsecret societyowlprophecyvisionmind controlwitchcraftlifting someone into the airdarktough girl …false accusationshowdownbattlephotographflashbackdogfemale nuditybased on novelbloodviolencetwo word titlebare chested malefemale rear nudityfighttitle spoken by characterexplosionknifechasesurprise endingvoice over narrationcell phonebeatingcorpseblood splatterhorserescueslow motion scenepunched in the faceswordarrestbrawlbare buttsunglassesneighborsubjective cameradecapitationfoot chaseflashlightsword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwaysevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuescreamingcharacter's point of view camera shotmissionrace against timeknocked outlightningopening action scenescene during end creditsfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetexploding buildingspidernosebleedbuttknightfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footageanimated sequencepower outagebutcherstabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumlighttelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovestabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern daynight watchface blown off (See All)

The Last Witch Hunter (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last Witch Hunter (2015)

The modern world holds many secrets, but the most astounding secret of all is that witches still live amongst us; vicious supernatural creatures intent on unleashing the Black Death upon the world. Armies of witch hunters battled the unnatural enemy across the globe for centuries, including Kaulder, … a valiant warrior who managed to slay the all-powerful Queen Witch, decimating her followers in the process. In the moments right before her death, the Queen curses Kaulder with her own immortality, forever separating him from his beloved wife and daughter in the afterlife. Today Kaulder is the only one of his kind remaining, and has spent centuries hunting down rogue witches, all the while yearning for his long-lost loved ones. However, unbeknownst to Kaulder, the Queen Witch is resurrected and seeks revenge on her killer causing an epic battle that will determine the survival of the human race. (Read More)

Subgenre:
supernaturalblack comedyconspiracydark fantasychristian horror
Themes:
magictorturemurderdeathrevengesurrealismkidnappingbetrayalprisonescapefuneralmonsterinvestigationdeceptionmemory …supernatural powerapocalypseblindnessvengeancenear death experiencemurder of family (See All)
Mood:
darkness
Locations:
kitchennew york citybarchurchsnowairplanetaxiapartmentcavecatholic churchschool bus
Characters:
evil witchwitchtattoosoldierpriesthostagetough guywarrioraction herowaitressbiblecatholic priest
Story:
good versus evilblack magicshape shiftingopen endedsecret societyteleportationmind controlwitchcraftenemyoccultprisonerinterrogationshowdownbattledream …fireflashbackbloodviolencefightexplosionknifesurprise endingpistolvoice over narrationcell phonecorpseshot in the chestshotgunrescueswordfalling from heightheld at gunpointhallucinationshot in the backassassincandlestrangulationaxemassacremountaindeath of friendimpalementstabbed to deathstabbed in the chestno opening creditsanti heroone man armycoffinassassinationchild in perilfictional wardouble crosscreaturefemme fataleflash forwardtreecursestabbed in the backprologueattackmissionrace against timecover uplightningopening action sceneshot in the shouldermanipulationbodyguardexploding bodythreatened with a knifequeenarsonstylized violencetraitorbow and arrowburned aliverevelationassassination attemptgothicheavy raincrucifiximpersonationirishtorchend of the worldback from the deadbar fighteaten alivepresumed deadretirementcrime scenepump action shotgundamsel in distressreverse footageresurrectionimmortalitycigarette lighterdark heroheartaerial shotlonercanedark pastdressing roomtragic heroburned to deathtelekinesistelepathyimprisonmentspellenglishman abroadsuffocationnarrated by characterillusionfire extinguisherstabbed in the handbongold dark housegiant monsterhitlerbrooklyn bridgegun held to headcomic reliefplagueflycrystalgreenhousepocket watchbakerydruggedman kills a womanoffscreen killingmacguffinpotionfashion showaltered version of studio logosole black character dies clichetimes square manhattan new york citycathedralmaggotrighteous ragetragic pastdeath of familysubterraneancamera phonesymbolfemale bartendermind readingpentagrampenrookieglowing eyesheart in handmagic spellchrysler building manhattan new york cityregenerationselfiechantingdiscovering a dead bodybattle axedecomposing bodyenglishwoman abroadsecret doorsecret organizationchemistryarsenalman fights a womanrepressed memorypossewarlockirongiant creaturehand through chestcherrycouncilcatwalkstalinalternate worldlucid dreamswarmstabbed through the chestinside the mindweather manipulationfacial cutbiographeraxe throwingnapoleonarsenicblowing smoke in someone's facehuman brandingsiamese catclose up of handflaming swordwitch hunterlife forcesword throwingrapid healingsnapping fingersgiant treeair hostessmental manipulationdead flystabbed through the backweapons cabinetblack plaguefalling down a holecircumscribed pentagramwoman wearing lingeriegummy bearman holding a babyswarm of flies (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Fantastic Beasts And Where To Find Them (2016) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fantastic Beasts And Where To Find Them (2016)

Holding a mysterious leather suitcase in his hand, Newt Scamander, a young activist wizard from England, visits New York while he is on his way to Arizona. Inside his expanding suitcase hides a wide array of diverse, magical creatures that exist among us, ranging from tiny, twig-like ones, to majest …ic and humongous ones. It is the middle of the 20s and times are troubled since the already fragile equilibrium of secrecy between the unseen world of wizards and the ordinary or "No-Maj" people that the MACUSA Congress struggles to maintain, is at risk of being unsettled. In the meantime, the voices against wizardry keep growing with daily protests led by Mary Lou Barebone and fuelled by the increasing disasters ascribed to a dark wizard, Gellert Grindelwald. At the same time, by a twist of fate, Newt's precious suitcase will be switched with the identical one of an aspiring No-Maj baker, Jacob Kowalski, while demoted Auror, Tina Goldstein, arrests Newt for being an unregistered wizard. To make matters worse, with the suitcase in the wrong hands, several creatures manage to escape to unknown directions. Before long, this situation will catch Senior Auror Percival Graves' attention who will target both Tina and Newt amid panic caused by an invisible, devastating and utterly unpredictable menace that still wreaks havoc in New York's 5th Avenue. Is there a hidden agenda behind Graves' intentions and ultimately, what will happen to the remaining magical creatures still loose in the st… (Read More)

Subgenre:
slapstick comedyfish out of watersteampunkdark fantasyperiod filmurban fantasy
Themes:
magicchristmasfriendshipdeathloverevengesurrealismbetrayalfeardrunkennessescapegangsterdeceptionrobberyanger …supernatural powerparanoiaunrequited loveexecutionpanicprison escapeunlikely hero (See All)
Mood:
rain
Locations:
trainnew york citybarsnownightclubdeserturban settingapartmentpolice carjunglecar fire
Characters:
witchfather son relationshippolicesingerbrother brother relationshipphotographerwritersister sister relationshiplittle girlbaker
Period:
1920s
Story:
good versus evilblack magicshape shiftingsorcerysecret societyteleportationwizardvisionmind controlblockbusterwitchcraftratdarksuitcaseanimal …birdfalse accusationtrialorphaninterrogationshowdownbattlefirephotographkissf ratedbased on novelfighttitle spoken by characterexplosionchasesurprise endingshowerbased on bookcorpsecar accidentshotgunrescueslow motion scenepunched in the facearrestbrawlheld at gunpointhandcuffsrevolvermanhattan new york cityreportersubjective cameradisguisemontagebridgesubwayno opening creditsdouble crosscreaturenecklacebartenderon the runauthorcursedangerprotestfactoryfugitivepoisonumbrellacharacter's point of view camera shotmissionrace against timecover upevil manchristmas treebaseball batbankmanipulationdeath of brotherpresidentexploding bodyautomobiledeath of sonwitnesstypewriternewspaper headlinemonkeyicegolddestructionrevelationbreaking and enteringheavy rainegghelmetspin offmagicianexploding buildingfraudeccentricwristwatchpress conferenceculture clashbrooklyn new york cityorphanageanimal attackfalse identitybar fightclockrampageitalian americanimpostorpower outage3 dimensionalchaoszooinsectlove at first sightblack and white scenesenator3dlionice skatingaerial shotdungeonraidlong titlepolice raidmutationsecret identityferryprequelmedia coveragetelepathyspellenglishman abroadinvisibilityinvestigatorlevitationalleyfinal showdownwhalebureaucracycentral park manhattan new york citysubway stationfake identityevil spiritportalabandoned housebrooklyn bridgecomic reliefmegalomaniacskyscraperhanging upside downdepartment storesorcererlandladyadopted sonbakerypremonitionfactory workerstatue of liberty new york citychandelierpotionrallyeagledomestic abusealtered version of studio logogoblinfinal battlefamous scorecollectorcamouflageoverturning carrighteous rageshape shiftercorrupt officialadopted daughterjailbreakmind readingpentagramwanted posterwrongful arrestforce fieldgiant animalglowing eyestrenchcoatmagic spellprohibitionrainforestrevolving doorabusive motherjewelry storetragic villaincustomsgold coinbubblegrand canyonhands tiednewspaper editorbank vaultrhinocerosmagic wandbritish actor playing american charactercriminal mastermindbank managergiant creatureorbcouncilfragments of glasshippopotamussanctuaryanti villaincryptozoologylobotomybirdcageministryevil sorcererkleptomaniacnewsstanderased memorysecret revealedworld war one veteranabusive parentflipping carsea lionteapotwandspeakeasytrue identity revealedmagical objectmagical creaturemisadventurewhimsicalgiant birdtime reversalyear 1926gas lampadopted sisterhome repairextremist groupgifted childcryptozoologistgolden eaglederelict houseabuse victimrotary clubdestroyed buildingplatypusstrudelneck bitefemale investigatorrockefeller center (See All)

The Huntsman: Winter's War (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Huntsman: Winter's War (2016)

Subgenre:
supernaturalmartial artsblack comedysuspensefairy talesword and sorcerydark fantasysword and fantasybased on fairy tale
Themes:
evilmagicmurderdeathloverevengesurrealismkidnappingmarriagebetrayalfearescapemonsterherodeception …angerobsessionsupernatural powerredemptionguiltinsanitygriefunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All)
Locations:
forestchurchsnowvillagewoodscastlecampfire
Characters:
soldierbabyhostagesister sister relationshipthieftough guywarrioraction herolittle girllittle boy
Story:
good versus evilblack magicstudio logo segues into filmhalf brotherowlvisionmind controlfireplaceeavesdroppingtough girlbirdfalse accusationsnakeorphanshowdown …battleface slapcharacter name in titlesequelflashbackkissbloodviolencebare chested malefightexplosionknifechasesurprise endingvoice over narrationbeatingcorpsefistfighthorsemirrorshot in the chestshot in the headrescueslow motion scenepunched in the faceswordbrawlhand to hand combatsecond parthallucinationrivercombatsubjective cameracandlesword fightambushaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestno opening creditsanti herodisarming someoneone man armychild in perilfictional wardouble crosskingcreaturefemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessicetraitorgoldwolfbow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondtarget practicebraverycrossbowfight to the deathfairydual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomburned to deathtelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinganti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All)

The Hunger Games: Mockingjay - Part 1 (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hunger Games: Mockingjay - Part 1 (2014)

With the Games destroyed, Katniss Everdeen, along with Gale, Finnick and Beetee, end up in the so thought "destroyed" District 13. Under the leadership of President Coin and the advice of her friends, Katniss becomes the "Mockingjay", the symbol of rebellion for the districts of Panem.

Subgenre:
suspensepost apocalypsedystopiacyberpunkfuturistic
Themes:
torturefriendshipmurderdeathlovepoliticsfearfilmmakingdeceptionmilitarypovertyexecutionhopecourage
Locations:
elevatorforesthospitalwoodswheelchairlaboratoryabandoned factoryairship
Characters:
teenage girlteenagermother daughter relationshiptattoofemale protagonistsoldiersister sister relationshiplove trianglewarriorfilm director
Story:
good versus evilbased on young adult novelopen endedspiral staircasestrong female leadmind controlrebellionblockbusterstrong female charactertough girlcatdreamfirephotographsequel …dogf ratedbased on novelviolencetitle spoken by characterexplosionsingingsurprise endingpistolcorpseshot to deathmachine gunshot in the chestshot in the headrescuecamerariflebombrivercombatscientistflashlightambushstrangulationaxemansionarmyno opening creditsfictional warthird partnews reportdrowningattempted murdertreepilotattackpoisonmissionrace against timeknocked outskeletonmanipulationpresidentexploding bodymercenaryflowerrefugeeclass differencescivil warmissilefalling down stairssabotagebow and arrowhypodermic needleheavy rainpropagandatied to a bedexploding buildingskullaction heroinecolonelsocial commentaryfemale warriorexplosiveconstruction sitecrossbowresistanceinventorpower outagemuteblack eyefascismhologramalternate realitydeerraidrescue missiondictatorsign languagegeniusmedia coveragepalaceoppressionbrainwashingbag over headfemale fightercomputer crackerabandoned houserepressionplane crasharcherybunkercameramancommandercomputer hackercommando missiondamwhistlingfemale herofilm studionickname in titlefight the systemclimbing a treecommando raidtv interviewaircraftsubterraneanpsychological torturesymbolshooting rangesecret missionuprisingbulldozerresistance fighterexploding airplanearmoryteenage herototalitarianismfloodingfictional countryscreenplay adapted by authorpick axeair strikepageremaciationwater towerlogginggas grenadestar died before releasehovercraftanti aircraft gunstylistteenage heroinetv personalityhelmet camerawar roomhydroelectric powerdevastated landscapefemale archerdam burstpsychological warfarepirate broadcast (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Sorcerer's Apprentice (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sorcerer's Apprentice (2010)

Balthazar Blake (Nicolas Cage) is a master sorcerer in modern-day Manhattan trying to defend the city from his arch-nemesis, Maxim Horvath (Alfred Molina). Balthazar can't do it alone, so he recruits Dave Stutler (Jay Baruchel), a seemingly average guy who demonstrates hidden potential, as his reluc …tant protege. The sorcerer gives his unwilling accomplice a crash course in the art and science of magic, and together, these unlikely partners work to stop the forces of darkness. It'll take all the courage Dave can muster to survive his training, save the city and get the girl as he becomes The Sorcerer's Apprentice. (Read More)

Subgenre:
cult filmmartial artscoming of age
Themes:
magicmurderdeathlovesurrealismkidnappingbetrayalherodeceptionrobberysupernatural powerhome invasionself sacrificenear death experienceunlikely hero …book of magicbook of evil (See All)
Mood:
car chase
Locations:
elevatortrainnew york citycemeterywatertaxiapartmentpolice carcastlerooftopindialaboratorytunnelschool bus
Characters:
witchteacherteenagerpolice officerstudenthostagetough guywarrioraction herochinesegirlfriend
Period:
2000s2010s21st centuryyear 2010year 2000
Story:
evil wizardgood versus evilsorceryspiral staircaseteleportationwizardmind controlloss of loved onefireplacetough girlpossessionsnakeshowdownbookbattle …firekissdogflashbackviolencefightexplosionknifechasethree word titleshowercell phonehorsecar accidentmirrorrescueswordfalling from heightletterpaintinghand to hand combatapostrophe in titlecar crashbathroomdemonmanhattan new york cityfightingcombatfoot chasesword fightstrangulationaxemassacredisguisedeath of friendmontagemixed martial artsstabbed in the chestsubwaychild in perilritualroommatenecklacetransformationtrainingduelflash forwardparkprologueelectrocutionumbrellamissionproduct placementdragondollstatuecollege studentlightningringdatethreatened with a knifesacrificehenchmanpizzawolfkilling an animalwhat happened to epiloguegothicheavy rainquestfaintingrome italyhatmagicianeccentricimpersonationchefjumping from heightskullrailway stationparking garagecarnivaltorchanimal attackinterracial friendshipcrushed to deathback from the deadfemale warrioryogareverse footagefloodimpostoregyptresurrectionimmortalityscene after end creditsbased on storyrainstormcanenoteclassmatedemonic possessionpuppysword duelbenchalarm clockburned to deathsurprise after end creditsimprisonmentspellcoffee shopimpersonating a police officerlevitationrobberfountainteenage lovecockroachfireballlockerworld dominationbrooklyn bridgemegalomaniacmicrosoft windowsbroken mirrorradio stationsorcererpyramidreluctant herocrashing through a windowbulleaglemuggingbritaindisembodied headtimes square manhattan new york cityflamecollege campusorchestral music scorepark benchshape shiftermiddle agesshapeshiftingsymbolsorceresscockney accenturnstatue of libertychosen oneapprenticeteenage herochrysler building manhattan new york cityradio djbroomchildhood sweetheartbased on poemmistvaseantique shoppendantbritish accentel trainempire state building manhattan new york citypepsigargoyleteenager fighting adultmuggerfire breathing dragonnight cityscapefear of heightssecret laboratorycar stuntevil sorcererlovers reunitedconfettisatellite dishbegins with narrationvintage cargreat wall of chinamagical mirrormopsplit headchinatown manhattan new york cityincantationnew york universitymagical ringmaster apprentice relationshipcirclefight in the restroomhole in wallantennahole in chestsabredemonesslecture hallbook of the deadbrushing one's teethfire axeinanimate object comes to lifeabsorbing powerfalling objectsuccessorenchanted objectevil spellawakened by an alarm clockwashington square manhattan new york citywizardryglowing eyedeath of mentortribeca manhattan new york citytesla coilmountain dewfifth avenue manhattan new york city8th centurypassing notetrapped in a mirrorasian dragonbattery park manhattan new york citychild witchsecret hiding placepompadourtrapped soulabandoned subway stationantique dollbryant park manhattan new york city (See All)

King Arthur: Legend Of The Sword (2017) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

King Arthur: Legend Of The Sword (2017)

Subgenre:
supernaturalmartial artscoming of ageblack comedysword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history
Themes:
magicfriendshipmurderdeathrevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneralmonster …deceptionrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All)
Mood:
nightmareraindarkness
Locations:
englandforestboatlondon englandwatervillagewoodslakeshipcastlecavebrothelsewer
Characters:
witchhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction hero …little boymaiduncle nephew relationshipmermaidself doubt (See All)
Story:
good versus evilblack magicprophecyvisionmasked manmind controlrebelliongiantblockbusterratsnakeprisonerorphaninterrogationshowdown …battlefirecharacter name in titleflashbackdogbloodviolencebare chested malefighttitle spoken by characterexplosionknifechasesurprise endingbased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorswordbrawlfalling from heighthand to hand combatdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationspyfoot chasecandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestmapnonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedpoolrebeljumping from heightknightcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscamslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknametarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All)

The Brothers Grimm (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Brothers Grimm (2005)

Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir …ing genuine courage. (Read More)

Subgenre:
supernaturalcult filmblack comedyfairy taleslapstick comedydark fantasy
Themes:
magictortureghostmurderdeathrevengesurrealismkidnappingmoneybetrayalprisondrinkingfeardrunkennessescape …monsterdeceptionmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All)
Mood:
nightmarerain
Locations:
forestchurchsnowcemeterysmall townvillagewoodscastlecavegermany
Characters:
witchmother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove triangle …warriormayorfrench soldier (See All)
Period:
19th century1810s
Story:
animal crueltylifting someone into the airfireworksrattough girlpossessionanimaltrialsnakeprisonerinterrogationbookbattlecatfire …character name in titleflashbackkissdogbloodviolencegunfightdancingtitle spoken by characterexplosionknifethree word titlepistolcorpseunderwearfoodhorsemirrorshot in the chestshot in the headrescuedrinkswordarrestfalling from heightriflerunningbedhallucinationshot in the backdecapitationbound and gaggedwinecandleold manaxestabbingwomaneatingarmystabbed to deathstabbed in the chestweaponmapsevered headman with glassesanti herodrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuestorytellingrace against timerabbitwigcrosswitnesspighauntingtied upsevered armgeneralqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagehatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnesscrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Seventh Son (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Seventh Son (2014)

John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to  …survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)

Subgenre:
martial artscoming of ageblack comedysword and sorcerydark fantasysword and fantasy
Themes:
magicghostmurderdeathloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionrobberysupernatural power …death of motherredemptionunrequited lovehopecourageself sacrifice (See All)
Mood:
nightdarkness
Locations:
forestchurchsnowvillagewoodsfarmcastlecampfirewalled city
Characters:
evil witchwitchmother son relationshipmother daughter relationshipsoldiersister sister relationshiptough guywarrioraction heroalcoholicteacher student relationshipdeath of student
Story:
good versus evilblack magicopening creditswoman murders a manshape shiftingbased on young adult novelteleportationvisionstrong female leadgiantstrong female characterpossessionshowdownbattlefire …dogbased on novelviolencefighttitle spoken by characterexplosionknifechasesurprise endingfistfighthorseurinationrescueslow motion sceneswordbrawlfalling from heighthand to hand combatdemonhallucinationcombatassassinsword fightambushstrangulationaxemountainmontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestno opening creditsanti herochild in perilfictional warunderwater scenecreaturefemme fataletransformationtrainingskinny dippingstabbed in the backprologueattackdragonrace against timelightningskeletonfarmerexploding bodypigthreatened with a knifewaterfallbearqueenbattlefieldstylized violencehenchmandestinybow and arrowburned alivespearassassination attemptheavy raincagecatfightvillainesseccentricjumping from heightirishskullknighttorchaction heroinefemale killerbar fighteaten alivefull moonretirementtarget practicebraverycrossbowdual wieldson3 dimensionalstabbed in the headoiltime lapse photographystabbed in the legdark heroaerial shotknife fightwisecrack humorrainstormdeerdisfigurementknife throwingdemonic possessiontragic heroburned to deathexorcismswordsmanfemale fightergiant monstertwo man armyworld dominationfemale spyhired killertavernassistantpremonitionman kills a womantrollwoman kills a manstabbed in the shouldersole black character dies clichebladejumping into waterstabbed in the faceclawgravestonepitchforkchosen oneapprenticearmorypitregenerationvillain turns goodmentor protege relationshiptragic villainhorse drawn carriagenetgold coinaxe fightbrandingpendantleopardtalismanwarlockgiant creatureturned to stonecaged humancaught in a netwitch huntfemale thiefsilvercrisis of consciencetailtroubled productioncloakbell towerfighting in the airmaster apprentice relationshipsororicidecauldronaxe throwingman murders a womanbookshelfgemstonesceptertough womanwoman murders a womanwitch hunterrolling down a hilltapestryfarmboydark forestwitch burningwoman kills a womanblood moongood witchcarry onrolling downhillcliffhanginglancashire (See All)

Thor: The Dark World (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thor: The Dark World (2013)

Thousands of years ago, a race of beings known as Dark Elves tried to send the universe into darkness by using a weapon known as the Aether. Warriors from Asgard stop them but their leader Malekith escapes to wait for another opportunity. The warriors find the Aether and since it cannot be destroyed …, they try to hide it. In the present day, Jane Foster awaits the return of Thor although it has been two years since they last saw once another. In the meantime, Thor has been trying to bring peace to the nine realms. Jane discovers an anomaly similar to the one that brought Thor to Earth. She goes to investigate, finds a wormhole, and is sucked into it. Back on Asgard, Thor wishes to return to Earth but his father, Odin refuses to let him. Thor learns from Heimdall, who can see into all of the realms, that Jane disappeared. Thor then returns to Earth just as Jane reappears. However, when some policemen try to arrest her, an unknown energy repulses them. Thor then brings Jane to Asgard to find out what happened to her. When the energy is released again, they discover that when Jane disappeared, she crossed paths with the Aether and it entered her. Malekith, upon sensing that the time to strike is now, seeks out the Aether. He attacks Asgard and Thor's mother Frigga is killed protecting Jane. Odin wants to keep Jane on Asgard so that Malekith will come. Thor disagrees with his plan, so with his cohorts, he decides to take Jane away. He enlists the aid of his brother, Loki. Unfortun… (Read More)

Subgenre:
martial artssuperherodisneydark fantasyscience fantasy
Themes:
magicmurderdeathrevengebetrayalprisondrunkennessfuneralmonsterdeceptionsupernatural powerdeath of motherdeath of wifeself sacrificespace travel …prison escapenorse mythology (See All)
Mood:
darkness
Locations:
englandrestaurantlondon englandvillagepolice carouter spacecaveearthabandoned factory
Characters:
husband wife relationshipfamily relationshipsfather son relationshipmother son relationshipdoctorbrother brother relationshipsoldierpolice officertough guywarrioraction herovillainamerican abroadbabe scientistfemale scientist …alien superhero (See All)
Story:
good versus evilsequel baitingactor reprises previous rolelong haired womanshared universeopening creditslong haired malepsychotronic filmopen endedmale protagonistreturning character killed offteleportationgiantblockbusterenemy …strong female characterdarktough girlprisonershowdownbattleface slapcharacter name in titleflashbacksequelnuditymale nudityviolencebare chested malefightexplosionknifechasesurprise endingvoice over narrationcell phoneshot to deathfistfightcar accidentshot in the chestswordarrestbrawlbased on comichand to hand combatsecond parthandcuffscombatscientistshot in the backsword fightbased on comic bookaxedisguisebridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestweaponmapexploding carno opening creditsone man armyhit by a carfictional warspaceshipkingcreaturejourneynews reporttransformationpublic nuditylibrarycharacter repeating someone else's dialoguestabbed in the backrace against timestatuelightningopening action scenescene during end creditsexploding bodydateneck breakingthreatened with a knifewaterfallsevered armsacrificequeensubtitled scenebattlefieldprincegamegrenaderacespearheavy rainhammerspacecraftplanetsevered handfaked deathknightgenocideend of the worldaction heroinecrushed to deatheaten alivefemale warriormental institutioncameoprison guardinvasionfairy3 dimensionalstabbed in the legscene after end creditsmarvel comicsinfectiondungeonhologramrainstormbody landing on a careye patchdaggerlaser gunsurprise after end creditspalaceelffemale soldiermale objectificationinvisibilityillusionlevitationfinal showdownsuper strengthgiant monsterportalworld dominationmegalomaniacbearded mansorcerertavernfighter jetadopted sonheirstation wagonravenparasitefacial scarexploding shipshapeshiftinghit with a hammerwoman slaps a manforce fieldthronex rayed skeletonalien racehostile takeoverearth viewed from spaceepic battlestarts with narrationinterncityscapeaxe fightbattle axesurprise during end creditshuman aliencrushed by a carcar keysstabbed in the sideone eyed manfuneral pyrebody armorgiant creatureturned to stonevortexobservatorycaught in the rainholding cellsparringmarvel entertainmentcliffhanger endingrusemarvel cinematic universestonehengedouble impalementpixilated nuditysee you in hellreturning characterwarrior racefake injurybound in chainsadopted brotherastrophysicistfalling objectreference to captain americaextraterrestrial alienwife killedcloaked shipmale doctorstan lee cameohorned helmetadoptive mother adoptive son relationshipdark worldpersonal journeypointy earsmother killedhammer as weaponwar hammerwoman with long hairpolice station wagon (See All)

Guardians Of The Galaxy (2014) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Guardians Of The Galaxy (2014)

After stealing a mysterious orb in the far reaches of outer space, Peter Quill from Earth, is now the main target of a manhunt led by the villain known as Ronan the Accuser. To help fight Ronan and his team and save the galaxy from his power, Quill creates a team of space heroes known as the "Guardi …ans of the Galaxy" to save the world. (Read More)

Subgenre:
cult filmmartial artsblack comedysuperherodark comedyfuturisticspace operaurban fantasyscience fantasylive action and animationrevisionist westernscience fiction comedy
Themes:
torturefriendshipmurderdeathrevengesurrealismsuicidekidnappingmoneybetrayalprisondrunkennessescapeherodeception …theftsupernatural powerterrorismdeath of mothercancergamblingsurveillancetraumaself sacrificenear death experiencespace travelprison escapealien abductionescape from prison (See All)
Locations:
hospitalbarouter spacespacecavestormearthspace battleprison fight
Characters:
family relationshipsmother son relationshipfather daughter relationshipfriendboygirlsoldieralienhostagesister sister relationshipthieftough guywarrioraction herolittle girl …interracial relationshiplittle boygrandfather grandson relationship (See All)
Period:
1980s2010syear 1988year 2014
Story:
good versus evilsequel baitingshared universeshape shiftingpsychotronic filmopen endedmale protagonistreturning character killed offensemble castmasked manstrong female leadrebelliongiantblockbusterstrong female character …gifttough girlprisonerorphaninterrogationshowdownbattleface slapflashbackdogviolencebare chested malefightdancingtitle spoken by characterexplosionknifechasesurprise endingcryingshootoutshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facewritten by directorswordarrestgunfightbrawlfalling from heightlettershootingbased on comicheld at gunpointhand to hand combatbombjailhallucinationhandcuffscriminalcombatshot in the backfoot chaseassassinsword fightbased on comic bookterroriststrangulationmontagebridgearmyimpalementfour word titlestabbed to deathmixed martial artspoliticianstabbed in the chestweaponsevered headanti herofictional warspaceshipunderwater scenecreatureracial sluron the rungunshottreepilotcharacter repeating someone else's dialoguestabbed in the backelectrocutionfugitivedollkicked in the facelightningscreamscene during end creditsscarexploding bodyneck breakingdie hard scenariofirst partthreatened with a knifemercenaryex convictsevered armloss of motherprofanityobscene finger gesturebattlefieldpowerstylized violencesisterexperimentpiratecaptainheroineheavy raintalking animallistening to musicscene during opening creditscatfighthelmethammerspacecraftexploding buildingkicked in the stomachplaneteccentriccampbarefoot malerebelsevered handlaserrocket launchercrying manaction heroinegun fucrushed to deathandroidchokingmale underwearfemale warriorcyborganthropomorphisminterracial romanceadventurercameohaunted by the pastprison guardnicknameface paintdual wieldsmugglingmanhunt3 dimensionalanthropomorphic animalsexismsuper villainfalling to deathscene after end creditshit on the headmarvel comicsabsent fathersexual harassmentoutlawknife fightwisecrack humorsuperheroinehologramracisttitle at the endbounty hunterconvictvoice over letterraised middle fingerminelens flarebroken armgadgetarrowlightdaggerholding handsarrogancelaser gunsurprise after end creditsfemale assassinman cryingmale objectificationpresentfinal showdownfemale fightersuper strengthmini dressmale in underwearshot with an arrowmegalomaniacyoung version of characterbroken windowblack markethospital roomsmugglercrash landingbased on graphic novelgenetic engineeringfemale heromacguffinsuperhero teambreaking a windowfemale villainaudio cassettekicked in the headfinal battleevil womancollectorshape shifterplandance scenealien planetexploding shipfemale criminalstarshipadopted daughterwarlordhit with a hammerarm cut offracial stereotypefemale bossaerial combatvillain not really dead clicheforce fieldraccoonanti heroinechild abductionwalkmanalien creaturex rayed skeletonpointing a gun at someonealien racecrying maleslow motion action sceneprison riotdecoywoman punching a mangadgetryreading a lettermissouricassette tapepassive aggressive behaviorsurprise during end creditswoman punches a manhuman aliensecretly observinghand cut offpassive aggressive womanzero gravityfall to deathhand kissinginterspecies sexoverheard conversationhuman in outer spacelifted by the throatflying carprosthetic limbsequel mentioned during end creditsorbdisembodied handtalking to an animalwoman hits a manescape podhandcuffed womanpulp fictionmarvel entertainmentoutrunning explosionheroesprosthetic legmarvel cinematic universehumanoid alienone legged manfictional planetspace piratewanted manfemale politiciandisembodied voicefemale chauvinismboxer briefsdouble impalementbald womanfemale chauvinistobscene gesturestrong female protagonistracist remarkescape planhalf humanlistening to music on headphonesgreen skinill motherblue skinmale female fightbiting someonedragging someonerape jokeviolent mandance offinterspecies romancekissing someone's handpeace treatyaerial bombardmentfemale sexistlocked in jailbroken jawhead spinfemale humanoid alienkicked in the bellyviolent womankidnapped boythrowing something at someoneelectra complexshort dressbad guysbad reputationexploding starshipgetting dressedhuman alien hybridmistaken belief that someone is deadfemale sexismprison planetreference to bonnie and clydemale antagonistreference to kevin baconfather issuesholographic projectionsexist remarksuperiority complexarrogant womanemotionally unstable womanhandcuffed maninterspecies friendshipinterspecies relationshipreference to michael douglasthreatened with a swordtroll dollwet underwearartificial gravitysony walkmanlying on the floorreference to billy the kidblue skinned alienman's best friendbipedal alienfemale green skinned humanoid alienhammer as weaponpouring rainteam workanti gravityend tease for sequelscar on chestscreaming boy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Warcraft (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Warcraft (2016)

When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth,  …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)

Subgenre:
sword and sorceryepicdark fantasysword and fantasy
Themes:
evilmagicghostfriendshipmurderdeathrevengesurrealismbetrayalpregnancyfeardrunkennessescapefuneralmonster …investigationdeceptionangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All)
Locations:
forestchurchsnowvillagewoodscastle
Characters:
husband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipsoldierbabyhostagetough guywarrioraction herosingle fatherpregnantengineer
Story:
evil wizardgood versus evilblack magicshape shiftingspiral staircaseteleportationwizardmind controlgiantblockbustereavesdroppingtough girlbirdprisonerinterrogation …showdownbookbattlefirebased on novelbloodviolenceone word titlebare chested malefightexplosionknifechasesurprise endingvoice over narrationbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightdemonrivercombatsubjective cameradecapitationsurvivalsword fightambushstrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapsevered headno opening creditsanti herochild in perilfictional wardouble crossritualunderwater scenekingcreaturetransformationduelone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facelightningskeletonmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenebattlefieldprincestylized violencesingle parenthenchmantraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetpoolrebelsevered handcovered in bloodsheepskullknighthonortorchburialaction heroineanimal attackcrushed to deathslavefemale warriorfull moonguardbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationsword duelwilhelm screamtelekinesisdaggerexorcismpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterdoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreathorse chasemacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All)

X-men: Apocalypse (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

X-men: Apocalypse (2016)

Since the dawn of civilization, he was worshiped as a god. Apocalypse, the first and most powerful mutant from Marvel's X-Men universe, amassed the powers of many other mutants, becoming immortal and invincible. Upon awakening after thousands of years, he is disillusioned with the world as he finds  …it and recruits a team of powerful mutants, including a disheartened Magneto, to cleanse mankind and create a new world order, over which he will reign. As the fate of the Earth hangs in the balance, Raven with the help of Professor X must lead a team of young X-Men to stop their greatest nemesis and save mankind from complete destruction. (Read More)

Subgenre:
martial artscoming of agesuspensesuperherotragedyepicfish out of wateralternate historyperiod film
Themes:
murderdeathrevengesurrealismkidnappingmoneybetrayalfeardrunkennessescapedeceptionmilitarymemoryangersupernatural power …surveillancehopedeath of wifepanicapocalypsecourageself sacrificenear death experiencedeath of daughter (See All)
Mood:
nightmarehigh school
Locations:
forestnew york citybarhelicoptersnowmotorcycleairplanedeserttaxiwoodswheelchairouter spacecavestormlaboratory …submarinefishing boatu boatcave in (See All)
Characters:
professorteacherteenage boyteenage girlhusband wife relationshipteenagerfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipsoldierhostagethief …tough guywarrioraction herobullysingle motherteacher student relationshipasian americangermanamerican abroadengineerself healing (See All)
Period:
1980syear 1983
Story:
good versus evilshape shiftingreturning character killed offteleportationensemble castvisionstrong female leadmind controlgiantblockbusterloss of loved oneteen angststrong female charactertough girlorphan …showdownbattlefirephotographcharacter name in titlesequeldogflashbackbloodviolencebare chested malegunfightcigarette smokingexplosionknifechasesurprise endingpistolbeatingcorpsearcade gameblood splatterfistfightmachine gunrescueslow motion scenepunched in the facewatching tvswordbrawlfalling from heightheld at gunpointhand to hand combatsunglassesrobotrevolvertelevisioncombatscientistshot in the backsubjective cameradecapitationsurvivalfoot chaseflashlightbased on comic bookambushstrangulationmassacremountaindisguiseambulancemansionbasketballthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestmapsevered headman with glassescultno opening creditsdisarming someonefictional wardouble crossritualunderwater scenepolice officer killedthird partnews reporttransformationon the runflash forwardone against manytreebeaten to deathdangerprologuescreamingelectrocutionfactoryfugitivecharacter's point of view camera shotundercoverproduct placementrace against timeknocked outkicked in the facedeath of childlightningopening action sceneskeletonbraceletdeath of brotherbodyguardhigh school studentbasementneck breakingthreatened with a knifemercenaryblindfoldpsychicciasubtitled scenebattlefieldstylized violencesingle parenthenchmanpizzaberlin germanyak 47missilesabotagedestructionbow and arrowburned alivehead buttspearcomic bookhelmetmutantcaptiveexploding buildingkicked in the stomachloss of wifevillainesslasertorchend of the worldaction heroinecolonelfemale killercrushed to deathback from the deadbald manbroken legearthquakefemale warriorpassportcamera shot of feetrampagebarefootreverse footagecameostealing a cartarget practicebraverydual wieldstabbed in the throatinventorobesityimpostormercilessnesspower outageegyptchaosresurrectionevacuationimmortalityescape attemptmentorscene after end creditsmarvel comicspunched in the chestjumping through a windowaccidental killingaerial shotsuperheroineundercover agentdeerpolandbody landing on a cardark pastbroken armmutationkilling spreeworld trade center manhattan new york cityburned to deathloss of brothertelekinesisnewspaper clippingprequelsurprise after end creditspostertelepathybullet timefemale assassintombceremonycia agentinvisibilitylevitationfinal showdownburied aliveoutcastpickpockethigh school teacherohiosydney australiasuper strengthfake identityhuman sacrificeshipwreckloss of daughterportalworld dominationbrooklyn bridgebully comeuppancemegalomaniacplane crashyoung version of characterfemale spyholocaust survivormilitary basepyramidcabin in the woodsdampremonitionfactory workershamanoffscreen killingsuperhero teamwoman kills a manjockauschwitzfinal battlecapefamous scorefilmed killingrighteous rageshape shiftersixth partclawreference to ronald reaganexploding housetragic pastdeath of familywoman fights a manreference to star warsimmortalsubterraneangodhuman experimentloss of familymind readingone woman armybaldmurder spreeancient egyptu.s. air forceexploding airplaneabandoned warehousepentagonforce fieldanti heroinebilingualismteenage heroregenerationwingsnuclear threattragic villainslow motion action scenebedtime storydoomsdaywoman punches a manstun gunsuper speedinvulnerabilityorigin of herocairo egyptbritish actor playing american characternuclear missileman fights a womanrole modeldark heroinesnorricamcage fightingx menmanor housecollapsing buildingbubble gummohawk haircutteenage superheroshipping containerheadsetfemale thieflawn sprinklerhenchwomanmarvel entertainmentoutrunning explosionsubliminal messagetailelectromagnetic pulsesupervillainbridge collapsesecret laboratorywest berlin west germanyswordswomancargo shiptime freezecnn reporterdarwinismsoul transferenceinside the mindeast berlin east germanyfemale bodyguardwolverinehumanity in perilgod complexblue skinprequel and sequelsydney opera housefemale mercenaryelectromagnetismtwinkiedisaster in new yorkhieroglyphicsstreet urchinglowing eyereference to icarussoviet navycage fightercollapsing bridgestan lee cameoweather controlfemale mutant (See All)

Oz The Great And Powerful (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Oz The Great And Powerful (2013)

Oscar Diggs ('James Franco'), a small-time circus magician with dubious ethics, is hurled away from dusty Kansas to the vibrant Land of Oz. At first he thinks he's hit the jackpot-fame and fortune are his for the taking. That all changes, however, when he meets three witches, Theodora ('Mila Kunis'  …(qv)), Evanora ('Rachel Weisz' (qv)), and Glinda ('Michelle Williams (I)' (qv)), who are not convinced he is the great wizard everyone's been expecting. Reluctantly drawn into the epic problems facing the Land of Oz and its inhabitants, Oscar must find out who is good and who is evil before it is too late. Putting his magical arts to use through illusion, ingenuity-and even a bit of wizardry-Oscar transforms himself not only into the great and powerful Wizard of Oz but into a better man as well. (Read More)

Subgenre:
slapstick comedyfish out of watersteampunkchrist allegory
Themes:
evilmagictorturefriendshiploverevengesurrealismkidnappingbetrayaljealousyfearescapedeceptionsupernatural powerredemption …faithhopefreedomcouragenear death experienceunlikely herocheating death (See All)
Locations:
forestcemeterywoodswheelchaircastlestormwalled city
Characters:
evil witchwitchfamily relationshipsgirlsoldierhostagesister sister relationshiplove triangleengineer
Period:
1900s
Story:
good versus evilcrystal ballprophecywizardwitchcrafthatefireworksgiftfalse accusationorphanshowdownbattlefirekissdancing …explosionsingingknifechasehorserescuefalling from heightriverfoot chaseambushaxedisguisemontagearmymapanti herofictional wardouble crosscreaturejourneyfemme fatalegraveyardprincessnecklacetransformationon the runattempted murderscreamingclownelectrocutionattackstorytellingstatueknocked outlightningmanipulationscarloss of fatherwaterfallflowermonkeybattlefieldcircusgoldfalling down stairsrevelationflyingspearlooking at oneself in a mirrortalking animalquestcatfightagingmagiciantreasurehidingvillainesseccentricservantjumping from heightfaked deathcarnivalanimal attackbroken legapplecannonpresumed deadfull moonanthropomorphismbraveryfairyimpostorpower outageevacuationimmortalityexilecon artistlionthrown through a windowfogcapturekingdomsmokepalacecrowrocketcon manillusionmagic tricklevitationhit in the facestrongmanfireballfilm projectorcrowntornadocornfieldcrash landingreluctant herofall from heightscarecrowtrumpetbroken heartcapesewing machinechainedmeteorhot air balloonmusic boxkansasgrudgefake moustacheforce fieldthronetop hatbanishmentgold coinbubblemagic wandzero gravitystowawayguerilla warfarevisionarygunpowderleather pantsgluespear throwingalternate worldcoin tossprojectionwizard of ozchariotmagician's assistantfighting in the airtwo sistersreference to thomas edisonmagical ringflying broomorigin storywandcharlatanreference to houdinigreen skinoptical illusionozsleight of handdark forestpoison appleshowmanblack hatbroomstickporcelainyear 1905heir to throneflying monkeyred hatgood witchmunchkintalking monkeyconcealing the truthblack cloaklife debtpoppy fieldgoing over a waterfallhole in floorwitch hat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Your Highness (2011) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Your Highness (2011)

Throughout history, tales of chivalry have burnished the legends of brave, handsome knights who rescue fair damsels, slay dragons and conquer evil. But behind many a hero is a good-for-nothing younger brother trying just to stay out of the way of those dragons, evil and trouble in general. As two pr …inces on a daring mission to save their land, they must rescue the heir apparent's fiancee before their kingdom is destroyed. Thadeous (McBride) has spent his life watching his perfect older brother Fabious (Franco) embark upon valiant journeys and win the hearts of his people. Tired of being passed over for adventure, adoration and the throne, he's settled for a life of wizard's weed, hard booze and easy maidens. But when Fabious' bride-to-be, Belladonna (Zooey Deschanel), gets kidnapped by the evil wizard Leezar (Justin Theroux), the king gives his deadbeat son an ultimatum: Man up and help rescue her or get cut off. Half-assedly embarking upon his first quest, Thadeous joins Fabious to trek across the perilous outlands and free the princess. Joined by Isabel (Natalie Portman)-an elusive warrior with a dangerous agenda of her own-the brothers must vanquish horrific creatures and traitorous knights before they can reach Belladonna. If Thadeous can find his inner hero, he can help his brother prevent the destruction of his land. Stay a slacker, and not only does he die a coward, he gets front row seats to the dawn of an all-new Dark Ages. (Read More)

Subgenre:
martial artsblack comedysword and sorcerysword and fantasy
Themes:
evilmagictorturemurderdeathrevengekidnappingdrugsbetrayaldrunkennessescapeweddingmonsterdeceptionsupernatural power
Mood:
gorespoofparody
Locations:
forestwoodscastlecampfire
Characters:
witchfather son relationshipbrother brother relationshipsoldierhostagewarrioraction hero
Story:
evil wizardgood versus evilblack magiclong haired malekiss on the lipsteleportationprophecywizardstrong female leadgiantstrong female characterfireworkstough girlbirdbattle …firefemale nuditybloodmale nudityviolencetwo word titlebare chested malefightexplosionpartyknifechasecorpseblood splatterfistfighthorserescueswordbrawlhand to hand combatcombatf worddecapitationfoot chasesword fightambushaxearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headanti heroritualkingcreatureprincessskinny dippingvirginstabbed in the backmissiondragonrace against timeattempted rapeexploding bodycharacter says i love youthreatened with a knifewaterfallsevered armbare chested male bondagebattlefieldprincetraitorbow and arrowkilling an animalquesttied to a bedknighttorchaction heroineanimal attackbar fightfemale warriorfull moondamsel in distressdwarfreverse footagesevered fingercrossbowcannibalstabbed in the headstabbed in the legsibling rivalrydungeonknife fightslackercapturetribekingdomrescue missionsevered legcrude humorswearingdaggerpipe smokingpalacetorso cut in halfpractical jokemazefemale fighterscene before opening creditsgiant monsterhuman sacrificeworld dominationmegalomaniacstonersorcerertavernkidnappershapeshiftinganimated creditsriddletwo brothersone woman armycompassthronehorse chasehorse drawn carriageeclipsesuit of armordouble entendrestabbed in the footwarlockgiant creatureinterrupted weddingstabbed with a swordscalpingroyal weddingminotaurswordplaybest manoutnumberedwedding daybad singingevil sorcererchastity beltseerheir to the throneclothes torn offmaking facesstorybookman woman fightmanservantspeared to deathwhipping someonemagical staffthong bikinimechanical birdthrowing a speartackled to the groundsaying booarm chopped offspear in chest (See All)

Power Rangers (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Power Rangers (2017)

High school outcasts stumble upon an old alien ship, where they acquire superpowers and are dubbed the Power Rangers. Learning that an old enemy of the previous generation has returned to exact vegenance, the group must harness their powers and use them to work together and save the world.

Subgenre:
martial artscoming of ageblack comedysuperheroteen movie
Themes:
evilmagicfriendshipmurderdeathrevengesurrealismkidnappingbetrayalfearescapefuneralmonsterherodeception …robberyangerpsychopathobsessionsupernatural powerterrorismredemptioninsanitysadismabusehome invasionhopegreedpanicapocalypsecourageself sacrificenear death experienceautism (See All)
Mood:
high schoolcar chase
Locations:
forestschooltraincemeterysmall townbicyclewaterwoodspolice cartruckouter spacecavecampfiresinging in a carschool teacher …fishing boatschool bullycar firestorm at seacave in (See All)
Characters:
teenage boyteenage girlhusband wife relationshipteenagerfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanbrother brother relationshipbrother sister relationshippolice officeralienhostage …tough guywarrioraction herobullysingle mothersecurity guardhomosexualityasian americanpolice chasefishermanhomeless manevil alienmean girl (See All)
Period:
2010s
Story:
good versus evilblack magictraining montageopen endedfemale psychopathvisionmasked mangiantenemyteen angsteavesdroppinghatetough girlshowdownbattle …firephotographkissf ratedviolencebare chested malefighttitle spoken by characterexplosionchasesurprise endingpistolcell phonebeatingcorpsefistfightcar accidentshot in the chestremakeshotgunrescueslow motion scenepunched in the faceswordbrawlfalling from heightheld at gunpointbeerhand to hand combatcar crashrobotcombatfoot chaseflashlightbound and gaggedambushaxemontagearmymixed martial artstied to a chairmapfishexploding carnunno opening creditsanti herofictional wardouble crossspaceshipunderwater scenecreaturepolice officer killedvanfemme fatalenews reporttransformationtrainingflash forwardskinny dippingone against manybased on tv seriesbeaten to deathdangercostumeprologuelocker roomfantasy sequencemissionproduct placementrace against timeknocked outlightningopening action scenescene during end creditspranklong takemanipulationscarhigh school studentcheerleaderexploding bodylaptoptied upcowsubtitled scenegaragebattlefieldpowersingle parentterminal illnesspickup trucknerdrockropegolddestinysabotagedestructionhead buttelectronic music scoremass murderheavy rainlooking at oneself in a mirrorgroup of friendsspacecraftexploding buildingkicked in the stomachvillainessjumping from heightend of the worldfateaction heroineinterracial friendshipcrushed to deathback from the deaddinosaurcannonfemale warriorrampagecrime scenecameoexplosivebraveryconstruction sitehatredmercilessnesspower outageresurrectionevacuationsuper villainswamppunched in the chestvolcanoaerial shotsuperheroinehologramrainstormlonerminestadiummutationjuvenile delinquentsecret identitykilling spreegeekwilhelm screamcoinbullet timecoffee shoptext messagingheroismgiant robotextraterrestriallevitationfinal showdownoutcasthigh school teacherconstruction workerdockfemale fightersuper strengthgiant monsterfireballworld dominationstandoffcomic reliefmechabully comeuppancemegalomaniactrailer homewallmisfitcrystalworkshopreluctant herotentacleoffscreen killingsuperhero teamleadersaving the worldjockhumorsuper powerfinal battleevil womanteamworkmeteortow truckprehistoric timeshigh school girloverturning carsuperhuman strengthhomeless personaircraftmasked herodetentionbo staffimprovised weaponfather son conflictbulldozercar rolloverchainsmass murdererstafflifting person in airrelictrespassinganti heroinedonutglowing eyesbilingualismteenage heroregenerationearth viewed from spaceepic battleabusive mothercryogenicsjewelry storehit by a traindutch anglecanteenleadershipdetonatorpenis jokesuit of armorsurprise during end creditshuman aliencliquequarryinvulnerabilityorigin of herobritish actor playing american characteralien technologybased on cult tv serieszero gravitykaijuangryhigh school footballsuperpowergold minegiant creatureabandoned minegreen hairrebootteenage angstfragments of glasssick mothermorphingteenage superherogolempickaxefootball fieldhouse arrestelectromagnetic pulselatin americanteenage rebellioncity in ruinsevil laughcoastal townevil laughterhumanoid alienfreeze to deathpower suitrepairreference to spidermangold toothfemale alienflipping carsuspended animationcostumed heroprank gone wrongorigin storycar hit by a traintalking robotalien robothigh school dropoutrobot suitfrozen alivemontage with pop songreboot of seriesteen rebelscepteralien languagepower rangerstooth knocked outtooth ripped outfloating in spacepower armorangry fatherlesbian lead charactercutting own hairanger issuesboat yardevil smileaggressivereference to iron manalien supervillainanger anonymousangry motherbody slamsinging nungeodeteenage lifefixkrispy kremepower rangerautism spectrum disorderautistic boyautistic spectrum disorderpunishedstaff weapon (See All)

Star Wars: Episode Vii - The Force Awakens (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Star Wars: Episode Vii - The Force Awakens (2015)

30 years after the defeat of Darth Vader and the Empire, Rey, a scavenger from the planet Jakku, finds a BB-8 droid that knows the whereabouts of the long lost Luke Skywalker. Rey, as well as a rogue stormtrooper and two smugglers, are thrown into the middle of a battle between the Resistance and th …e daunting legions of the First Order. (Read More)

Subgenre:
martial artscoming of ageepicspace operafamily dramascience fantasy
Themes:
torturemurderdeathrevengekidnappingbetrayalfearescapemonsterdeceptionangerdeath of fatherbrutalitysupernatural powerredemption …hopecouragenear death experiencespace travelunlikely herodestruction of planet (See All)
Mood:
ambiguous ending
Locations:
elevatorforestbarsnowdesertwatervillagewoodsouter spacespace stationspace battle
Characters:
father son relationshipmother daughter relationshipfemale protagonistsoldiernursealienhostagetough guywarrioraction herodeath of hero
Period:
2010swinter
Story:
good versus evilactor reprises previous roleopen endedreturning character killed offvisionmasked manstrong female leadmind controlgiantblockbusterstrong female charactertough girlprisonerorphaninterrogation …showdownbattleface slapfiresequelf ratedbloodviolencegunfightexplosionchasesurprise endingshootoutshot to deathfistfightshot in the chestremakeshot in the headrescueslow motion scenepunched in the facewritten by directorarrestgunfightbrawlfalling from heightshootingheld at gunpointhand to hand combatrobotislandcombatshot in the backsurvivalfoot chaseassassinsword fightgangambushstrangulationmassacredeath of friendwomanarmymixed martial artsstabbed in the chestmapno opening creditsanti heroone man armyfictional wardouble crossspaceshipcreaturebartenderfive word titleon the runduelone against manypilotbinocularscharacter repeating someone else's dialoguedangerkeyelectrocutionattackfugitivemissionrace against timemissing persontentknocked outopening action sceneshot in the shoulderlong takeshot in the armgeneralsubtitled scenebattlefieldstylized violencehenchmandestinycaptainsabotagedestructionspearmass murderheavy rainquesthelmetragewalkie talkieroman numeral in titlespacecraftexploding buildingcaucasianplanetproduced by directorskulllaseraction heroinecannoneaten alivepresumed deadfemale warriordamsel in distressexplosivebraverycrossbowseven word titleresistanceobesityhatredmercilessnesspower outagechaossunaerial shotprisoner of warwisecrack humorhologrambounty hunterlens flarelieutenantrescue missionsword duelcellarflamethrowerwilhelm screamtelekinesislaser guntelepathyfemale soldierjunkyardfemale fightershipwreckworld dominationmajormegalomaniacstar warsfemale spyadventure herocommandersmugglerhearing voicesfilm starts with textcrash landingfighter pilotgenetic engineeringreluctant heroblizzardpatricidetentaclefemale heromacguffinwoman kills a manlightsaberhumorstabbed in the shouldercapefamous scorewoman fights a manmasked villainroman numbered sequelexploding shipstarshipcloningjailbreakadmiraldogfightmind readingone woman armyresistance fighterlifting person in airanti heroinegogglesman with no namebilingualismalien creaturethirstepic battlescottish accentseventh partdesertermagical powerdetonatorsagaflame throwerwoman punches a manbombardmentfemale pilotair strikeangryhuman in outer spaceprosthetic limbrebootthe forcewoman hits a manjedi knightquicksandspit takeoutnumberedfather and sonscavengerson murders fatherstrong womancrisis of conscienceoutpostweapon of mass destructionabandoned shiphumanoid alienspace westernfictional planetnumber in character's namestabbed through the chestadvanced technologyjediangry manco pilotdroidexploding planetfood shortagelaser cannonstormtroopertalking robotspaceship crashdesert planetrationingmale soldierhumanoid robotsnowy landscapesuper weaponwarp speedhyperspacestarfightermale female huglightsaber battleplasmawookieeimax versionviolent outburstcharacter says i have a bad feeling about thisasteroid beltstarship bridgeturncoattie fighterastromech droidmillennium falconr2 d2remote detonatorx wing starfighterbattlecruisercharacter says may the force be with youprotocol droidstar destroyerworld destructionbipedal aliendesert landscapehandheld detonatorrobotic armspace fleetspacecraft cockpitstarfighter pilottentacled alienbar scenebattlecruiser starshipblaster pistolcrashed starshipplanetary destructionred blade lightsaberscrap merchantstarfighter cockpit (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Hansel & Gretel: Witch Hunters (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hansel & Gretel: Witch Hunters (2013)

The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)

Subgenre:
supernaturalmartial artsblack comedyfairy talesword and sorcerysteampunkdark fantasy
Themes:
magicmurderdeathsurrealismkidnappingbetrayalescapedeath of fathersupernatural powerdeath of motherabductionfalling in lovemissing child
Mood:
gore
Locations:
forestsmall towndesertvillagewoodscity
Characters:
evil witchwitchpolicebrother sister relationshiphostagetough guyaction herovillainsnipersheriffmayorsniper rifleself inflicted gunshot wound
Story:
good versus evilblack magickiss on the lipsmind controlwitchcraftdarktough girlorphaninterrogationshowdownbattlefirephotographcharacter name in titleflashback …female nuditynuditybloodviolencebare chested malegunfemale rear nudityfightexplosionknifechasepistolvoice over narrationpunctuation in titlebeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorswordbrawlfalling from heightrifleheld at gunpointhand to hand combatcombatshot in the backf worddecapitationcleavageassassinsword fightambushaxemassacrestabbingimpalementstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timeknocked outopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachbuttocksvillainesscovered in bloodgrindhouseaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved onefamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotguncabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All)

Vampire Academy (2014) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Vampire Academy (2014)

Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab …ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)

Subgenre:
martial artscoming of ageblack comedyteen romancevampire comedy
Themes:
evilmagictorturefriendshipmurderdeathloverevengesurrealismkidnappingbetrayalfeardancedeceptionsupernatural power …paranoiaredemptionsurveillancerivalry (See All)
Mood:
nightmarehigh schoolhalf vampire
Locations:
schoolhospitalchurchhelicoptermotorcyclecemeterybuswoodscaveschool teachersuv
Characters:
teacherteenage boyteenage girlteenagerfather daughter relationshipfriendboyfriend girlfriend relationshipfemale protagonistpriesttough guylove trianglevampirewarriorbest friendbully …villainteacher student relationshipolder man younger woman relationshipvampire girl (See All)
Period:
2010s
Story:
good versus evilfemale teacherbased on young adult novelopen endedyoung lovemind controltough girlclassroominterrogationcatdreamfirephotographflashbackkiss …based on novelbloodviolencetwo word titlefighttitle spoken by characterpartyknifesurprise endingpistolvoice over narrationshot to deathfistfightcar accidentshot in the chestrescueslow motion scenearrestkissingbrawlhand to hand combatcar crashhandcuffsstrangulationmountainmansionmontagestabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequencedouble crosscreatureroommatefemme fatalepantyhoseprincessnecklacetransformationon the runtraininglibrarycharacter repeating someone else's dialoguedangerstabbed in the backperson on firecover upgymdeath of brotherbodyguardbasementlaptopneck breakingqueenpowerstylized violencerunawaysisterundergroundsabotagesyringewolfloyaltyhypodermic needlesecurity camerajail cellaction heroinefemale warriorgirl with glassesbackpackstabbed in the throatshopping mallescape attemptmentorschool uniformlaughterwisecrack humorprison cellgeekcrowpractical jokespelldead animaltwist endingblack pantyhosefemale friendship17 year oldstabbed in the armfemale vampireschool principalbitten in the neckmonitorguardianoregonpsychic powercurecelldead cattwistlesbian subtextvampirismblack dressmind readingpet catanti heroineglowing eyesmontanastrengthmagical girlmagical powerblood drinkingwriting in bloodacademyjudo throwhigh fivestakeblood transfusionrepressed memoryhidden doornunchucksexploding motorcycledeath of petstained glass windowsedativeheadmistressvampire bitecomputer discadrenalinetightspyrokinesishealing powerreference to jimmy carterrunaway teenfemale narratorhalf humanvampire versus vampirechild vampirepsychic linkwrist bandageblack tightspsychic visionroyalwriting on walltattoo on neckvampire teethlicking bloodstake through the heartvampire stakedcamera footagedrinking fountainanimal on fireteenage vampiredhampirneck bitepsychic girl (See All)

Avengers: Age Of Ultron (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Avengers: Age Of Ultron (2015)

Tony Stark creates the Ultron Program to protect the world, but when the peacekeeping program becomes hostile, The Avengers go into action to try and defeat a virtually impossible enemy together. Earth's mightiest heroes must come together once again to protect the world from global extinction.

Subgenre:
martial artssuperhero
Themes:
magicmurderdeathrevengefeardrunkennessdeceptionsupernatural powerterrorismapocalypseself sacrificetechnologyartificial intelligence
Locations:
elevatorforestnew york citybarbeachchurchsnowmotorcycleairplanebuslondon englandwoodspolice stationcityafrica …shipcastlelaboratoryspace stationmotorcycle chasespace shiptrain accidentsinging on airplane (See All)
Characters:
professorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother sister relationshipsoldierhostagetough guywarrioraction heropregnant womanengineer …ex soldierpregnant wifealien superhero (See All)
Story:
good versus evilopen endedreturning character killed offensemble castvisionstrong female leadmind controlgiantblockbusterenemystrong female charactertough girlorphanbattlecharacter name in title …flashbacksequelviolencebare chested maleexplosionpartysurprise endingpistolcorpseshot to deathfistfightmachine gunshot in the chestrescueslow motion scenebrawlfalling from heightbased on comicheld at gunpointhand to hand combatsecond partrobothallucinationrevolvercombatscientistshot in the backdecapitationspybased on comic bookambushterroristaxemontagebridgearmymixed martial artsinternetexploding carsevered headno opening creditschild in perilunderwater scenetransformationtrainingcharacter repeating someone else's dialogueelectrocutionfantasy sequencemissionrace against timelightningtankopening action scenescene during end creditsdeath of brotheramerican flagcountrysideexploding bodydie hard scenariomercenarysevered armshot in the armsecret agentdismembermentbattlefieldstylized violenceak 47missilefalling down stairsdestructionbow and arrowflyingjeepcagesociopathbarnjail cellexploding buildingswat teamlaserorphanageend of the worldaction heroinecolonelinterracial friendshipcrushed to deathback from the deadandroidfemale warriorrampageshieldcameohaunted by the pasttarget practiceinventor3 dimensionalresurrectionevacuationheadphonesmarvel comicsjumping through a windowassault riflewisecrack humorsuperheroinehologrambody landing on a carfemale doctoreye patchgadgetterrorist plottelekinesisgatling gunshot multiple timeslaser gunbullet timerockettorso cut in halftracking devicefemale assassinsatelliteheroismfinal showdowntimebombtractorwar heroarmored carsuper strengthshipwreckarms dealerworld dominationdronemegalomaniacarcherybunkerbillionairefemale spyneo nazihit by a truckfighter jetexploding truckdance clubgenetic engineeringinfertilityballerinasuperhero teamfinal battlecapejetteamworkhigh techarchertragic pastaircraftaircraft carriercut into pieceseastern europehit with a hammerheart ripped outhuman experimentaerial combatsecret passageceoforce fieldglowing eyesscience runs amokarmoryballroomexpectant motherworld war two veteranchrysler building manhattan new york cityfictional cityregenerationvillain turns goodepic battlechopping woodslow motion action scenekiller robotgadgetrysexual innuendoexpectant fatherbrandinggadget carhuman aliensuper speedbuilding collapseinvulnerabilityflying carmayhemhidden doorsafe housetelling a jokesuper computercocktail partymotorcycle ridingfriendly fireflying manmarvel entertainmentelectromagnetic pulsesupervillainoslo norwaymarvel cinematic universebridge collapsesouth africanman versus machinelarge format cameradarwinismrobot as menacetalking computerexploding tankrobot as pathoscostumed herohumanity in periltalking robotrobot armyred capeevil robotgauntlethumanoid robotradical transformationrobot suittrain derailmentcaped superherocommuter trainfuturistic aircraftgemstonescepterflying superheromale aliennorse godsentient robotrunaway traindeath of twinmuscle growthextraterrestrial humantwin brother and sisterextraterrestrial manman wearing an eyepatchfloating citytechneparty gamejumping on a moving vehiclepunched in the face multiple timesthrowing dartsflying fortressstan lee cameosuperhero versus superherocharacter turns greengerman scientistseoul south koreathe incredible hulkblack widow the characterself driving carsemi truck and trailerverticle take off and landing aircraftfront wheeliewoman riding a motorcycleflying supervillainspitting out a toothwar hammerfalcon the characterhawkeye the characterhelicarrierreference to odintanker truck explosion (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Sleeping Beauty (1959)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sleeping Beauty (1959)

After a beautiful princess, Aurora, is born in to royalty everyone gathers to exchange gifts. Everything is perfectly fine until an unwanted guest appears, Maleficent. Magnificent casts a spell on the young princess and announces that she will die by pricking her finger on the spindle of a spinning  …wheel on the evening of her 16th birthday. Fortunately, one of the good fairies, Merryweather, changes the spell so Aurora will fall asleep, and that the only way to wake her up were the tears from her true love. Finally the day comes. Will she be left to sleep forever? (Read More)

Subgenre:
fairy talesword and sorcery2d animationdisneysword and fantasybased on fairy talehand drawn animationtraditional animation
Themes:
evilmagicfriendshipsurrealismprisondrunkennessdancehero
Locations:
forestfrancecastle
Characters:
evil witchwitchteenage girlfather son relationshipfemale protagonistbaby girl
Story:
good versus evilowlprophecyblockbusterwitchcraftlifting someone into the airgiftbattlefirekissbloodsingingvoice over narrationcryinghorse …swordbirthdaydemoncombatbound and gaggedwinesword fightmountainfishbirthday partyforeign language adaptationkingfemme fataleprincesscursemistaken identitydragonrabbithorse ridingtrapflowerqueenprincespeardresseggcakevillainessknightcelebrationguardstupiditydamsel in distressshieldfairylove at first sighthypnosisoildungeonkingdomarrowlightspellhappy endingfinal showdownstonetrue lovecrownsquirrelsleepcottageyoung womanfriends who live togetherfinal battlerainbowravencleaningyoung manhappy birthday to yousurprise partybroomlifting female in airbirdsbuckethuman becoming an animalbubblecoatmagic wandfireworkfalling asleepawakeningturned to stonechimneytalking to an animalfire breathing dragonmockerycastle thundersuper villainesssurprise birthday partyplatefalling off horsemop14th centurydrawbridgeacornbootsleeping beautycradlepet bird16th birthdayspinning wheeldisney princesslutebluebirdhelpingstorybook in opening shotbetrothalthornbaking a caketransmutationpricked finger (See All)

Hocus Pocus (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hocus Pocus (1993)

300 years have passed since the Sanderson sisters were executed for practicing dark witchcraft. Returning to life thanks to a combination of a spell spoken before their demise and the accidental actions of Max, the new-kid-in-town, the sisters have but one night to secure their continuing existence. ….. (Read More)

Subgenre:
cult film
Themes:
magicghostrevengefearangersupernatural powerhumiliationunrequited lovefalling in lovebook of magic
Mood:
high school
Locations:
motorcyclecemeterymuseumsewer
Characters:
evil witchwitchteenage boyteenage girlbrother sister relationshipzombiesister sister relationshiplittle girlbully
Period:
1990s17th century1700s
Story:
good versus evilmagical broomstickwitchcraftlifting someone into the airdarkcatfiretwo word titlecigarette smokingtitle spoken by charactersingingsurprise endingcryingbedsubjective camera …decapitationhalloweencandlehousetied to a chairtransformationpainvirginproduct placementdeath of childscreamscene during end creditshanginghalloween costumecabinhaunted houseundeadfalling down stairsburned alivetalking animalhatspidertorchsevered fingerrejectionimmortalityhypnosischairhalloween partyarrogancemale virginspellcandydead animaltrick or treatingdoubtlighterbicyclingtombstonecottageshoerhyme in titlecabin in the woodssunrisepotionwarningnoosebus rideblack catpillowsaltlobsterwitch costumeliquidhorror for childrenvillain turns goodovensittingtelephone numberhuman becoming an animalchild killerturned to stonedevil costumelifting a female into the airroadkillcaged humanspit taketalking catchased by a dogevil laughterpet foodblown coverflying broomcurseddisbelieving adultlightingsiren the alarmsiren the creaturedracula costumefire sprinklerspellcastingdrum setmouth sewn shutbeheadeddeath by poisonfuture shockmagical booksmashed pumpkininterrupted kissreference to madonna the singermanhole coversalem massachusettswitch burningkilnrevenantsacred groundtoilet paperingyouth restoredselling soulpoliceman costumedaylight saving timedeath by sunriseexploding personfiery redheadflattenedforced to danceevil musicrenaissance costume (See All)

The Little Mermaid (1989) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Little Mermaid (1989)

In Disney's beguiling animated romp, rebellious 16-year-old mermaid Ariel is fascinated with life on land. On one of her visits to the surface, which are forbidden by her controlling father, King Triton, she falls for a human prince. Determined to be with her new love, Ariel makes a dangerous deal w …ith the sea witch Ursula to become human for three days. But when plans go awry for the star-crossed lovers, the king must make the ultimate sacrifice for his daughter. (Read More)

Subgenre:
fairy tale2d animationfish out of waterdisneybased on fairy tale
Themes:
magicfriendshiploverevengesurrealismbetrayalfeardanceweddingangerfalling in loveself sacrifice
Locations:
kitchenbeachboatseashipcastleoceanstormcaribbeanstorm at seasea foodsea stormship firesea witch
Characters:
evil witchwitchteenage girlteenagerfamily relationshipsfather daughter relationshipfemale protagonistmusicianpriestsister sister relationshipbest friendmaidmermaidmysterious girllittle mermaid
Period:
19th century1830s
Story:
good versus evilyoung loveteenage protagonistgiantblockbusterwitchcraftlifting someone into the airteen angstfireworksbattlefiredogkissnudityfight …title spoken by characterexplosionsingingknifethree word titlemirrorrescuebirthdaybedcookingconcertdisguisefishdinnerforeign language adaptationbathkingprincessdrowningtransformationdangerbased on short storymistaken identitystatuelightningexploding bodysadnessfirst partunderwatersacrificeprincerockropepiratedestructiondressheroinetalking animalscene during opening creditsroyaltyvillainesscheffrogsharkbrideanimal attackanthropomorphismtelescopeanthropomorphic animalmuterowboathypnosismusical numberspyingturtlesailorduckkingdomwishsmokespellcontracthappy endingsidekicksunsetlaundrydockscene before opening creditsflutelegsseagull16 year olddolphinnude girlunconsciousnessbubble bathfemale heroswimming underwatermeat cleaverpipepotionfriends who live togetherfinal battlecrabstar crossed loversrainbowalter egooctopusexploding shiprescue from drowningsnailconductornakedbarrelwavemagic spellshark attackx rayed skeletoncanceled weddingwedding cakefat womancarriagehumanbirdsdefeatvoicedealcuriosityseal the animalforkpuppet showfalse namedanishstruck by lightningjamaicanharpoonblowing out candledisobeying orderslifting a female into the airfireflycollectinganchorcastle thunderclotheslinecinderella storysuper villainesslagoonseashellblue eyesjack in the boxmalletevil laughtershrimpsunken shiphans christian andersenseasicknessred eyesflamingolairfake namemaster of disguisestarfishpelicantridenttalking birdbird attacksea turtletrue identity revealedsailwolf whistlewhirlpoolgrottowhite hairmermanblowing smoke in someone's faceredheaded girltalking fishinterspecies romanceseafoodseahorseangry fathersinging animalbedtimeloss of voicedisney princessbluebirdpinching nosecombing someone's hairbitten on the buttflower in hairgiantessseashell bikinidisguised as humanmoray eelappearing from watercrow's nestlily padobjectanimal licking someonespiraling eyestalking crabwashing oneselfbroken teethfiery redheadwasher womanblowing a raspberryflattenedfrench chefold english sheepdogbecoming humandestroying a statuefish tailpolypundersea kingdom (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Beauty And The Beast (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Beauty And The Beast (2017)

Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc …hanted. (Read More)

Subgenre:
coming of agetragedyfairy taleslapstick comedyfish out of waterdisneydark fantasybased on fairy tale
Themes:
magicloverevengesurrealismkidnappingjealousyfearescapedancemonsterdeceptionobsessionsupernatural powerdeath of motherblackmail …redemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All)
Mood:
poetic justice
Locations:
forestbarsnowparis francebathtubvillagewoodsfrancelakecastlerooftop
Characters:
witchhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglelittle boymaidgrandmother grandson relationship …single fatherex soldier (See All)
Story:
studio logo segues into filmspiral staircaseteleportationowlensemble caststrong female leadblockbusterfireplacebirdfalse accusationbedroomshowdownbattlefirephotograph …character name in titlekissflashbackdogbare chested malefightdancingtitle spoken by characterexplosionsingingpartychasesurprise endingpistolvoice over narrationbeatingcorpsehorsemirrorshot in the chestremakerescueslow motion scenepunched in the faceswordkissingbrawlfalling from heightpaintingrifleheld at gunpointbedpianoshot in the backcandlesword fightmountaindisguisewomanmontagebridgefour word titlemapno opening creditsdrawingcontroversykingcreaturetransformationbartenderflash forwardattempted murderlibrarycursedangerprologuewidowerrace against timeknocked outlightningmanipulationwigtied upgardencabinloss of motherlove interestreference to william shakespearequeenprincesingle parentchesswerewolficeropefalling down stairswolfdressheroineheavy raintalking animalhunterloss of wifeeccentriccomposerservantjumping from heightculture clashcgitorchcompassionanimal attackclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptballbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumaristocratimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monstermarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All)

The Mortal Instruments: City Of Bones (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Mortal Instruments: City Of Bones (2013)

Set in contemporary New York City, a seemingly ordinary teenager, Clary Fray, discovers she is the descendant of a line of Shadowhunters, a secret cadre of young half-angel warriors locked in an ancient battle to protect our world from demons. After the disappearance of her mother, Clary must join f …orces with a group of Shadow Hunters, who introduce her to a dangerous alternate New York called the Shadow World, filled with demons, warlocks, vampires, werewolves and other deadly creatures. (Read More)

Subgenre:
independent filmmartial artscoming of agefish out of waterdark fantasy
Themes:
magictorturefriendshipmurderdeathrevengesurrealismsuicidekidnappingbetrayalescapemonsterdeceptionsupernatural powerdeath of mother …abductionhome invasion (See All)
Mood:
Locations:
new york citychurchhotelmotorcyclecemeterynightclubbicyclewaterrooftop
Characters:
witchteenage girlteenagerhomosexualmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guyartistlove trianglevampirewarrioraction herosecurity guard …suicide by poison (See All)
Story:
good versus evilbased on young adult novelspiral staircaseteleportationvisionmind controlphone boothtough girlbirdinterrogationshowdownbattledogflashbackkiss …based on novelbloodviolencebare chested malegunfightexplosionpartyknifechasesurprise endingcell phonefistfightrescueslow motion sceneswordbrawlsecretfalling from heightletterpaintinghand to hand combatplace name in titlebirthdaypianodemoncombatfoot chasecandlesword fightambushthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairanti heropainterdrawinghit by a carfictional warcreaturenecklacetransformationlibrarystabbed in the backmini skirtangelstatuelightningskeletonscarexploding bodybasementgardenthreatened with a knifeflowerbattlefieldstylized violencehenchmanwerewolfspearheroineheavy rainirishskullbrooklyn new york cityfaked deathmonkaction heroinefemale warriormechaniccamera shot of feetdual wieldimmortalitybutterflysketchdungeonrainstormrefrigeratordemonic possessionsecret identityflamethrowerplaying pianotelekinesisdaggerstick fighttelepathycrowdrugged drinkenglishman abroadimpersonating a police officergothfire extinguisherfemale fighterteenage lovestairwayportalworld dominationbrooklyn bridgemegalomaniacgreenhousereluctant heromacguffinsunriseravehit with a shovelshapeshiftingsymbolcockney accentmind readingpentagramteenage herogas explosionchrysler building manhattan new york citycuptarot cardmidnightflame throwerbody part in titlearsenalmausoleumman fights a womanbarefoot womanwarlockrottweilerfrying panturned to stonecaught in the rainsanctuaryfireflyhit with a frying panpoetry readingalternate worldpoisonedlittle black dresslancefake deathsecret tunnelaccidental incesthealing powersecret compartmenttarot cardshalf humandemon huntersurroundedabandoned hotelsecurity officerbead curtainadult as childcappuccinohiding under a tablehit with a fire extinguisherinstitutereference to johann sebastian bachpsychic readingreplica16th birthdayupright pianowoman changing clothesnephilimwoman wearing a little black dressbreak door inhalf brother half sister incestrecovered memoryleg hold trappost it notevampire versus werewolfantique storewoman faintingnew york cityscapehooded manbarricading a doorbeam of energyred ballauto repair storechained to a chair (See All)

Alice In Wonderland (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Alice In Wonderland (2010)

Alice, an unpretentious and individual 19-year-old, is betrothed to a dunce of an English nobleman. At her engagement party, she escapes the crowd to consider whether to go through with the marriage and falls down a hole in the garden after spotting an unusual rabbit. Arriving in a strange and surre …al place called "Underland," she finds herself in a world that resembles the nightmares she had as a child, filled with talking animals, villainous queens and knights, and frumious bandersnatches. Alice realizes that she is there for a reason--to conquer the horrific Jabberwocky and restore the rightful queen to her throne. (Read More)

Subgenre:
high fantasyfairy talefish out of waterdark fantasylive action and animation
Themes:
magicsurrealismmarriagefearescapemonsterangerinsanityexecutionself sacrifice
Locations:
forestlondon englandwoodsshipcastlechina
Characters:
teenage girlhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfemale protagonistsoldierdancerlittle girlmythical creature
Period:
19th century1800s1870s
Story:
opening creditsbased on young adult novelpsychotronic filmteleportationprophecyblockbusterlifting someone into the airanimalbirdprisonerbattlecatface slapdreamfire …character name in titleflashbackkissdogf ratedbased on novelfightdancingpartyhorseslow motion scenecomputerswordpaintinglierunningpianohallucinationhandcuffssubjective cameradecapitationcandlesword fightmansionarmymapfishsevered headno opening creditspainterfictional warjourneymarriage proposalnecklaceflash forwardattempted murderkeyliaractor playing multiple rolesdragonrabbitlightningflowerspigfirst partgardentwincult directorqueenmonkeychesssisterdestinyspearwoundtalking animalcakequesthatmousefrogtorchclockcelebrationfemale warrioranthropomorphismimaginationtelescopebootsfanimpostor3 dimensionalanthropomorphic animalsibling rivalryenglishrosebutterflyengagementeye gougingbalconyknife throwingstabbed in the eyeeye patchpuppyhorse and carriagecrowdhorseback ridingvictorian erabeheadinginvisibilitywedding ceremonyruinsdoubtstairwayestatecrownhuntpocket watchfantasy worldfallingeyeballmushroompotiondisembodied headwindmillcoderepeated lineriddlereturning hometalking dogslapalice in wonderlandthronetop hatred hairvulturecanceled weddingsailing shippower strugglecaterpillarimplied nudity19 year oldscrollbanishmentsuit of armorlordfalse namehedgehogjugglershrinkingcandelabrared rosemagical potionmagical swordexecutionerfireflyscarred facefire breathing dragongazebotalking cattea partykeyholeempressengagement partyplaying cardsame actor playing two characterswhite rabbitevil queensentenced to deathflamingokilled with a swordlisprocking horseharehookahteapotcocoondrawbridgemonarchwhite rosethe color redwardrobe malfunctionfalling into a holefemale slaps maleblowing smoke in someone's faceknife in handprosthetic body partbloodhoundmonocletalking horsebugleflock of birdslive action remakemoatsedan chairtrumpetersudden change in sizemanaclessugar cuberose gardenchanging sizetree stumpdragonslayerfake noseforced perspectivemad hatterfantasy landdodogrowing in sizelawn partyoverweight boyrabbit holetalking mouseanimal wearing clothesanthropomorphic flowercheshire catlewis carrollqueen of heartsrose bushtartblowing one's nosedomino fallbig headtalking animalstalking frogaccidental nuditycolor in character's namefalling down a holegap toothedlawn croquetbattle for thronejabberwockyleg chainsred queenhead huntinglive action adaptationmistaking reality for dreamrivalry over throneslaying a dragontalking flower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Mummy (2017) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Mummy (2017)

Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.

Subgenre:
supernaturalmartial artsblack comedyparanormal phenomenadark fantasymonster movie
Themes:
evilmagicghostfriendshipmurderdeathrevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionmilitary …seductionangersupernatural powerparanoiaredemptionsurveillancepaniccourageself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All)
Mood:
darknesshorror movie remake
Locations:
foresttrainchurchhelicoptercemeteryairplanebusdesertlondon englandwoodspolice carrooftopmuseumlaboratorytunnel
Characters:
professorpolicedoctortattoozombiesoldierpolice officerpriesthostagethieftough guywarrioraction herosecurity guardamerican abroad …self mutilationbabe scientistamerican in the uk (See All)
Period:
2010s
Story:
good versus evilblack magicsecret roomopen endedsecret societyvisionmind controlratshowdownbattleface slapdreamfiredogflashback …bloodviolencebare chested malefemale rear nudityfightexplosionknifechasesurprise endingpistolshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestremakeshotgunrescueslow motion scenepunched in the facegunfightbrawlbare buttheld at gunpointbeerhand to hand combatsunglassescar crashhallucinationcombatscientistshot in the backsubjective camerafoot chaseflashlightambushstrangulationaxemassacreambulancedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesno opening creditsanti herodisarming someoneone man armycoffinassassinationdouble crossritualunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincessdrowningtransformationflash forwardattempted murderpilotcursebinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologuescreamingelectrocutionattackfantasy sequencecharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outlightningopening action sceneskeletonmanipulationscarinjectionlaptopthreatened with a knifemercenarypubsubtitled sceneundeadbattlefieldpowerak 47pickup truckmissiledestinyhand grenadegrenadedestructionassassination attempthypodermic needlegothictape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachspidervillainesspoolskullknighttorchfateburialcolonelback from the deadiraqgun battleguardrampagecrime scenereverse footagemiddle easttarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckresurrectionevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessiontelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickliving deadalleyfinal showdownburied alivetasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefmegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingbitten in the neckmacguffinwoman kills a manaltered version of studio logoheirchainedarcheologistalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorfratricidecryptinfanticideregenerationtragic villainwomen's bathroomarchaeologistdecomposing bodyenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All)

Brave (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Brave (2012)

Set in Scotland in a rugged and mythical time, "Brave" features Merida, an aspiring archer and impetuous daughter of royalty. Merida makes a reckless choice that unleashes unintended peril and forces her to spring into action to set things right.

Subgenre:
coming of agecomputer animationslapstick comedycgi animation
Themes:
magicghostrevengemarriageescapedeceptionredemption
Locations:
forestsnowboatvillagewoodsshipcastle
Characters:
witchteenage girlhusband wife relationshipteenagerfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipfemale protagonistgirltough guywarrior …maidhunting party (See All)
Story:
good versus evilblack magicscotlandstrong female leadteen angstfireplacestrong female charactertough girlshowdowndogflashbackfemale nudityf ratedone word titlemale rear nudity …dancingtitle spoken by characterknifechasesurprise endingvoice over narrationtitle directed by femaleshot to deathhorseshot in the chestrescueslow motion scenepunched in the faceswordbare buttbirthdayriverswimmingfoot chasesword fightambushaxemontagefishno opening creditskingprincessnecklacetransformationon the runtrainingflash forwardlegendcursecharacter repeating someone else's dialogueprologuescreamingkeyrace against timelightningprankcontestfeminismchickenwaterfallshot in the armbearqueenprincechessdestinyfalling down stairsspiritbow and arrowspearheavy rainlooking at oneself in a mirrorcakebuttocksrebelsheeptorchfateanimal attackapplefemale warriorshieldtarget practicebravery3 dimensionalrowboatscene after end creditspunched in the chestmedieval timesprideaerial shotshadowrainstormknife throwingkingdomwisharrowsign languagecrowhorseback ridingtriple f ratedhit in the facebirthday presentstuffed animalstrongmanshot with an arrowyoung version of characterarcherycrowndomineering motherfemale heromooningmacguffinstablefight the systemheirarcherbechdel test passedbowbagpipesanimal killingbanquetrock climbingmagic spellteenage herothronehide and seekmedievalsuitorscottish accentbroomscotclothes rippinghuman becoming an animallordharptrackerrebellious daughterruinwood carvinginvisiblespit takeclanspear throwingteenage rebellionmatriarchytrackingone legged manrider horse relationshipwooden legmusic lessontug of warscottish highlandstripletscauldrongirl horse relationshipaxe throwingthrown from a horsebareback ridingredheaded girlcubriding bareback10th centuryirish wolfhoundtapestrypeg legceltdisney princessevil spelllutefemale horse riderfemale archerbetrothalplaying bagpipesbullseyehaggisanimal becomes humangirl riding a horsewill o' the wispfiery redheadwork horsedrumstickrefusing to believehighland gamesmenhir (See All)

Star Trek Beyond (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Star Trek Beyond (2016)

After stopping off at Starbase Yorktown, a remote outpost on the fringes of Federation space, the USS Enterprise, halfway into their five-year mission, is destroyed by an unstoppable wave of unknown aliens. With the crew stranded on an unknown planet and with no apparent means of rescue, they find t …hemselves fighting against a ruthless enemy with a well-earned hatred of the Federation and everything it stands for. Only a rebellious alien warrior can help them reunite and leave the planet to stop this deadly menace from beginning a possible galactic war. (Read More)

Subgenre:
martial artsfuturisticspace operarevenge plot
Themes:
friendshipmurderdeathrevengekidnappingbetrayalfearescapedeceptionangerbrutalityparanoiahopepanicvengeance …courageself sacrificenear death experiencespace travelalien abduction (See All)
Mood:
half alien
Locations:
elevatorforestbarmotorcyclewoodscityouter spacecavespace stationspace battlealien ship
Characters:
african americandoctoralienhostagetough guywarrioraction herointerracial relationshiprussianengineerex soldierrevenge motiveformer soldierrevenge seeker …same sex kiss (See All)
Period:
23rd century
Story:
good versus evillong haired womanopening creditsshape shiftingpsychotronic filmnight timemale protagonistreturning character killed offteleportationblockbusterenemystrong female charactertough girlprisonerorphan …showdownbattlephotographsequelviolencebare chested malefightexplosionpartyknifechasethree word titlevoice over narrationshootoutcorpseshot to deathfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facegunfightbrawlfalling from heightheld at gunpointhand to hand combatbirthdayrock musiccombatshot in the backsurvivalfoot chaseambushstrangulationdisguisedeath of friendmontagebridgeimpalementmixed martial artsno opening creditsdisarming someonedouble crossbirthday partyspaceshipunderwater scenecreaturesearchthird partnecklacetransformationcoffeeone against manybased on tv seriesdangerelectrocutionattackmini skirtmissionrace against timeknocked outkicked in the facelong takethreatened with a knifesubtitled scenebattlefieldstylized violencehenchmanlgbtdestructionheroinegay charactersurvivorcaptivewalkie talkiespacecraftkicked in the stomachplanetaction heroineinterracial friendshipcrushed to deathfemale warriorbraverycynicisminventorhatredmercilessness3 dimensionalevacuationfalling to deathimmortalityescape attemptpunched in the chestjumping through a windowbooby trapaerial shotblack eyewisecrack humorhologramtitle at the endcapturedisfigurementdark pastlens flarewar veteranlieutenantmutationrescue missiondictatorwilhelm screamwritten by starlaser gunfast motion scenetracking devicevodkasatellitetranslatormale objectificationinvisibilitygay manfinal showdownfemale fighterstar trekstrandedpromotionportaldronemegalomaniacno title at beginningcommandercrash landingartifactfemale martial artistmacguffinwoman kills a manhumorfamous scoreshape shiftertragic pastwoman fights a manalien planetexploding shipstarshipsubterraneanwarlordadmiralmedical doctorone woman armybo stafffamous linevillain not really dead clicheforce fieldanti heroinearmoryalien creaturegas explosionalien racescottish accenttragic villaindutch anglescotsmanhuman alienhuman versus alienbiological weaponalien technologyzero gravityfalse nameman fights a womanbrandyhuman in outer spacelifted by the throatmotorcycle stuntvideo recordingfragments of glasssurprise attackafrican american manescape podstar died before releaseloud musicoutnumberedscavengeroutrunning explosionbased on cult favoriteabandoned shipexplosive decompressionhumanoid alienspace westernwoundedswarmdirected by co starsearch and rescuesecret revealedancient astronautfemale alienrap songvideo messagetrue identity revealeddisintegrationhalf humanspaceship crashthirteenth partgreen skinwarp speedalien civilizationphaservulcandeep spacedistress signalfuturistic cityalien languagefloating in spacestarship captaincommunicationsinvisibility cloakphoton torpedoesenterprise the starshipfemale humanoid alienalien artifactshapeshiftertragic heroinewhiskyhuman alien hybridspaceportvow of revengenebulaspaceship captainstarship interiorspace navyasteroid beltmale captainstarship bridgesequel to a rebootstarfleet captainalien weaponfederation starshipmale doctorartificial gravityhandheld communicatorattempted revengehuman vulcan manplanet viewed from outer spacepointy earsshakespearean quotechief medical officerhuman beingrevenge beatingspace captainu.s.s. enterprise ncc 1701vulcan manbipedal alienfemale lieutenanthalf human half alienlife force sucked outmale physicianspacecraft cockpitstarship crewtricorderalien crew memberdisintegrating bodystaff weaponu.s.s. enterpriseu.s.s. enterprise ncc 1701 auniversal translator (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witches (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witches (1990)

A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.

Subgenre:
conspiracyabsurdism
Themes:
magickidnappingmoneyfearescapeangerdeath of fathersupernatural powerdeath of motherabductioncrueltypanicmissing child
Locations:
englandkitchenelevatorschoolbeachrestauranthotelsnowsmall townbicycletaxipolice carocean
Characters:
witchhusband wife relationshipfamily relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipdoctorgirlpolice officerpolicemanbabylittle girllittle boy …maidgrandmother grandson relationship (See All)
Story:
good versus evilwitchcraftlifting someone into the aireavesdroppingfireworksgiftsnakebedroomorphancatbased on novelsingingsurprise endingcryingbased on book …underwearrescuemaskpaintingtearsrunningbirthdaysubjective camerafoot chasecandlemountaindisguisechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationmissing personscreamspeechdisappearancepursuitwigexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of mothereuropebirthday cakeeyeglassesapplausetalking animalcakecagefaintingcomic bookhatcookmousehidingaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleaverhandtreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalyoung boyrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All)

Mirror Mirror (2012) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mirror Mirror (2012)

After a beloved King vanishes, his ruthless wife seizes control of the kingdom and keeps her beautiful 18-year-old stepdaughter, Snow White, hidden away in the palace. But when the princess attracts the attention of a charming and wealthy visiting prince, the jealous Queen banishes the girl to a nea …rby forest. Taken in by a band of rebellious but kindhearted dwarfs, Snow White blossoms into a brave young woman determined to save her country from the Queen. With the support of her new friends, she roars into action to reclaim her birthright and win back her Prince in this magical adventure comedy that will capture the hearts and imaginations of audiences the world over. (Read More)

Subgenre:
fairy talebased on fairy tale
Themes:
magicfriendshipmarriagejealousyescapedancedeceptionrobbery
Locations:
forestsnowwoodslakecastletown
Characters:
evil witchwitchfemale protagoniststepmother stepdaughter relationship
Story:
good versus evilblack magicstrong female leadwitchcraftstrong female characterbirdcharacter name in titlekissf ratedtwo word titlebare chested maletitle spoken by characterpartychasehorse …mirrorremakeswordbirthdaysword fightdisguiseno opening creditskingprincesstrainingattempted murderdangerpuppetkeyscene during end creditsbare chested male bondagequeenprincechessrepetition in titleroyaltyvillainessappledwarfbutcherkingdompuppydaggerspellinsecurityfemale fightercockroachstepmothercrownrumorbeast18 year oldhanging upside downscorpionheiresshiding under a bedfinancial problemcanceled weddinghung upside downbanishmentpendantsong and dancebarongalamagical potiondisobeying ordersleechhands tied behind backsnow whiteevil queentaxmagical mirrorevil plotmirror does not reflect reality18th birthdayevil stepmotherwoman fights mantalking to mirrordark powertax collectorpoison appleturned into an animalwicked witchsong during creditsseven dwarvesunder a spellenchantresshalf naked manorders to killdecreehuman chessboard (See All)

The Wizard Of Oz (1939)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Wizard Of Oz (1939)

In this charming film based on the popular L. Frank Baum stories, Dorothy and her dog Toto are caught in a tornado's path and somehow end up in the land of Oz. Here she meets some memorable friends and foes in her journey to meet the Wizard of Oz who everyone says can help her return home and possib …ly grant her new friends their goals of a brain, heart and courage. (Read More)

Subgenre:
allegory
Themes:
magicfriendshipescapedancedysfunctional familyguiltabductioncourage
Locations:
forestsnowbicyclevillagefarmroad tripcastlewalled city
Characters:
evil witchwitchhusband wife relationshipsingerhostageuncle niece relationshipaunt niece relationshipcoronergirl and her dog
Story:
good versus evilcrystal ballwizardwitchcraftlifting someone into the aircatdreamfiredogtitle spoken by charactersingingcryingsonghorserescue …secretfalling from heightaxedisguisechild in periltreeperson on firethreatflowermonkeyrunawaytalking animalquestfaintingvillainesshomecompassionanimal attackcrushed to deathclockguarddwarfinnocenceimpostorpet dogawardlionjumping through a windowheartdeath of sisterdungeonsnowingsecret identityfortune tellerbrainadolescentcrowauntlevitationgatefireballfarmhousetween girlmedalhot dogtornadoshoecornfieldunconsciousnessfantasy worldchandelierscarecrowhot air balloonbeauty salonbechdel test passedreference to abraham lincolnkansaspigtailsrecluselocked in a roomintellectualdoormanvoyagemagic spellcurtainbroomcowardicebubblefalling asleepniecehomesicknesshourglassbasketrich snobalternate universetalking to a dogdeus ex machinait was all a dreampleadingwizard of ozcrossroadslittle personpet owner relationshipcharlatandrawbridgereference to julius caesarfarm handapple treegreen skinreference to cleopatracycloneanimate treedeath certificatediplomaowner dog relationshipwavinghaunted forestreference to isistin mansmall dogtalking treefacadeslipperwoodsmanreference to the egyptian god osirisaccidental herobroomstickomaha nebraskahome sweet homepigstybucket of waterflying monkeyimaginary landmagical shoegood witchskywritingfloating headloyal doganthropomorphic treemelting womanoil canpoppy fieldflying witchhonorary degreeruby slippers (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hunger Games: Catching Fire (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hunger Games: Catching Fire (2013)

Twelve months after winning the 74th Hunger Games, Katniss Everdeen and her partner Peeta Mellark must go on what is known as the Victor's Tour, wherein they visit all the districts, but before leaving, Katniss is visited by President Snow who fears that Katniss defied him a year ago during the game …s when she chose to die with Peeta. With both Katniss and Peeta declared the winners, it is fueling a possible uprising. He tells Katniss that while on tour she better try to make sure that she puts out the flames or else everyone she cares about will be in danger. (Read More)

Subgenre:
conspiracypost apocalypsedystopiacyberpunkpolitical satire
Themes:
torturemurderdeathsuicidedancedeceptionmilitarydeath of motherparanoiasurveillanceexecutiontraumarevolutionself sacrifice
Mood:
nightmaresatire
Locations:
elevatorforesttrainbeachhelicoptersnowwoodsjunglecampfireairship
Characters:
husband wife relationshipteenagermother son relationshipmother daughter relationshipfemale protagonistsoldiersister sister relationshiplove trianglewarrioralcoholic
Period:
futurenear future
Story:
fictitious sportbased on young adult novelopen endedreturning character killed offstrong female leadblockbusterstrong female characterfireworkstough girlfirephotographsequelf ratedbased on novelblood …violenceinterviewbare chested maleexplosionpartyknifesurprise endingpistolcorpseshot to deathmachine gunhorseshot in the chestshot in the headpunched in the facecomputerswordundressingsecretlettersecond parthallucinationislandcompetitiontelevisionscientistshot in the backsurvivalmansiondeath of friendmontagearmyimpalementstabbed to deathstabbed in the chestno opening creditsunderwater sceneshot in the legdrowningtrainingtreecharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on fireelectrocutionfactorypoisonknocked outlightningpresidentthreatsuspicionthreatened with a knifemercenarywhippingbare chested male bondageclass differencesgraffitiapplausebow and arrowkilling an animalwhat happened to epiloguespearhypodermic needleheavy rainpropagandacovered in bloodfaked deathtournamentaction heroineanimal attacksocial commentaryfemale warriorfloodresistanceinventorpower outagementorfogfascismhologramtitle at the endhealingrainstormwedding dressstadiumtourflamethrowerdictatorsign languagepalacetracking devicebatoppressionarcherystabbed in the armno title at beginningcommanderstretcherfemale heroman punching a womanfight the systemminerapeone woman armyuprisingflogginganimal killingforce fieldanti heroinelocketteenage herototalitarianismpost traumatic stresstalk show hostprotective malewaltzcprbleeped dialoguebaboonfaked pregnancyfake marriagebird attackdometeenage heroinefuturistic trainsugar cubesports arenapoisoned to deathfemale archer (See All)

Fantastic Four (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fantastic Four (2015)

FANTASTIC FOUR, a contemporary re-imagining of Marvel's original and longest-running superhero team, centers on four young outsiders who teleport to an alternate and dangerous universe, which alters their physical form in shocking ways. Their lives irrevocably upended, the team must learn to harness … their daunting new abilities and work together to save Earth from a former friend turned enemy. (Read More)

Subgenre:
martial artssuspensesuperhero
Themes:
friendshipmurderdeathrevengesurrealismdrunkennessescapemilitaryangerdeath of fathersupernatural powerredemptionsurveillancenear death experience
Mood:
high school
Locations:
forestnew york cityhelicopterlaboratory
Characters:
professorteenage boyteenage girlteenagerfather son relationshipfather daughter relationshipbrother brother relationshipsoldierinterracial relationshipsecurity guardchildhood friendengineer
Period:
2000s2010syear 2014year 2007year 2015
Story:
good versus evilteleportationstrong female leadgiantenemystrong female characterorphanclassroomshowdownbattleface slapfirenumber in titlebloodviolence …two word titlebare chested maleexplosionsurprise endingcell phonebeatingdigit in titleblood splatterfistfightmachine gunshot in the chestremakerescuepunched in the facewritten by directorbrawlbased on comichand to hand combatcar crashscientistsubjective camerabased on comic bookmontageno opening creditsanti herodisarming someonedrawingtransformationshot in the foreheadon the runflash forwardlibrarycharacter repeating someone else's dialogueperson on fireelectrocutionfugitivecharacter's point of view camera shotrace against timeknocked outbaseball batamerican flaghigh school studentexploding bodygeneralsubtitled scenemonkeyexperimentmissiledestructionburned alivehead buttreference to adolf hitlertied to a bedend of the worldpresumed deadu.s. armyinventorhatredpower outagesuper villainmarvel comicsexploding headcommandosuperheroinetitle at the endcaptureraised middle fingermutationgovernment agenttelekinesisclose up of eyesenergyinvisibilityfinal showdownhigh school teacherjunkyardcar racefireballportalworld dominationinventiondronemegalomaniacyoung version of characterno title at beginningcomputer hackermilitary basereluctant herocabin in the woodsreference to albert einsteinsuperhero teamaction violencecapegurneytop secretexperiment gone wrongtwo way mirrorhigh techcommando raidalien planetshapeshiftingadopted daughterexploding airplanepentagonforce fieldglowing eyesscience runs amokteenage herospacesuitguard dogchild prodigygroup name in titletoy carwormholeblack holeorigin of herobritish actor playing american characteranimal testinghazmat suitblack opsrebootshipping containermarvel entertainmenttroubled productionelectromagnetic pulsearea 51craterair ventpanamastretchingprototypereference to instagramuh 60 blackhawk helicoptersinkholefoundationlovecraftianresearch facilityscience fairreboot of seriesteenage heroinereference to neil armstrongc 130 herculeschild geniusbody suitinvisibility cloakre bootbeam of lightabusive brotherstreet racethink tankreference to buzz aldrinscrap yardsuperhero originsupervillian originteleporter (See All)

Home Alone 2: Lost In New York (1992) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Home Alone 2: Lost In New York (1992)

Kevin McCallister is back. But this time he's in New York City with enough cash and credit cards to turn the Big Apple into his very own playground. But Kevin won't be alone for long. The notorious Wet Bandits, Harry and Marv, still smarting from their last encounter with Kevin, are bound for New Yo …rk too, plotting a huge holiday heist! Kevin's ready to welcome them with more battery of booby traps the bumbling bandits will never forget! (Read More)

Subgenre:
cult filmslapstick comedy
Themes:
christmasfriendshiprevengesurrealismfearescapememoryrobberyhome invasionhomelessnessmissing child
Mood:
rainnightbreaking the fourth wall
Locations:
elevatorhospitalnew york cityswimming poolhotelairplanetaxiairporturban settingpolice stationpolice carcityrooftoptaxi driver
Characters:
husband wife relationshipfamily relationshipspolicemother son relationshipbrother brother relationshipboybrother sister relationshippolice officerlittle boymaidboy hero
Period:
1990swinter
Story:
christmas giftchild heromale protagonistplaygroundvisionblockbusterlifting someone into the airfireworksgiftbirdfirephotographsequelnumber in titlegun …chaseshowertelephone calldigit in titlerescueslow motion scenearrestfalling from heightsecond partplace name in titlenumbered sequelmanhattan new york citytelevisioncriminaltelephonesubjective cameranew yorkconcertcolon in titlefishapologyparklimousinetreehotel roomperson on fireelectrocutionpay phoneproduct placementvacationchristmas treescreamskeletoncity name in titlepigtrappizzaholidayropehuggingflyingtape recordertoyfloridaladderorchestraremote controlburglarseven word titleburglarychild protagonistpower outagemiami floridachristmas evebooby trapatticbody landing on a carroomsequel to cult favoriteworld trade center manhattan new york citypigeonuncleabandoned buildingcartoon on tvcentral park manhattan new york citysecond in seriessenior citizenbrooklyn bridgevacuum cleanercoca colacredit cardreference to donald trumpunsubtitled foreign languagechewing gumtimes square manhattan new york cityjumping into waterroof10 year oldstaffdoveprecocious childrevolving doorice rinkphysical comedydeja vuchristmas movienail gunwish fulfillmentwoman punches a mannumber 2 in titlehotel managerhome alonehomeless womanlost childtoy storemother son reuniontwin towersroom serviceluxury hotelchristmas decorationlifting a male into the airbird attackchildren's choirjumping into a swimming poolmovie reality crossovercredit card fraudhead in a toiletcarnegie hall manhattan new york citymemory lapsekid outsmarts adultblurry visioncartoon reality crossovergreen slimehit with a brickmischievous childrockefeller center manhattan new york cityreference to donald duckmale antagonisttownhousebrick thrown through a windowhitting one's headplaza hotel manhattan new york cityvoice recorderwoman punches manchristmas with familycriminal duohotel guestwoman slaps man in the facehit on the head with a bricki cross my heart and hope to dieschool concertskeleton visible during electrocutionfalling brickforgetting namehotel bellmanscreaming boy (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Tron: Legacy (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tron: Legacy (2010)

Sam Flynn, the tech-savvy 27-year-old son of Kevin Flynn, looks into his father's disappearance and finds himself pulled into the same world of fierce programs and gladiatorial games where his father has been living for 20 years. Along with Kevin's loyal confidant Quorra, father and son embark on a  …life-and-death journey across a visually-stunning cyber universe that has become far more advanced and exceedingly dangerous. Meanwhile, the malevolent program CLU, who dominates the digital world, plans to invade the real world and will stop at nothing to prevent their escape. (Read More)

Subgenre:
martial artssuperherodystopiacomputer animationcyberpunkallegorydisney
Themes:
evilmagicmurdersurrealismbetrayalescapedeceptionangersupernatural powersurveillanceself sacrificeartificial intelligenceutopia
Locations:
elevatorbarswimming poolcarmotorcyclenightclubtaxipolice stationseatunnelmotorcycle chasetwo on a motorcycle
Characters:
father son relationshiptattooalienpolicemanwarriorsecurity guardfatherengineeryounger version of charactercolleague colleague relationship
Period:
1980s2000s
Story:
good versus evilactor reprises previous roleopening creditspsychotronic filmmale protagonistspiral staircasereturning character killed offteleportationblockbusterfireworksprisonerorphanbookphotographcharacter name in title …dogflashbacksequelbloodviolencetwo word titlebare chested maleexplosionchasepistolpunctuation in titlecryingmirrorrescuepunched in the facecomputercameraarrestbrawlfalling from heightbeerbombsecond partdecapitationflashlightbridgearmystabbed in the chestinternetdinnersevered headno opening creditsanti herofictional warnews reportnecklacebartenderparklibrarypilotcharacter repeating someone else's dialogueprologuemini skirtumbrellaactor playing multiple rolesproduct placementrace against timelightningprankspeechdisappearancepursuitcontestexploding bodypigtrapreuniondirectorial debutsevered armgrandmotherdismembermentgaragehenchmanexperimentgrenaderaceelectronic music scorecopheavy rainlooking at oneself in a mirrorhelmetsecurity camerabeardhidingexploding buildingeccentricvirtual realitylasercgigenocidetorchapplefemale warriorwatching televisionanthropomorphismguardbarefootthunderfight to the deathgrandfatherresistanceson3 dimensionalfalling to death3djumping through a windowcartoonparachutehologramalternate realitydisfigurementbody landing on a carpop songcanecorporationlens flarestadiumlasersightsecret identitysequel to cult favoritedictatorlightwilhelm screamclonecoinchildhood memoryposterrockettorso cut in halfleather jacketfemale fightersuit and tieportalrace carmegalomaniacarcadecheering crowdsplit personalitybearded mancomputer hackercrash landingsimulationman punching a womansunriseshort skirtaltered version of studio logofight the systemgame playingaircraftfather son reunioncircular staircasemotorcycle coparm cut offchild abandonmentelevator shafttechno musichackingregenerationstock marketcamera focus on female buttbedtime storysecret doorcut armzenel trainrubik's cubepagernew identityhidden doorexploding motorcyclehumanoidmotorcycle crashman punches a womansuper computercomputer programmerjedi knightboard meetingnightclub ownerbar ownershort haircyberspacecoors beerlong lost fathervirtual setbomb explosionbase jumpingfalling downmysterious disappearancefirst filmcomputer gamecomputer programair guitarfalling into a holedeathmatch3d sequel to 2d filmcartoon reality crossoverford motor companyhit by a motorcyclevirtual worldbody suitpug dogford crown victoriadiscreference to jules verneimax versionneo 80squarterblurred visioncomputer simulationfalling elevatorglass elevatorsecret entrancetelevision news reportbrain in a vatinspirational speechreal worldcomputer generated imagerygladiatorial combatimpound yarddeath matchfalling down a holeprotagonist and antagonist played by same actorvirtual character come to lifeamputated armducatisetting a trapautocracycomputer worldford fusioninside a computerplaying air guitar (See All)

Guardians Of The Galaxy Vol. 2 (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Guardians Of The Galaxy Vol. 2 (2017)

After saving Xandar from Ronan's wrath, the Guardians are now recognized as heroes. Now the team must help their leader Star Lord (Chris Pratt) uncover the truth behind his true heritage. Along the way, old foes turn to allies and betrayal is blooming. And the Guardians find that they are up against … a devastating new menace who is out to rule the galaxy. (Read More)

Subgenre:
martial artsblack comedysuperheroslapstick comedyswashbucklerspace operaurban fantasyscience fantasylive action and animationscience fiction comedy
Themes:
friendshipmurderdeathloverevengesurrealismsuicidekidnappingbetrayaljealousypregnancyescapedancefuneralmonster …herodeceptionangertheftpsychopathsupernatural powerredemptionsurveillanceself sacrificenear death experiencespace travel (See All)
Locations:
forestcarsnowsmall townwoodscastleouter spacespacecavestrip clubcampfirebrotheltunnelsinging in a carspace battle
Characters:
father son relationshipfriendtattooprostitutealienhostagesister sister relationshipthieftough guywarrioraction heroreference to godinterracial relationshippregnant womanalien monster
Period:
1980s2010syear 1980year 2014
Story:
good versus evilsequel baitingactor reprises previous roleshared universeshape shiftinglong haired malepsychotronic filmmale protagonistreturning character killed offfather figureensemble castmasked manmind controlgiantblockbuster …strong female charactertough girlorphaninterrogationshowdownbattlephotographkissflashbacksequelnumber in titleviolencebondagebare chested malegunfightdancingexplosionsingingpartyknifechasesurprise endingpistolshootoutdigit in titleshot to deathfistfightmachine gunshot in the chesturinationrescueslow motion scenepunched in the facewritten by directorswordgunfightbrawlfalling from heightbased on comicheld at gunpointbeertearshand to hand combatsunglassesbombsecond partnumbered sequelrobothandcuffscombatstripperflashlightassassinbased on comic bookgangambushold manmontageimpalementmixed martial artsdinertied to a chairjokedinneranti herofictional wardouble crossspaceshipcreaturetransformationracial sluron the runtrainingflash forwardconfessionattempted murderpilotcharacter repeating someone else's dialogueprologueelectrocutionfugitiveproduct placementrace against timestatueknocked outopening action sceneskeletonscene during end creditslong takemanipulationscarexploding bodydie hard scenariomercenarysevered armshot in the armsacrificebattlefieldfreeze framemoonstylized violencecoupleriotpiratecaptaindestructionflyingassassination attemptheroinelooking at oneself in a mirrorslow motiontalking animalcagelistening to musicscene during opening creditscatfighthelmetsecurity camerajail cellstealingbeardspacecraftspiderplanetjumping from heightclubskulllaserrocket launchercrying manaction heroinemexican standofffemale killergun fucrushed to deathandroideaten alivefemale warriorfull mooncyborganthropomorphismguardrampageinterracial romanceremote controlcameohaunted by the pastexplosiveconstruction sitefight to the deathdual wieldhatredanthropomorphic animalshot in the faceimmortalitytime lapse photographyexilescene after end creditsmarvel comicspunched in the chestsafeastronautbooby trapaerial shotwisecrack humorsuperheroinehologrambounty hunterdisfigurementsnowingdark pastducktragic herogadgetlaughingarrowlightwilhelm screamclonetelekinesismoral dilemmabraingatling gungeniusshot multiple timeslaser gunsurprise after end creditspalaceparking lotsouthern accenttelepathyimprisonmenttorso cut in halftracking deviceleather jacketfemale assassinpractical jokeshot through a windowmale objectificationsaving a lifeenergyface masklevitationfinal showdowntimebombscene before opening creditssuper strengthgiant monsterblonde womansarcasmportalworld dominationdronecomic reliefshot with an arrowmegalomaniacyoung version of characteratomic bombsuper powersadventure herocrashhired killermisfitjacketcrash landingelectric shockfallinggenetic engineeringwhistlingpatricideheld captivetaking off shirtsuperhero teamhypnotismeyeballasteroidaudio cassettefinal battlecapeteamworkfilmed killingmeteorpart computer animationcountdownmurder attemptrepeated lineawkward situationshape shiftermanipulative behaviortragic pastdance scenegalaxyimmortalexploding shipfather son reunionstarshipsubterraneanjailbreakman on firegodneck braceracial stereotypemind readingdeath by gunshotfather son conflictshot through a doorcaverndreadlocksforce fieldraccoonanti heroinewalkmanthronealien creaturespacesuitx rayed skeletonpointing a gun at someonescreaming womanalien racephotowoman woman relationshipestranged fatherregenerationscottish accentslow motion action scenetime bombgadgetrysexual innuendobubblehands tiedmissouripenis jokepassive aggressive behaviorsurprise during end creditsmascotwormholeblond manhuman alienmutinyinvulnerabilityfireworkpassive aggressive womanpsychological manipulationzero gravitybatteryvintagemanipulative womancharacter says i'm sorryhuman in outer spaceone eyed mansquidsocially awkwarddeath by shootingfuneral pyreipodsequel mentioned during end creditstrackertrampland minegiant creatureneon signorbemotional abusetalking to an animalescape podhybridseedhandcuffed womanpulp fictionmarvel entertainmentmockeryspeakertime lapsejet packmarvel cinematic universesibling relationshippac maneternityexplosive decompressionyear 2017freeze to deathbomb explosionfictional planetspace piratevintage carwatching someone sleepblobevil godchoke holdcomplaintfighting in the airfemale chauvinismfemale bullyfemale alienfemale chauvinistlocked in a cageexploding planetfoster fatherracist remarksleeping on the floorcassette playersideburnshalf humanpurple hairspaceship crashwarrior raceblastgiant squiddistortiongreen skindemi godethnic stereotypewarp speedalien spaceshipjealous womansocial awkwardnessblue skinfemale robotsleeping shirtlessstealbiting someoneterraformingbubblesviolent manfloating in spaceinterspecies romancecultural differencesgadgetsmisfitsfemale sexistbody suitcountry roadends with funeralfemale mercenarymale alienshirtless malesquadgenetic experimenthuman alien relationshipsevered toeblack suitcoretalking treecosmicfemale bounty huntergun for hirehuman alien hybridmale bondagefemale sexismchildish behaviormale antagonistsister sister conflictalien organismasteroid beltestranged sistermuscular mansexist remarksister sister fightstarship bridgeanthropomorphic duckarrogant womaneating an insectinterspecies friendshipman tied to a chairreference to mary poppinssitting on the floorskeletal remainswoman fights a womanbad teethbomb timer counting downdrunkenessmechanical handshooting into the airspaceship explosionstan lee cameotelekinetictroll dollalien supervillainectogenfather son fightgenetic modificationhypnotizelaunch codemixtapereference to david hasselhoffsex with objectsony walkmanartificial wombco worker co worker relationshipectogenesisfemale bondagegeodehigh priestessinsigniasister sister hugsmelling clothesthrowing a stonedairy queenfather son talkfather versus sonprotective suitreference to pac manbipedal aliendesintegrationempathfemale green skinned humanoid alienforced landinghalf human half aliennarcissistic womanpassive aggressive manreference to sexsex with an objectsleeping fully clothedspace fleetspacecraft cockpitteam workanti gravitybattle suitcelestialeaten by a monsterend tease for sequelfighter craftreference to heather locklearseedlingshackle (See All)

Willow (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Willow (1988)

A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village … council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)

Subgenre:
cult filmmartial artsfairy talesword and sorcerydark fantasysword and fantasychrist allegory
Themes:
evilmagicfriendshiprevengesurrealismkidnappingbetrayaladulteryescapemonsterheroredemptionsadismcourageforgiveness …book of magic (See All)
Mood:
rainpoetic justice
Locations:
forestsnowboatvillagefarmlakecastlecampfireroad movie
Characters:
witchhusband wife relationshipfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendlittle girllittle boyvillain …self discoverycrying babybaby girl (See All)
Story:
good versus evilblack magicprophecywizardlifting someone into the airprisonershowdownbookbattlecatcharacter name in titledogkissbloodone word title …fightdancingtitle spoken by characterknifechasecryinghorsepunched in the faceswordfalling from heightmaskhand to hand combatislandrivercombatsubjective camerasword fightmountaindisguisedeath of friendthroat slittingimpalementanti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightloss of friendhidingvillainessanimal attackgoatapplefemale warrioradventurerdwarfshieldfairyrowboatexiledungeontigerpassionate kisskingdomwilhelm screamsmokedaggercrowhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Sword In The Stone (1963) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Sword In The Stone (1963)

Arthur (aka Wart) is a young boy who aspires to be a knight's squire. On a hunting trip he falls in on Merlin, a powerful but amnesiac wizard who has plans for Wart beyond mere squiredom. He starts by trying to give Wart an education (whatever that is), believing that once one has an education, one  …can go anywhere. Needless to say, it doesn't quite work out that way. (Read More)

Subgenre:
sword and sorcery2d animationdisney
Themes:
magicsurrealismmonster
Locations:
englandforestsnowlondon englandwoodscastle
Characters:
witchboymerlin
Story:
owlprophecywizardblockbusterbirdsnakeorphancatdogbased on noveltitle spoken by characterhorseswordfishritual …underwater scenetransformationfive word titledueltreedragonrabbitchickenwolfbow and arrowtalking animalelephantmousefrogknighttournamentgoatdivingmedieval timesfalldeerturtlekingdomcrocodilecrownsquirrelblackboardfriends who live togethercrabrattlesnakecoldhawkthronetitle appears in songminiaturizationhuman becoming an animalrhinocerosmagic wandwashing dishesdisobeying ordersfire breathing dragonking arthuranvilplatewalrustalking birdexcaliburarthurian legenddisobediencethermometertalking fishround tablesquirestorybook in opening shot6th centurychicken poxgiantesssword in stonecharacter turns greenanimal licking someonewizards' dueldirty dishesrefusing to believe (See All)

The Golden Compass (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Golden Compass (2007)

It was no ordinary life for a young girl: living among scholars in the hallowed halls of Jordan College and tearing unsupervised through Oxford's motley streets on mad quests for adventure. But Lyra's greatest adventure would begin closer to home, the day she heard hushed talk of an extraordinary pa …rticle. Microscopic in size, the magical dust--discovered in the vast Arctic expanse of the North--was rumored to possess profound properties that could unite whole universes. But there were those who feared the particle and would stop at nothing to destroy it. Catapulted into the heart of a terrible struggle, Lyra was forced to seek aid from clans, 'gyptians, and formidable armored bears. And as she journeyed into unbelievable danger, she had not the faintest clue that she alone was destined to win, or to lose, this more-than-mortal battle... (Read More)

Subgenre:
epic
Themes:
friendshipsurrealismkidnappingdrinkingdrunkennessescapeabductioncourageenvironmentmissing child
Locations:
forestboatlondon englandseashiprooftoplaboratoryairship
Characters:
witchmother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrentattooboyfemale protagonistgirluncle niece relationship
Story:
owlprophecystrong female leadblockbusterfireplaceeavesdroppingstrong female characteranimalbirdsnakeorphanbattlecatfiredog …based on novelviolenceexplosionknifechasepistolvoice over narrationhorserescuedrinkswordlettershootingriflerunningcollegerobotdemoncolor in titlewinecandlestrangulationmountainbridgemapno opening creditschild in perilfictional warcontroversykingsearchnecklacetransformationcursebinocularspoisonmissionstorytellingrabbitringpursuitneck breakingfirst partcabinbearsubtitled scenemonkeysurgeryexperimenticewolfbow and arrowflyingspeartalking animalcagequestmouseskullstreet lifeclockfull moonwhiskeyadventurerchild's point of viewcrossbowfight to the deathintriguechild protagonistsoulalternate realityarmorglobal warmingclosethiding in a closetgateschemealarmarcticshot with an arrowarcheryclimbing through a windowfantasy worldmetamorphosisfemale herohot air balloondeskshape shifterparallel universepolar bearmagnifying glassglacierbarrelchosen oneimmolationlifting person in airhawkvoyagecompassthronesurgical operationnorth poledustsledlordleopardoverheard conversationegyptianmother son reunionhourglassicebergvillainess played by lead actressfalconcaught in a netdog sledtalking catwatchtowerzeppelinheresyoxford universityaviatorfly the insectfalling over a cliffdisobediencebrushing hairchasmpraying mantishiding under a tablesteamshipsea voyagechain mailraptoranimal skullgobletfjordchild thiefcollapsing bridgesighttalking bearpaddlewheel boatfate of the universefalling down a mountainice axesnow leopardbased on cult bookshoulder bagflying witchice bearspirit animal (See All)

Solomon Kane (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Solomon Kane (2009)

Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi  …kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)

Subgenre:
independent filmb moviesword and sorcerysword and fantasychrist allegorygothic horror
Themes:
magictorturemurderdeathrevengekidnappingreligionbetrayaldrunkennessfuneralmonsterdeceptionredemptionfaithabduction …cannibalismdevilmurder of familycooking over a campfire (See All)
Locations:
englandforestchurchsnowcemeteryvillagewoodsshipcastlecavecampfire
Characters:
witchhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierpriesthostagewarriorbibleself mutilation …ex soldiership captain (See All)
Period:
winter16th century1600s
Story:
good versus evilblack magiclong haired malesorceryteleportationmind controlwitchcraftinterrogationshowdownbattlefirecharacter name in titleflashbackbloodviolence …two word titlebare chested maleguntitle spoken by characterexplosionknifechasesurprise endingcorpseblood splatterhorsemirrorshot in the chestshot in the headrescueslow motion sceneswordfalling from heightmaskbased on comicdemonbritishprayerrivershot in the backdecapitationsword fightambushaxemassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestsevered headno opening creditsanti herochild in perildouble crosskingjourneytransformationshot in the foreheadcursestabbed in the backprologueperson on firestatuetentknocked outdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armundeadprincerevelationheavy rainhatslaverycaptivecrucifixtreasureaccidental deathjumping from heighttorchmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydark herodead childjumping through a windowdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legburned to deathwilhelm screamdaggercrowmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortresssorcerershot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accenthorse chaseknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Hunger Games (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hunger Games (2012)

In a dystopian future, the totalitarian nation of Panem is divided into 12 districts and the Capitol. Each year two young representatives from each district are selected by lottery to participate in The Hunger Games. Part entertainment, rutal retribution for a past rebellion, the televised games are … broadcast throughout Panem. The 24 participants are forced to eliminate their competitors while the citizens of Panem are required to watch. When 16-year-old Katniss' young sister, Prim, is selected as District 12's female representative, Katniss volunteers to take her place. She and her male counterpart, Peeta, are pitted against bigger, stronger representatives, some of whom have trained for this their whole lives. (Read More)

Subgenre:
cult filmmartial artspost apocalypsedystopiateen movie
Themes:
friendshipmurderdeathrevengedrugsescapemonsterlonelinessunrequited loveblindnesscheatinghunting
Mood:
nightmarerain
Locations:
kitchenforesttrainwoodscavetunnel
Characters:
teacherteenage boyteenage girlteenagermother daughter relationshipboyfemale protagonistsister sister relationshipreference to godalcoholicteacher student relationshipkiller dogdeath of a boydeath of a girl
Period:
future
Story:
based on young adult novelteenage protagoniststrong female leadrebellionblockbusterstrong female charactertough girlbattlecatdreamfirephotographdogkissflashback …f ratedbased on novelbloodviolencefightcigarette smokingtitle spoken by characterexplosionknifechasethree word titletelephone callcryingcell phonebeatingcorpsefistfightfoodmachine guncamerabrawlfalling from heightshootingpaintingvomitingheld at gunpointtearshand to hand combatdead bodyhallucinationrivercompetitiontelevisionsurvivalflashlightcandlesword fightstrangulationaxemassacrestabbingdeath of friendthroat slittingmixed martial artssuicide attemptweaponmapchilddisarming someonedrawingchild in perilcreaturefemme fatalenecklacegunshottrainingone against manybinocularsbeaten to deathperson on firepoisonumbrellapresidentpursuittragic eventneck breakingtrapfirst partthreatened with a knifeflowersleepingclass differencestrustriotropegamebow and arrowmedicinekilling an animalspearmass murdermachetepropagandasurvivorwristwatchcrushtournamentaction heroineanimal attackmexican standoffsocial commentaryapplegas maskguardpromiseswitchbladetarget practicecrossbowfight to the death3 dimensionalmutedespairmentorcigarette lighterdead childknife fighthologrammurder of a childcapturebulletproof vestknife throwingdead boyarrowwilhelm screamdead girlbandagelotteryfireballmakeovermegalomaniactween girlarcherytv reporterflaskdrunkardhunt16 year oldmercy killingarenadruggedfemale herocookietrain ridemushroombleedingvolunteerluckfight the systemclimbing a treeminerescortgladiatorfacial scarbechdel test passedfictional reality showheroic bloodshedvictoryone woman armydog attackforce fieldloudspeakerstarvingcompasssecret loveteenage heroleg woundshot with a bow and arrowtotalitarianismlandminebloody body of a childglamouraxe fightscreenplay adapted by authorpolitical repressioncontestantmost dangerous gamechild murdererfictional tv showgiant creaturewaspchild murders a childwashing hairsuicide pactgame of deathlive televisionpesticidespear throwingsponsoralliancebullhornchariotminefieldchild suicideginrafflepinlast man standingclosing eyes of dead personberrystylistdeath by poisonneo fascismhuman hunting a humanfuturistic trainlying in waitchild stranglingshiveringmining accidentroasted pigswarm of beeschild killed by animalfemale archerdeath starefemale gladiatorgame of survivallovebirdcalesthenicsmine explosiondead child with eyes openself survivalleg cuthunter and the huntedmonitoring deviceteen in peril (See All)

Rogue One: A Star Wars Story (2016) is one of the best movies like Harry Potter And The Order Of The Phoenix (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rogue One: A Star Wars Story (2016)

All looks lost for the Rebellion against the Empire as they learn of the existence of a new super weapon, the Death Star. Once a possible weakness in its construction is uncovered, the Rebel Alliance must set out on a desperate mission to steal the plans for the Death Star. The future of the entire  …galaxy now rests upon its success. (Read More)

Subgenre:
suspensetragedyepicspace operascience fantasy
Themes:
torturefriendshipmurderdeathrevengekidnappingbetrayalpoliticsprisonfearescapedeceptionangerdeath of fatherbrutality …supernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicblindnesscourageself sacrificeartificial intelligencespace travelprison escape (See All)
Locations:
elevatorbeachdesertfarmouter spacespacecavespace stationspace battlebattle station
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfemale protagonistsoldieralienhostagetough guywarrioraction herolittle girlasiandirectorsniper …sniper rifleengineerrobot human relationship (See All)
Story:
good versus evilshared universeopening creditslong haired malepsychotronic filmopen endedreturning character killed offstrong female leadrebellionblockbusterloss of loved onelifting someone into the airstrong female charactertough girlprisoner …interrogationbattlefireflashbacknumber in titleviolencetwo word titlefighttitle spoken by characterexplosionchasepistolshootoutcorpseshot to deathmachine gunshot in the chestshot in the headrescueswordarrestgunfightbrawlfalling from heightheld at gunpointbombrobotcriminalcombatscientistshot in the backsubjective cameraspysurvivalambushstrangulationmassacredisguisedeath of friendarmyimpalementstabbed to deathstabbed in the chesttied to a chairmapno opening creditsanti herochild in perilfictional wardouble crossspaceshipcreatureon the runflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionundercoverrace against timeevil manknocked outlightningfarmerstreet shootoutshot in the shoulderexploding bodyloss of fathermercenaryex convictloss of mothershot in the armgeneralsecret agentsubtitled scenebattlefieldpowermoonstylized violencecivil wartraitorcaptainsabotagegrenadedestructionassassination attemptheavy rainsociopathhelmetspin offjail cellcaptivetemplespacecraftsergeantexploding buildingloss of wifecaucasianplanetrebeljumping from heightlaseraction heroinemexican standoffsocial commentarybroken legpresumed deadfemale warriorgas maskcameohaunted by the pasttensionveteranbraverycrossbowresistancehatredfemale leadmercilessnesspower outageevacuationfalling to deathescape attemptsenatorhit on the headdeath of protagonistassault rifleaerial shothologramundercover agentcapturedark pastblind manbody countwar veteranbroken armwilhelm screamtelekinesismoral dilemmaprequellaser gunheroismshot through a windowswordsmanminingbag over headbureaucracyfemale fighterfake identitytoweralarmcomputer crackerworld dominationcomic reliefmegalomaniacplane crashyoung version of characterbunkergovernorstar warsfemale spybearded manmessagecrystalfilm starts with textcrash landingspace shuttlefighter pilotbehind enemy linesdamman kills a womanoffscreen killingspace warlightsaberdisembodied headguardianfight the systemfinal battlecapeempirefamous scoretragic pasttragic endingexploding shipfemale criminalstarshipdistrustfemale prisonerfiring squadjailbreakadmiraldogfightarchivecockney accentmind readingbo staffresistance fighterforce fieldlifting person in airanti heroinegogglesknocked out with a gun buttinnocent person killedalien creatureextreme close uptotalitarianismepic battlescottish accenthumancapmushroom cloudsagasuit of armorstabbed in the footdeath of parentescaped prisonerfemale pilotmessengertransportair strikedark heroinecollapsing buildingprosthetic limbdefectorcollisiondisobeying ordersmass destructioncouncilthe forceblueprintescape podsuicide missioninsubordinationoutpostweapon of mass destructionspace westernbazaarmining townfictional planetcargo shipsecret weaponlock pickgalactic warjedidroidnight vision binocularsagainst the oddsstrong female protagonistdeath sceneexploding planetexploding tankextremistrebel leaderrobot as pathosinformation leaksecret baseroninstormtrooperspaceship crashdestroyed citystorm trooperman with a ponytailsuper weaponwarp speedblasterdeath starwmdleather gloveshyperspacesecret messagealien languageprequel and sequelsecret planstarfightercommunicationsintelligence officersentient robotalien intelligencebad guys wingunshiptragic heroinefemale convictinbetwequelevil empireaerial battleblack maskdarth vaderextremist groupheroine diesmale captainswitchboardcontrol towerenergy shieldfather killedhuman maleschematichuman femalemale pilotspace pilottie fighterastromech droidhandheld communicatorsith lordspaceship name in titlefemale senatorplanet viewed from outer spaceshuttleultimate weaponx wing starfighterprotocol droidrebel basestar destroyerstardustat at walkerdeep voicedestroyed planetrebel starshipshuttlecraftspacecraft cockpitstarfighter pilotstolen planstransport starshipwarrior monkblaster pistoldefectdroid human relationshipforce chokegr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperrebel soldierred blade lightsaberrogue onestarfighter cockpit (See All)

Teenage Mutant Ninja Turtles (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Teenage Mutant Ninja Turtles (1990)

Through contact with a mysterious substance, called Ooze, 4 little turtles in the canalization of New York mutate to giant turtles. They can speak, walk upright and love pizza. The wise rat Splinter becomes their mentor and educates them to Ninja fighters. Their arch-enemy is the bad, bad guy Shredd …er, who struggles to gain power over the world. Of course the ninja turtles will do everything to stop him. (Read More)

Subgenre:
cult filmindependent filmmartial artssuperheroslapstick comedy
Themes:
friendshipmurderrevengesurrealismheroangerredemptionregret
Mood:
poetic justice
Locations:
waterapartmentfarmsewer
Characters:
teenagerfather son relationshippolicefriendbrother brother relationshiptough guywarrioraction herovillainemployer employee relationship
Period:
1990s
Story:
good versus evilmasked mangiantblockbusterenemylifting someone into the airrattough girlshowdownfireflashbackviolencefightbeatingfistfight …swordbrawlsecretfalling from heightmaskhand to hand combatfightingcombatkung fureporterjournalistsword fightbased on comic bookambushaxedisguiseboxingsubwaydisarming someoneduelargumentbased on tv seriescostumeattackninjaopening action scenescarfirst partvigilantepizzaanswering machineloyaltyspearelectronic music scoretalking animalcomastealingjumping from heightskateboardchop sockyanthropomorphismkatana swordanthropomorphic animalmentorskateboardingmeditationknife fightwisecrack humorturtlefemale reportermutationsword dueljuvenile delinquentsecret identitystick fightkung fu fightingface maskkatanacartoon on tvstreet gangkung fu classicspit in the faceold dark housesubway stationgolf clubpolice chiefdual roleadvicefish tankurban decayknocked unconsciousninjitsuvigilante justicepizza deliverygarbage truckboard gamefather son reunionantiquebo staffanimal that acts humanfemale journalistlifting female in airfalling through the floorantique shopcelebrity impersonationnunchuckshockey maskfurryhockey stickaudio flashbackteenage mutant ninja turtleshit with a golf clubninja armysaicomfortmirage comicsunderground hideoutelectrical wiretalking turtlewashclothcymbalstalking ratanthropomorphic turtlestaff weapon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Harry Potter And The Order Of The Phoenix?
<< FIND THEM HERE! >>