Best popular movies like Harry, Un Ami Qui Vous Veut Du Bien:

Do you need specific genre & keyword selection to find films similar to Harry, Un Ami Qui Vous Veut Du Bien?
<< FIND THEM HERE! >>

Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Harry, Un Ami Qui Vous Veut Du Bien (2000)

Michel, his wife Claire and their three little daughters Jeanne, Sarah and Iris are traveling to their cottage in Switzerland to spend summer vacation. When they stop the car, Michel goes to the toilet and a man stares at him. Soon the man introduces himself as Harold "Harry" Balestoro, who studied  β€¦with Michel in high school and knows him very well. When Michel and his family go to their car, Harry parks his Mercedes Benz and introduces his fiancee Plum to the couple and invites themselves to travel to Michel's house for a drink. Later her recalls by heart a poem written by Michel and shows that he was obsessed for Michel. Harry is surprised that Michel does not write anymore and tells that he is wealthy since he has inherited his father's investments. Michel and Claire are middle-class and are still repairing their cottage by themselves. Harry and Plum stay for the night in the guest room and in the morning, Harry gives a 4x4 V6 Pajero to his new friends. They do not accept but Michel needs to bring his parents to see their granddaughters and drives the truck. He brings his mother and his father that immediately recognizes Harry. He feels tension between Michel and Claire and his parents and Harry and Plum move to a nearby hotel. During the night, Harry decides to help his friend, showing that he is a psychopath that turns Michel's life upside down. (Read More)

Subgenre:
suspenseblack comedyindependent film
Themes:
inheritancewritingwealthpoetrydeath of motherdeath of fatherobsessionpsychopathfuneraldeathfriendshipmurder
Mood:
darknessnightmarehigh school
Locations:
new carrural settingbathtubhelicopterhotel
Characters:
grandfather granddaughter relationshipgrandmother granddaughter relationshipwriterbabyserial killergirlfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationships
Story:
family vacationmen's bathroomfuneral homelong lost friendhigh school frienddeath of mother in lawdeath of father in lawchanging a baby's diaperflying monkeycar over a cliffpsychosomatic illnesslong lostautocidebuying a carmatterhorn β€¦virilityantibioticmountain cabinorganismdead body in a car trunkanagramcountry homeheat wavedeath of grandfatherexhaustiondeath of grandmothermultiple murdercrematoriummercedeschance meetingdiarrheaholehitchcockiantow truckfeverwellcremationreckless drivingclassmateswingsurprisemobile phonedentistpsychologisteccentricmagazineeggpoemmurderergiftchildbirthpursuitreadingvacationchampagnescreamingargumentbathcoffinbathroomdead bodycar crashcar accidentcorpsecell phonechasefemale frontal nudityfemale nuditycharacter name in titlebloodnudity (See All)

High Tension (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
suspenseindependent filmb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
death of motherdeath of fatherpsychopathdeathmurderfriendshipsurrealismkidnappingrapefeartorturebrutalityinsanitysadismevil β€¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessnightmaregorecar chasenightslasherblood and gore
Locations:
rural settingbathtubhospitalforestwoodsroad tripfrancetruckgas stationsinging in a carbackwoodsback country
Characters:
serial killerfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspoliceboybrother sister relationshipteenage girlfemale protagoniststudentbest friend β€¦killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All)
Story:
classmateswingmobile phonemurdererpursuitbathroomdead bodycar crashcar accidentcorpsechasefemale frontal nudityfemale nuditybloodf rated β€¦violencebare breastsflashbackmasturbationdogguncigarette smokingphotographknifelesbian kisssurprise endingshowertelephone calldreamblood splattermirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedlow budget filmneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherstalkingdeath of sondeath of husbandsleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameragash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterbody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Glass House (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Glass House (2001)

When Ruby Baker's parents are killed in a car accident, she and her brother, Rhett, must travel to Malibu, to live with Terrence and Erin Glass, their former neighbors. At first, all seems well. Ruby is making new friends at school and Rhett is getting more video games and flashy toys than he's ever β€¦ had in his life. When Ruby speaks to her family's estate lawyer, he tells her that her parents have left Rhett and her $4 million. Suddenly, Ruby begins to notice odd behavior from Terry and Erin. (Read More)

Subgenre:
suspensepsycho thriller
Themes:
inheritancewealthdeath of motherdeath of fatherfuneralfriendshipdeathmurdersuicidedrugsdrinkingdrunkennessdrug useadoptioncheating β€¦murder of a police officerclaustrophobia (See All)
Mood:
nightmarehigh schoolrain
Locations:
restaurantschoolchurchswimming poolcarcemeterypolice cartruckschool teachercar explosiontruck accident
Characters:
girlfriendmother daughter relationshipfather daughter relationshipfather son relationshipmother son relationshipfamily relationshipspolicedoctorboybrother sister relationshipteenage girlteenage boyfemale protagonistpolice officer β€¦policemanpriestlawyermaiduncle nephew relationshipuncle niece relationship (See All)
Story:
car over a cliffreckless drivingscreamingargumentdead bodycar crashcar accidentcorpsebloodguncigarette smokingexplosionknifecryingdream β€¦watching tvcomputerdrinkbikinitearscafeclassroomswimmingcleavageorphanflashlightbracaliforniamansionstabbingstabbed to deathinternetchild abusedrivingdrawinghit by a cargraveyardgravedrug addictdebtlightninginjectionhigh school studentfilm within a filmloss of fathersuspicionloss of motherclassreference to william shakespearetrusthypodermic needlemachetefaintingcaptiveloss of loved onewatching a moviearchitecthome moviescamdrug overdosemovie theatreswitchbladetensionbroken glassjunkietheatre audiencee mailsocial workerdeath of loved onenintendo 64flat tiremenstruationtombstonedrunk drivingpopcornloanglassloan sharkguardianreference to shakespeare's hamletbmwcruisingmorphineloss of parentsvideo cassetteplagiarismcar wreckapple computercaregiverdriving lessondiabeticillegal drugseulogydead parentsperilinsulinshooting uplife insurancetrust fundseat beltgourmetsocial servicesunlikely criminalreference to meryl streepcheating on a testelectric drillbrake failurecar hit by a trucksaablegal guardianglass housestepfamilyferrari testarossadeviousnessmulholland driveradio producerdriver's educationsan bernardino californiaaol (See All)

Enter The Void (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Enter The Void (2009)

Tokyo's nasty underside, seen primarily through the eyes of Oscar, a heavy drug user, whose sister Linda is a stripper. Oscar also has flashbacks to his childhood when trauma upends the siblings. Oscar's drug-fed hallucinations alter Tokyo's already-disconcerting nights, and after the police shoot h β€¦im, he can float above and look down: on his sister's sorrow, on the rooms of a love hotel, and on life at even a molecular level. The spectrum's colors can be beautiful; it's people's colorless lives that can be ugly. And what of afterlife, is there more than a void? (Read More)

Subgenre:
cult filmexperimental film
Themes:
death of motherdeath of fatherdeathfriendshiplovesurrealismdrugsmoneybetrayalghostjealousyadulterypregnancyfearincest β€¦paranoiadrug usedyingabortionpolice investigationafterlifefear of death (See All)
Mood:
nightmarenight
Locations:
bathtubhotelhospitalbarbeachairplanetaxiairportelevatorapartmentjapanpolice carmotelstrip clubtunnel β€¦love hotel (See All)
Characters:
grandfather granddaughter relationshipgrandmother granddaughter relationshipbabyfriendfather daughter relationshipmother daughter relationshipmother son relationshipfather son relationshipfamily relationshipshomosexualpolicedoctorsingerboy β€¦brother sister relationshipprostitutepolicemandancerbest friendlittle girljapanesejewcatholicolder man younger woman relationshipamerican abroadolder woman younger man relationshipgrandfather grandson relationshipgrandmother grandson relationshipcrying babygo go dancer (See All)
Period:
future
Story:
cremationswingchildbirthpursuitscreamingbathbathroomdead bodycar crashcar accidentcorpsechasefemale frontal nudityfemale nudityblood β€¦sexmale nudityviolenceflashbackbare chested malegunkissfemale rear nuditycigarette smokingfingeringdancingnipplesphotographsingingknifeleg spreadingthree word titlepantiestelephone callfirecryingsongbeatingdreamunderwearpenetrationfoodmirrorshot in the chestface slappunched in the facethongbare buttshootingpaintingbooktearsrunningmarijuanasex standing uphallucinationstripperf wordsubjective cameraswimmingorphanflashlightdrug dealereatingcocainetoiletfemale pubic hairnonlinear timelineapologypainterritualroommatepoint of viewflash forwardspermdrug addicthotel roomfired from the jobpay phonecharacter's point of view camera shotmoaninglong takedeath of brotherflowersleepinghatepot smokingspiritflyingmorguebrother sister incestteddy bearpeeping tomstreet lifeback from the deadpromisebuddhistbra and pantiestokyo japanreincarnationpillspastbackstagejunkiestairscigarette lightercellphonebalconydressing roombuddhismlooking at self in mirrorlightexplicit sexg stringset upimperative in titlebreast feedingrepeated sceneexotic dancerpregnancy testroller coasterforeignerdrug dealspreadeagleflareknocking on a doorlsdpsychedelicdance clubsitting on a toiletoverhead camera shotpole dancershared bathurnflashback within a flashbackfetuspole dancingloss of parentswrapped in a toweldrug tripexpatriatetalking to oneselfstrobe lightvoice over inner thoughtsfoster carehashishlife after deathdrug bustoperating roomheartbeatfirst personlullabyaudio flashbackout of body experienceabortion clinicneon lightecstasy the drugimpregnationmodel traincremated remainsdoor lockcarrying a dead bodytrippybowingspoken inner thoughtsblack lightnude dancingshot by the policeflashing lightabortionistacid the druginternmentinner monologuemissing someoneidentifying a dead bodysniffing pantiesdistorted soundchest woundcutting one's fingersex with friend's motherpolice stingtaking off someone's pantiesdoor buzzerfertilizationflushing drugs down a toiletsense of timedead fetusdog toyvaginal examchildhood promisedmtslap on the buttwetting one's pantsfinger in someone's anusflashback within a flashback within a flashbackkissing someone's breastspulling up pantsreference to amsterdam netherlandsspinning camera shotaborted fetusgruntingpulling up panties (See All)

Tell No One (2006) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tell No One (2006)

The pediatrician Alexandre Beck misses his beloved wife Margot Beck, who was brutally murdered eight years ago when he was the prime suspect. When two bodies are found near where the corpse of Margot was dumped, the police reopen the case and Alex becomes suspect again. The mystery increases when Al β€¦ex receives an e-mail showing Margot older and alive. (Read More)

Themes:
death of fatherobsessiondeathfriendshipmurderlovesuicidekidnappinginfidelityrapepoliticsadulterydrinkingtortureescape β€¦weddinginvestigationvoyeurismmemoryextramarital affaircorruptionblackmaildrug useguiltgriefunfaithfulnesssurveillancedeath of wifeforgivenesspolice brutalitymurder investigationpolice corruptionmysterious deathmurder of father (See All)
Mood:
night
Locations:
hospitalbarrestaurantforestparis francebusairportelevatorwoodspolice stationpolice carfrancelakerooftop
Characters:
babyserial killergirlfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspolicedoctorboybrother sister relationshippolice officer β€¦nursedetectivepolicemanphotographerlawyerwaitresskillerfrenchamericanpolice chasechildhood friendcoronerfather in law son in law relationshipmother in law son in law relationshipboy girl kiss (See All)
Story:
dead body in a car trunkmultiple murderhitchcockiancremationmurdererpursuitcoffindead bodycar accidentcorpsecell phonechasefemale frontal nudityfemale nuditynudity β€¦bloodbased on novelmale nudityviolenceflashbackmale frontal nuditymale rear nuditydogbare chested malegunfemale rear nudityfightfemale full frontal nuditycigarette smokingphotographmale full frontal nuditylesbian kissshowertelephone callcryingbeatingshot to deathunderwearfoodhorsemirrorface slapshotgunslow motion scenepunched in the facewatching tvcomputercameradrinkarrestundressingbare buttsecretshootinglierifletearsrunningcafejailvoyeurmale pubic hairrevolvertelephoneshot in the backsubjective cameraswimmingcleavagegay slurnewspapervideo cameramansioneatingfemale pubic hairinternetnonlinear timelinefalse accusationapologyman with glassesscantily clad femaleassassinationforeign language adaptationsearchvanlatex glovesflash forwardconfessionparkskinny dippingsmokingbinocularsprologuekeymissing personcover upbaseball batfemale full rear nuditylong takegymdisappearancecountrysidedeath of sonthreathorse ridingsadnessratsuspiciontied upflowerhandguntypewritergraffitiheroinapplausetv newsbow and arrowrevelationinjuryred dresswalkie talkieloss of loved onedrug abusehidingloss of wifedesperationdriving a carfaked deathstreet lifeclockhomicidepresumed deadpassportretirementcamera shot of feetdivingphoto shoothaunted by the pasttensioninnocencesurveillance cameraplaygroundmourningburglarylesbian coupleautopsye maildeerhighwaycellphonesuspectpolice raidduckbruisenude woman murderedbenchsports cartan linechildhood memoryframed for murderdead dognude swimminganniversaryhandshakedark secretstreet gangrepeated sceneabuse of powerstairwaystreet marketbitternessgun held to headframedtraffic jamfemale lawyermale rapehired killernude girlcigarettefallingscene of the crimeplaying a video gamednastableemergency roominsurancebody bagnaked dead womandocumentmurder of wifecircular staircasedead catanguishwoman undressingchild rapecriminal investigationtreadmillclimbing out a windowfinding a dead bodysurveillance footageintercomtelephone numbertrophy wifecrotch shotapple computerfemale in a showerstun gunhand kissingpocket knifealibistreet kidwife abusesafe deposit boxman undressingpokiesperjurydoor bellwood carvingequestrianransackinghitting a womanphoto studiosidewalk cafeaudio recordingbroken windshieldblood sample911 callwalking a dogwall safeinternet cafewiretapi.d.pediatricianbox cutterchildhood lovearm injuryprime suspectinsurance policyhemophiliahorse jumpingplanted evidencewatching a video on a computergarbage dumpsterbreaking a glassbluffingslipping and fallingwife beatingbandstandhorse stableidentifying a dead bodybody in a car trunkhunting accidentparisian outskirtsballisticsstreet riotoff screen suicidecar pileupcomputer storehiding in a dumpsterstate senatorcomputer searchhunting trophymounted deer headautopsy reportflower deliverymidnight swimdna sampledragged by hairheroin userinternal bleedingparc monceau paris (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Disturbia (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Disturbia (2007)

After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu β€¦rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)

Subgenre:
suspenseblack comedy
Themes:
death of fatherpsychopathfriendshipdeathmurderrevengekidnappingbetrayaljealousydrinkingescapeinvestigationvoyeurismparanoiaphotography β€¦panicmurder of a police officer (See All)
Mood:
high schoolneo noirslasher
Locations:
swimming poolcarbicyclepolice carcourtroomrooftopstormfishing boat
Characters:
writerserial killerfriendfather daughter relationshipmother daughter relationshipmother son relationshipfather son relationshippoliceteenagerboyteenage boyteacherstudentpolicemandancer β€¦police detectivevillainterrorcousin cousin relationship (See All)
Story:
hitchcockianreckless drivingreadingbathroomdead bodycar accidentcorpsecell phonechasebloodviolenceone word titledoggunkiss β€¦fightdancingtitle spoken by characterpartyknifetelephone callblood splatterfoodpunched in the facewatching tvcomputerdrinkarrestbikinibookplace name in titlerunningneighborhandcuffsvoyeurclassroomswimmingnewspapervideo camerawomaneatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialfishingduelflash forwardbinocularssuburbmissing personevil manrabbitbaseball batlightningskeletonpranklong takescarwighigh school studentstalkingwitnessbasementneck breakinggardenclassobscene finger gesturesubtitled scenegaragemaniacflirtingtv newsteen angstbreaking and enteringlistening to musicsociopathcaptiveassaultpsychoskullparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreechocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustangbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All)

Kiss Kiss Bang Bang (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Kiss Kiss Bang Bang (2005)

A petty thief posing as an actor is brought to Los Angeles for an unlikely audition and finds himself in the middle of a murder investigation along with his high school dream girl and a detective who's been training him for his upcoming role...

Subgenre:
black comedycult film
Themes:
funeralmurderdeathfriendshipsuicidekidnappingchristmasmoneydrinkingtorturedrunkennessfilmmakingincestrobberytheft β€¦surveillancehomophobiachildhood (See All)
Mood:
high schoolsatireneo noircar chase
Locations:
hotelhospitalnew york citybarbeachswimming poolairplanelos angeles californiabusnightclubairportpolice carlakerooftopmotel
Characters:
girlfriendfather daughter relationshipmother daughter relationshipfather son relationshiphomosexualpoliceboyfriend girlfriend relationshipteenage girlteenage boyteacherdetectivepolicemanactorsister sister relationship β€¦thiefactressnative americanlustemployer employee relationshipuncle nephew relationshippolice shootoutsuicide by gunshotold frienddream girlairplane stewardesshomosexual kissgay detective (See All)
Period:
christmas party
Story:
high school frienddead body in a car trunkcremationreckless drivingreadingcoffinbathroomdead bodycar accidentcorpsecell phonefemale frontal nudityfemale nuditybloodbased on novel β€¦violenceflashbackdoggunkissfightcigarette smokingpartyleg spreadingsurprise endingerectionpantiespistolvoice over narrationfondlingshootoutbeatingshot to deathunderwearblood splattershot in the chesturinationblondeshot in the headshotgunpunched in the facewatching tvdrinkundressingfalling from heightshootingbooklierunningrobotrevolvermanhattan new york cityshot in the backswimmingcleavagegay slurambushvideo camerabridgefemale pubic hairfishnonlinear timelinechild abuseanti heroscantily clad femaledrawingunderwater scenevantalking to the cameraattempted murderprologueelectrocutionauditionchristmas treebaseball batshot in the shoulderfemale removes her clothescheerleaderwitnessdirectorial debutshot in the armbearsleepingcross dressingtrustgirl in pantiesrunawayprivate detectivechainsawicetv newsdestinyno pantiesnipples visible through clothingbreaking and enteringwoundrepetition in titlecookelephantmagicianpatientstealingsanta clausspidercarnivalfatechokingmental institutionretirementburglarsevered fingerbuddyburglarykicked in the crotchmental hospitalnovelistframe upaccidental killingdeath of sisterfilm producercanered pantiesabusive fatherdead girlvideo surveillancemental patientface masknotebookrobberset uppedophilianovelpistol whipfemale removes her dressfilm crewchild molestationtv commercialyoung version of characterlawsuitcliniccredit cardbeach housecookiemissingswimming underwaterepiloguehearserussian roulettecluetimes square manhattan new york cityrainbowhiding under a bedchapter headingsbaltimore marylandborn again christianportdiceprivate eyecasketfinding a dead bodyfleeingindianaluggagepassing outfingercricketsearch for fatherfoster careanimated opening creditsfalling asleepplastic bagbiological fatherrobbery gone awryreference to marlon brandogay straight relationsdenver coloradochristmas decorationmorse codeneonscreen testhotel desk clerkvenice beach californiafalling off a balconyi.d.reference to imdbairplane ticketreference to kurt cobainderringerelectrical torturemagic actartificial respirationmethod actingelvis presley impersonatortheatre marqueetv announcerstage nameparking attendantdetective sergeantreference to gene kellybirth control pillgay straight alliancedoodlingsawed in half magic actwood pilebreaking someone's noselunch wagonprobabilitythe one that got awayaging parentdemerolreference to joe pesciwiping off fingerprintspie eating competitionreference to olivia newton johnpain pillreference to drew barrymoreslamming a door on someone's fingersthrowing a drink glassurinating on a dead body (See All)

Don't Look Now (1973)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Don't Look Now (1973)

John and Laura Baxter are in Venice when they meet a pair of elderly sisters, one of whom claims to be psychic. She insists that she sees the spirit of the Baxters' daughter, who recently drowned. Laura is intrigued, but John resists the idea. He, however, seems to have his own psychic flashes, seei β€¦ng their daughter walk the streets in her red cloak, as well as Laura and the sisters on a funeral gondola. (Read More)

Subgenre:
suspenseindependent filmcult filmsupernaturalbritish horrorcult classic
Themes:
writingfuneraldeathmurdersurrealismmarriagedrinkingdrunkennesssupernatural powerguiltgriefmental illnessblindnessdeath of daughterafterlife β€¦death in childbirth (See All)
Mood:
gorerain
Locations:
rural settinghotelhospitalrestaurantchurchboatbicyclewaterairportpolice stationcityitaly
Characters:
serial killergirlmother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspolicechildrenboypolice officerpolicemanpriestsister sister relationship β€¦villainmaid (See All)
Period:
1970s
Story:
chance meetingpursuitreadingbathdead bodycorpsechasefemale frontal nudityfemale nuditybloodmale nuditybare breastsflashbackmale frontal nuditysex scene β€¦kisscigarette smokingnipplesphotographknifethree word titlesurprise endingshowertelephone calltopless female nuditypunctuation in titleunderwearfoodhorsemirrorslow motion scenecatarrestbare buttlettervomitingapostrophe in titlecafehallucinationprayermale pubic hairsubjective cameracandleold manambulancewomanbridgeeatingwidowfemale pubic hairnunpantyhoseold womandrowningflash forwardbased on short storycharacter's point of view camera shotsuitcasedollstatuedeath of childcity name in titlesadnessratpsychicitalianoccultfaintingarchitectureloss of loved onebuttocksaccidental deathlossladderfatewhiskeydwarfhaunted by the pastnipplelostdeath of protagonistdead childpolice inspectorbrushing teethriding a bicyclemale objectificationapparitionimperative in titleseanceloss of daughterbroken mirrormarried couplestretchervenice italypremonitionloss of childblind womanmediummotorboatbishopcowgirl sex positionseizurepondbleeding to deathpsychic powerorchestral music scorebriton abroadbloody violencedeath by drowningpsychotronic filmdressinggrindhouse filmmurder victimtrancecanalmosaicmental instabilitybritish accentgrievingunhappy endingraincoatgondolastained glass windowfemale star appears nudegiallo esquenude pantyhosescaffoldsibling relationshipmale in a showerdeliberate crueltygrieving mothermusic score features pianoprecognitiondead daughterthe color redtalking with the dead5 year oldartificial respirationspilled drinkstray catgrieving fatherchild drowningringing a bellsleazy giallodyetalking dollwomen's restroomreference to john miltonslashed to deathaccidental drowningmale star appears nudebegins with deathmultiple sex positionsprimal screamsaint nicholasboeing 727woman faintingexsanguinationgrieving parentdrowned bodysecond sightwoman getting dressedapplying mascaraitalian flagrefusing to believechurch restoration (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Lovely Bones (2009) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Lovely Bones (2009)

A 14-year-old girl in suburban 1970's Pennsylvania is murdered by her neighbor. She tells the story from the place between Heaven and Earth, showing the lives of the people around her and how they have changed all while attempting to get someone to find her lost body.

Subgenre:
suspense
Themes:
poetryobsessionfuneraldeathmurdersurrealismrapedrinkinginvestigationvoyeurismmemoryredemptionhome invasionhopemurder investigation β€¦death of daughterafterlifemissing child (See All)
Mood:
rain
Locations:
bathtubhospitalschoolsnowcemeterybicycletaxifarmpolice carlaketaxi driverschool buskitchen firerunning in water
Characters:
grandmother granddaughter relationshipserial killergirlfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipspolicedoctorbrother sister relationshipteenage girlteenage boydetective β€¦policemandancerphotographersister sister relationshiplittle girllittle boy (See All)
Period:
1970syear 1973
Story:
reckless drivingpoempursuitreadingdead bodycorpsechasebloodf ratedbased on novelflashbackdogkisscigarette smokingdancing β€¦photographtitle spoken by characterknifethree word titletelephone callfirevoice over narrationcryingbeatingdreamblood splatterfoodwatching tvcameradrinkfalling from heightpaintingbooktearsrunningbirthdayneighborvoyeursubjective camerasoccerflashlightcandleaxemontageeatingno opening creditspainterunderwater scenesearchflash forwardtreestalkersuburbfantasy sequencesuitcaseevil manbaseball batlightningflowerssuspicionhatestrong female characterrecord playereyeglassesbreaking and enteringhatjogginghammerhidingassaultaccidental deathteddy bearladderfollowing someonecrying manrapistbreakfastback from the deadshoesshopping mallfirst kissheavendead childpedophileevidencedeath of sisteralternate realitynotefieldcellarnewspaper clippingphoto albummudhit with a baseball batdead girlbeing followedlighthousepervertserial murdersaving a lifebad guypedophiliateenage lovechild molestationshipwrecklost lovevacuum cleanerbroken windowdigging14 year oldfalling into watercornfieldteenage crushwashing machinechild molestertrapdoorpurgatoryreturning homemolestationchild rapediverclimbing out a windowmurder victimcreepscrapbookserial rapistmultiple murderssexual predatorcuriositysnowglobechild killerwatching someonebreaking down a doorbeing watcheddollhousetoy storechild murdererdead teenagergrandfather clocknarration from the gravebased on young adult novelgazebosinkschool lockerserial child killerfigurinestuffed animal toywall safelock of hairiciclereference to coca colaclubhousesinkholewheat fieldleg in a caststocking capstraight edge razorpainting toenailsrape of a minorelectric trainserial teen killerreference to laurence oliviermodel shipfloating in spacebreaking a glass windowsoda popdelawareroll of filmmodel builderunderground hideoutfruit pickership in a bottlefilm developingcharm braceletbeauty treatmentbicycle bellbreaking glass bottlegirl driving a carhiding under floorboardsinstamatic camerastocking feetbottle openerhammer and nailsdeath of teenage girlvoice over note (See All)

Mr. Brooks (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mr. Brooks (2007)

Earl Brooks is a highly respected businessman and was recently named Portland's Man of the Year. He hides a terrible secret however: he is a serial killer known as the Thumbprint Killer. He has been attending AA meetings and has kept his addiction to killing under control for two years now but his a β€¦lter ego, Marshall, has re-appeared and is pushing him to kill again. When he does kill a couple while they are making love, he is seen and photographed by someone who also has his own death and murder fetish. In a parallel story, the police detective investigating the murder is having problems of her own. She is going through a messy divorce and a violent criminal who had vowed revenge some years before has escaped from prison and is after her. (Read More)

Subgenre:
suspensecult film
Themes:
psychopathdeathmurderfriendshiplovesuicidekidnappingmarriagepregnancyfearinvestigationdeceptionseductionangerdivorce β€¦blackmailsadismabductioncrueltydyingtraumamurder of husband (See All)
Mood:
nightmaregorerainmurder suicide
Locations:
hotelhospitalrestaurantchurchcemeteryairplanetaxikitchenofficerooftopstorm
Characters:
serial killerfriendfather daughter relationshipmother daughter relationshiphusband wife relationshippolicedoctorstudentdetectivepolicemandancerlawyerpolice detectivesecretaryex husband ex wife relationship
Story:
men's bathroommultiple murderreckless drivingsurprisemurdererchampagnedead bodycar accidentcorpsecell phonefemale nuditycharacter name in titlebloodmale nudityviolence β€¦flashbackmasturbationgunsex scenekissfemale rear nuditydancingnipplesphotographtitle spoken by charactersurprise endingpistoltelephone callpunctuation in titlecryingshootoutwoman on topdreamunderwearblood splattermirrorshot in the chesturinationshot in the headcomputersex in bedsecretshootingtearsbedcafehallucinationvoyeurprayertelephonenewspaperbedroomflashlightbradisguisestabbingthroat slittingbridgedinerdouble crossvanshot in the legshot in the foreheadlatex glovesgravestrippingprologuebusinessmanfactoryumbrellaevil mancollege studentshot in the shoulderwigdeath of husbandwitnesssilencermaniacpickup truckeyeglassesfireplacedesireaddictionbreaking and enteringheavy rainice creamcaught having sexbeardcovered in bloodparking garageblack humorfollowing someonedead womans&mpeeping tomschizophreniahomicidecrime scenestabbed in the throatmercilessnessstabbed in the neckmillionaireconvenience storeshovelscissorshit on the headdead manalternate realitybody landing on a cardead woman with eyes opendivorceenude woman murderedexhibitionismfemale detectivelyinginterrupted sexbeing followedserial murderpsychopathic killeryellingclosetrepeated scenehead woundescalatordouble lifehomicidal maniacvacuum cleanermasochismblood stainimaginary friendframedsplit personalityescaped convicthearing voicesjacketwetting pantsflight attendantdnaconscienceemergency roombleeding to deathmurder witnesshit with a shovelclothingalter egoman wearing glassesbmwcruisingwet clothesschizophrenicalcoholics anonymousmurder of a nude womanfingerprintbanquetportland oregonapprenticehatchetintercomthrown from a carovenstabbed with scissorsjoggerdance classwife swappingdriver's licensetalking to oneselfcrossword puzzlekilled during sexstrobe lightmultiple homiciderainy nightwoman shot in the foreheadsafe deposit boxdead woman on bedroad ragedance studiosidewalk cafespying on couple having sexneon lightpotterylawyer client relationshipdoor lockstaringimaginary personsecret compartmentalimonynude man murderedurinating in fearcollege dropoutphilanthropistincriminating photographattempted kidnappingexercyclefetishistmurder of a nude manincriminating evidenceamateur photographerlack of evidenceaa meetingdoor keyprocess serversadomasochistflip phonepalo alto californiareference to stanford universitygood becoming evilmechanical engineervolvo 240barcelona chairburner phoneurge to kill (See All)

Solace (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Solace (2015)

A psychic doctor, John Clancy (Sir Anthony Hopkins), works with an F.B.I. Special Agent (Jeffrey Dean Morgan) in search of serial killer Charles Ambrose (Colin Farrell). After having lived in isolation for two years, since the death of his daughter, Clancy is asked by his friend Joe, an F.B.I. Speci β€¦al Agent to help him solve several murders committed by a serial killer. The problem is that Ambrose is also psychic, and far ahead of Clancy. (Read More)

Subgenre:
suspenseindependent filmsupernatural
Themes:
death of fatherfuneraldeathfriendshipmurderfearinvestigationdeceptionbrutalitysupernatural powerparanoiacancerhome invasiondeath of daughtermurder of daughter
Mood:
goreneo noircar chase
Locations:
bathtubhotelhospitalbartrainchurchcartaxielevatorapartment
Characters:
serial killerfriendfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationshiphomosexualpolicedoctorpolice officerchristianmysterious killerpolice dog
Period:
seeing the future
Story:
psychologistcar crashcar accidentcorpsecell phonechasefemale frontal nudityfemale nuditybloodviolenceone word titlebare breastsflashbackdoggun β€¦female rear nudityknifesurprise endingpistoltopless female nudityshootoutshot to deathblood splattermachine gunshot in the chestshot in the headshotgunrescueslow motion scenegunfightbare buttlettershowdownheld at gunpointhandcuffsrevolvershot in the backf wordfoot chaseambushdeath of friendsubwayno opening creditsanti heropolice officer killedshot in the legshot in the foreheadlatex glovescharacter repeating someone else's dialoguefbipoisonrace against timedeath of childtough girlshot in the shoulderscardeath of husbandpsychicnewspaper headlinechild murderterminal illnesswolfbulletheavy rainsociopathwalkie talkiefbi agentswat teamdriving a carmexican standoffcrime scenehaunted by the paststealing a carvisionpolice officer shotdark heroassault rifleautopsybulletproof vestnotepolice raiddark pasttragic herolasersightnude woman murderedmoral dilemmabullet timedrugged drinkclose up of eyesblood on camera lensshot in the neckpolice officer shot in the chesteuthanasiawhodunitfilm starts with texthivpremonitionmercy killingleukemiapsychic powertwo way mirroroverturning cartragic pastprophetmind readingclairvoyantpolice officer shot in the headbrain tumorred herringcoming out of retirementhot dog standfax machinetelling a joketroubled productionhand gunshot in the eartoxinvision of the futuredead daughterchild cancerprojectorfemale psychologistchild with cancerdivinationpredicting the futurealtering the futurechild with leukemiadiviner (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Grand Budapest Hotel (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Grand Budapest Hotel (2014)

GRAND BUDAPEST HOTEL recounts the adventures of Gustave H, a legendary concierge at a famous European hotel between the wars, and Zero Moustafa, the lobby boy who becomes his most trusted friend. The story involves the theft and recovery of a priceless Renaissance painting and the battle for an enor β€¦mous family fortune -- all against the back-drop of a suddenly and dramatically changing Continent. (Read More)

Subgenre:
black comedyconspiracyabsurdismmadcap comedy
Themes:
inheritancewealthpoetrypsychopathdeathfriendshipmurdermarriagemoneyjealousyprisonescapeweddingracismtheft β€¦humiliationgreedprison escapeescape from prisonmurder of sister (See All)
Locations:
bathtubhoteltrainchurchswimming poolsnowmotorcyclecemeterybusbicycletaxielevatorcourtroomrooftopgas station β€¦museumsewercable cartwo on a motorcyclehotel kitchen (See All)
Characters:
writerfriendmother daughter relationshipmother son relationshippoliceboyfriend girlfriend relationshiptattooboybrother sister relationshipsoldierpolice officerpolicemanlawyersister sister relationshipthief β€¦artistlittle boymaidfrenchgermanolder woman younger man relationshippolice arrestbaker (See All)
Period:
1980s1960s1930swinteryear 1968year 1985
Story:
poemgiftpursuitchampagnebathcoffindead bodycorpsechasefemale nuditybloodsexmale nudityviolenceinterview β€¦flashbackdogbare chested malegunkisscigarette smokingphotographtitle spoken by charactersingingknifepistoltelephone callcryingshootoutfoodface slappunched in the facecatarrestgunfightsecretletterpaintingbookrifletearsplace name in titlerunningbirthdayreference to jesus christtelephonef wordsubjective cameradecapitationbisexualfoot chasegay slurnewspaperorphanflashlightwinecandleold manstrangulationaxemountainstabbingmontageeatingarmywidowstabbed to deathprisonerimmigrantnonlinear timelinejudgesevered headnuntrialno opening creditspainterdrawingfictional warvoice overold womanmarriage proposallooking at the cameratalking to the cameragunshotflash forwardconfessiontheatergraveauthorhotel roombinocularsuniformpay phonefugitivepoisonstatuewitnessratcinemahandgunrefugeetypewriternewspaper headlineeuropehatehenchmanflirtingeyeglasseswaiterfarcelawtreasurehidingwatching a movienosebleedphone boothservantaudiencebrideladderpart animationfollowing someonemonkguardbloody noseattorneytelescopesevered fingerguestanimated sequencetitle appears in writingblack and white scenebutlerrosedeath of sisterblack eyefascismconvictskiingcliffsnowinglanternsirenpajamaspipe smokingimprisonmentman cryingbeing followednarrated by charactersaving a lifepresentbarking doghandshakemonasterypost warspiral staircaselast will and testamentsubtitlesalarmpolice chiefmotorbikeconfessionalsecret societytombstoneborder crossinghideoutjuryflaskold ladyfall from heightcookiebunk bedcripplesense of smellcheesedocumentheirperfumevanitycowardprison breakcodetelegraminmatereading a newspaperfacial scarspaplancarouseldead catblack catfiring squadmonumenteastern europefirst person narrationmemorialalpstoy gunhappy birthday to youtrapdoormerry go roundflashback within a flashbackstaffcaskettear on cheekwedding gownmentor protege relationshiptennis courtcentral europeluggagemultiple time framesbirthmarkfictional countrysledfingerreading a lettersuit of armortrolleyhooded figureoathstreetcarturbanhaypassenger trainvisawillalibiart theftskiersnitchobservatoryhotel lobbyborder guardmotorcycle ridingcologneluxury hotelpenis slurstabbedon the lamspeakerconciergeinternment campswitchhit with a rifle buttbullhornpoisonedpastrywall safebellhopabbeyexhibitbondthree sistersconfession boothhotel ownerdeath squadspeaking to audienceyear 1932depositionscentstolen paintingcatacombsrope ladderknocking on doorpantrytrap doordumbwaiterelevator operatorpastry chefdelivery truckpushed off a cliffsleddingpastry shopski jumpkissing a dead bodyshoeshine boywicker basketpersian catpompositybobsledlaundry chuteloaf of breadstrychninebunkclubfoothanging from a ledgepolice whistletalking to a corpsesommelier84 year oldcoat checklying in statevaluable paintingchapter titlespastry boxreference to egon schiele (See All)

My Girl (1991) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

My Girl (1991)

1972. Vada Sultenfuss (played by Anna Chlumsky) is an intelligent, bubbly, hypochondriacal 11-year old girl. Her father, Harry (Dan Aykroyd), is a mortician and a widower. Her best friend is Thomas J Sennett (Macaulay Culkin). Then her father hires a new receptionist, Shelly (Jamie Lee Curtis), and  β€¦life will never be the same again. (Read More)

Subgenre:
coming of age
Themes:
writingpoetryfuneraldeathfriendshipmarriagefeardancememoryangertheftgriefphotographypanicchildhood β€¦death in childbirthfear of death (See All)
Locations:
forestsmall townbicyclewoodswheelchairlakeschool teacherpennsylvania
Characters:
grandmother granddaughter relationshipwritergirlfriendfather daughter relationshipfamily relationshipsdoctorchildrenbrother brother relationshipboyteacherpolice officernursestudentmusician β€¦best friendlittle girllittle boyteacher student relationshipamericansingle fatheruncle niece relationshipchildhood friendboy girl kiss (See All)
Period:
1970ssummeryear 1972
Story:
funeral homepoemargumentcoffindead bodycorpsebloodtwo word titlekissdancingphotographsingingpantiescryingwatching tv β€¦tearsbedneighborclassroomrivertelevisionswimmingbasketballdeath of friendfishfishingtreemicrophonewidowermini skirtdeath of childscreamringdatebasementfirst partloss of motherfireworkstypewritergaragesingle parentrecord playergirl in pantiesapplausegamesupermarketlifting someone into the airhattitle based on songloss of friendoverallsloss of wifelosstimecrushcarnivalpicnicyogaministerold agemourninghippieinsectsong in titlemedical examinationmakeupfirst kissrosedead childengagementmeditationlipstickbarbecuedivorceeuncleplaying cardspetmenstruationbeebicyclingundertakertween girlponytailtomboyboy with glassesgoldfishteasingreceptionistblackboardbikedocumentcrying femaleallergy11 year oldfourth of julyreference to richard nixonshopping cartmortuarycasketex wifemortalityprecocious childrocking chairbingocampermorticianblond boyfunfairphonograph recordoathfairgroundfireworksenilitymakeup artistlongingjumping ropecadaverwaspdead fishlifting a female into the airbeehivebumper carfirst crushmotor homecrying childmenarchecuckoo clockpuppy lovebee stingpunched in the gutex husbandchocolate barsitting in a treecrypony tailskipping ropejoblessembalmingpledge of allegiancetubaprostate cancerstylistteacher crushmajor child rolehypochondriastashbee attackcarnival gamegender in titlethe star spangled bannerfish bowlreference to the marx brotherstree climbingwant adbell bottomslaneswarm of beescarnyinsect attackleaseproducewriting classreference to walter cronkitedeath noticemixed bloodchild killed by an animalmood ringphrenologyschwinn bicyclecrush on teacherrope skippingcosmetologist (See All)

My Own Private Idaho (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

My Own Private Idaho (1991)

Mike Waters lives on the street and befriends the somewhat older and streetwise Scott Favor who shows him what is necessary to survive. Waters suffers from narcolepsy and can fall asleep at any moment and in almost any circumstance. Favor comes from a rich family and is rebelling against his own bac β€¦kground. They travel together extensively - Waters is driven by the need to find his biological mother - and spend time in Italy. Later in life however, Favor has joined mainstream society and has little time for his old friend. (Read More)

Subgenre:
independent filmcult filmcoming of age
Themes:
inheritancewealthdeath of motherdeath of fatherfuneraldeathmurderfriendshipsurrealismmoneypoliticsdrinkingdrunkennessincestmemory β€¦robberytheftpovertydrug usedysfunctional familyguiltgriefsexualitygamblingsadismabuseunrequited lovecrueltyhomelessnesstraumacheatingregretpsychological traumanarcolepsy (See All)
Mood:
nightmare
Locations:
rural settingbathtubhotelbarrestaurantchurchcarmotorcyclecemeterysmall townairplanetaxiairportwheelchairurban setting β€¦farmcityitalyfrancetruckrooftopcampfiregay bar (See All)
Characters:
girlfriendhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipshomosexualpoliceteenagersingerbrother brother relationshipboyprostituteteenage boygay sex β€¦policemandancerpriestthiefartistbest friendreference to godhomosexualitymaidgermangay teenagerboyfriend boyfriend relationshipgay friendself identityhomosexual kissex teacher (See All)
Period:
1990swinter
Story:
men's bathroompoempursuitbathcoffinchasefemale nuditysexmale nudityviolencethreesomeflashbackmasturbation β€¦dogbare chested malegunkissfemale rear nudityfightcigarette smokingdancingphotographsingingknifebased on playcryingsongdreamunderwearhorseurinationwatching tvdrinkcondomundressinglettershootingpaintingliebeertearssunglassesbombbedcafeprostitutionhallucinationmale pubic hairbisexualgay slurbedroomwinebandconcertfour word titlecocainepoliticianhousefishnonlinear timelinemodelpaintersearchjourneygraveyardold womandrowningconfessionlimousinesmokingliaron the roadstorytellingstatuetentrabbitbraceletflowershairy chestcountrysiderock 'n' rollsadnesssleepingfireworksgraffitieuropetwenty somethingitalianropepornographyteen angstrevelationfaintingrome italytitle based on songbarnstealingsanta claussheephome moviehomecompassionburialhitchhikerstreet lifehitchhikingmental institutionwhiskeybarefootmale prostitutehaunted by the pastsufferingshoesintriguerejectionjunkielosttime lapse photographymale male kissattractiondark pastalienationbonfirehustlerseattle washingtonpervertbisexualityhandshakeporn magazineheartbreaksandwichcartoon on tvnecrophiliagun in mouthleatheraccordionblackoutjukeboxmotel roomtrailer homepopcorncoca colaunconsciousnesspocket watchinfatuationfallingbathrobegigolotravelingteethbroken heartluckhandmale prostitutioncowardoregoncleaningsorrowtraumatic experiencereference to john waynespaghettiportland oregonlocksheltersnoringsquatterdepravityfacesurrogate fatherpreachingsoul matestate name in titleboy girl relationshippassing outsleeping bagmetropolisstreetcarmistreatmentrepressed memorytv show in filmwashington statewine bottlesearchingfrench friesidahobreakdownheartbeattwinkloss of innocencemodern day adaptationeffeminacypastamoral corruptionpsychedeliablack leatherseashellrelativecolosseumshavevagrantemotional breakdownpoker the card gameairplane ticketspeeding ticketpatrolmanrich poorporno shopshakespeare in modern dressconfronting the pastgay magazinedrive in movierandom sexsearch for parentcountry roadgreat plainsfarmlandsound of sexfamily disputemale hustlerold buildingrich fathergay prostitutionscrubbingfalling off a chairrighteousnessboise idahowater basinhome sweet homesafe boxdirty clothesspeed the drugteaching englishfake sexreference to sinead o'connorauto partssex for salegunnysackfaltering friendshiphome on the rangehouse occupationprofession of lovesleeping on a sidewalk (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Mother (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mother (2009)

A mother lives quietly with her twenty-eight-year-old son, Do-joon, providing herbs and acupuncture to neighbors. One day, a girl is brutally murdered, and Do-joon is charged with the killing. Now, it's his mother's call whether to prove him innocent or to leave him imprisoned.

Subgenre:
suspenseblack comedy
Themes:
writingfuneralmurderdeathfriendshiprevengemoneybetrayalprisonpregnancydrinkingfeardrunkennessinvestigationmemory β€¦blackmailguiltbullyingexploitationdisabilitypolice investigation (See All)
Mood:
satirerain
Locations:
barrestaurantforestcemeterysmall townbuswoodspolice stationrooftopbar hostessrunning after a car
Characters:
grandmother granddaughter relationshipgirlfriendmother daughter relationshiphusband wife relationshipmother son relationshippoliceboyteenage girlfemale protagonistpolice officerdetectivepolicemandancerlawyer β€¦motherprofessormother love (See All)
Period:
year 2002
Story:
virilityhitchcockiandead bodycar crashcar accidentcorpsecell phonefemale nuditybloodsexviolenceone word titleflashbackdogbare chested male β€¦fightcigarette smokingdancingphotographsurprise endingpantiesfirecryingwoman on topbeatingunderwearblood splatterfoodmirrorurinationface slapwatching tvcomputerdrinkarrestundressingbookvomitingtearsrunninginterrogationcafehandcuffssubjective cameraflashlightbracandleold maneatingtoiletfalse accusationhit by a carsearchgraveyardpantyhosecoffeepainflash forwardconfessionmicrophoneprologueumbrellamissiondebtcountrysideschoolgirlsuspicionsleepingarsonrockgolfteamedicinekilling an animalbreaking and enteringhidingassaultnosebleeddesperationfollowing someoneapplemental institutionwatching televisioncrime sceneprison guardbloody noseinnocencewindsufferingattempted suicidebackpackmisunderstandingsonkickingcigarette lighterhit on the headschool uniformdrunkevidenceatticlipstickone daysuspectfieldframed for murdermannequinmudbeing followedbriberyhit and runface maskmenstruationneedlekilling a doggolf clubname callingmental retardationabandoned houseteasingsoupgolf coursesouth koreaponddocumentpsychiatric hospitalfacial scarroofspitting bloodpool of bloodcalendaroverhead shotretreatwrenchriceshackrearview mirrorgolf cartmirror ballwatching sexacupunctureostracismcalling someone an idiotgolf ballforensicspublic urinationscapegoatsanitariumtaking off pantsdragging a dead bodyband aidbludgeoned to deathoverprotective mothermementocyanideherbelderly manprison visitationteeth knocked outfacial bruisewading in waterchief of policeelderly protagonistdog hit by a cartofuman undressing a womanscrubbing a floorping pong ballbus tourcleaning up bloodherbalistvomiting in a toiletmob ruletv antennachestnutmentally handicapped personacupuncturistbuilding a firefinger injuryseoul south koreavomiting into a toilettampaxattempted filicideclimbing up a hillhit on the back of one's headrice cakeeating from a cankicking a car (See All)

Garden State (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Garden State (2004)

Andrew Largeman is a semi-successful television actor who plays a intellectually disabled quarterback. His somewhat controlling and psychiatrist father has led Andrew ("Large") to believe that his mother's wheelchair bound life was his fault. Andrew decides to lay off the drugs that his father and h β€¦is doctor made him believe that he needed, and began to see life for what it is. He began to feel the pain he had longed for, and began to have a genuine relationship with a girl who had some problems of her own. (Read More)

Subgenre:
cult filmcoming of ageautobiographical
Themes:
death of motherfuneralfriendshipsuicidekidnappingdrugsmoneydrinkingvoyeurismlonelinessparanoiadepressiondrug usedysfunctional familyapocalypse β€¦blindness (See All)
Mood:
high schoolrain
Locations:
bathtubhotelbarrestaurantswimming poolmotorcyclecemeterylos angeles californiaairportkitchenwheelchairpolice caryachttown
Characters:
writerbabygirlfriendmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspoliceafrican americanboyfriend girlfriend relationshipdoctorsingerbrother sister relationship β€¦prostitutepolice officerstudentpolicemandanceractorjewishbest friendreference to godpsychiatristjewcousin cousin relationshipgrandfather grandson relationshipfrench kissstepbrother stepsister relationshipsex with prostitute (See All)
Story:
men's bathroomholeclassmategiftreadingscreamingcoffinbathroomfemale nuditysexdoggunsex scenekisscigarette smoking β€¦dancingejaculationsingingpartypantiesbased on true storytelephone callcryingsongunderwearslow motion scenewatching tvdrinkswordliebedcafemarijuanarobotvoyeurguitaralcoholtelephoneswimmingbramansioncocainewhite pantiesdream sequencejourneygraveyardnecklacepainhotel roomcharacter repeating someone else's dialoguesuburbliarpay phonewritten and directed by cast memberauditionstorytellingchristmas treedirected by starisolationsadnessdirectorial debutloss of mothertrustblack americanrecord playergirl in pantiestwenty somethingwaiterhuggingdestinygolfpot smokingteafireplacebow and arrowmedicineheavy raincakehelmettempleamerican footballphone boothimprovisationhome movieknighthomefateburialtowelpeeping tomscamdivingpillsnew jerseyticklinginventoranxietyheadphonesmedical examinationmedicationbathingice skatingmedieval timesairplane crashsaunaexistentialismbriefsphoto albumatheistmarijuana jointshynessbongcannabisparalysisjunkyarddead animalwoman cryinghomecominggerman shepherdsnorting cocaineescalatorbreadinventiontraffic jamstonedwoman in bra and pantiesunhappinessadopted sonecstasyjointblind womanurinalwalkingseizurealligatorguardianparaplegicacoustic guitarfather son estrangementoverhead camera shotfather son reunionanguishdigging a graveshared bathimplied sexwet clothesepilepsyheadachepeep holepet catcasketpolice sirenfreewayvideo cassettemotorcycle with a sidecartap dancinghardware storeairlineranimal in cast creditshamsterprotective malevietnamesesuit of armorphonograph recordlaw firmquarrydoctor's officeflaming arrowstore clerkfigure skatinghobbydishwasherorganistpeep showheadstonecaught in the rainchancefingerprintsgrave diggerspin the bottledobermanmedical clinicquarterbackreference to star trekspying on couple having sexserendipitydiving boardearrainy daybellhopfree spiritbrain scanmetrosexualfootball practicescam artistabyssneurologistsiren the alarmgrave robberreference to dick cheneyarkmedicine cabinettrading cardreference to julia robertsseeing eye dogkissing in the rainnewark new jerseywailing walldog humping someone's leggo kartpit bullreference to robert denirobudding friendshiplithiumneck injurycollision coursedeath of a petyom kippurcamera obscuracooliejousttrekkieeye linerfuneral ritemanic pixie dream girlpet cemeteryunhappy childhoodcuff linkspsychiatric examinationreference to life magazinemaydayreturn to the pastunintelligible dialogue with subtitlesmeeting againpet funeralreference to aldous huxleysitting in a bathtubnumbnessrock quarryturpentinevelcrooperation desert stormdusting for fingerprintsemotional detachmentunderground cavernknight in armorreference to brave new worldsnot dripping from nosevietnamese restaurant (See All)

Elephant (2003) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Elephant (2003)

A day in the lives of a group of average teenage high school students. The film follows every character and shows their daily routines. However two of the students plan to do something that the student body won't forget.

Subgenre:
independent filmexperimental filmpunkteen movie
Themes:
deathfriendshipmurderrevengesuicidejealousyfeardrunkennessescapeangerbrutalitysadismbullyingphotographycruelty β€¦panicvengeance (See All)
Mood:
high school
Locations:
schoolcarschool shooting
Characters:
girlfriendfather son relationshipboyfriend girlfriend relationshipboyteenage girlteenage boyteacherstudentphotographergay kissbullyteacher student relationship
Story:
high school friendmultiple murderclassmatescreamingargumentbathroomcar accidentnuditybloodviolencedoggunphotographexplosionpistol β€¦showertelephone callfireshot to deathblood splattershotgunwatching tvcamerashootingrifleheld at gunpointbombanimal in titlerunningmarijuanapianoclassroomtelephonemassacrevideo cameraweaponnonlinear timelineman with glassesgunshotlibrarylocker roomscreamactor shares first name with characterlong takegymhigh school studentlaptopkillingpot smokingstreetragetimepart of trilogyhomicidegirl with glassesexplosivethunderbackpackmercilessnessdiscussionstairsthunderstormhandheld cameraone daypsychoticlaptop computerswastikaoutcasthigh school teachercar drivingcafeteriafirearmfemale teacherstaircaseadvicerestroomdrunk drivingconversationblackboardwalkingwarninghallwaydarkroomrunhigh school girlfrightbloodshedbaglunchdetentionbulimiascaregrudgedelivery manportland oregondisturbed individualcorridormultiple perspectivescity parkblond boycapfrisbeefemale studentmultiple homicidemass killingadolescent boyhigh school principalteenage angstadolescent girlhigh school boyschool lockerdeanmurderer duoschool libraryschool cafeteriafitting introubled teenage boylunchroomdisturbed personfur elisefemale classmatemultiple killingschool gymfirst time actor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Funny Games (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Funny Games (1997)

Two seemingly well-educated young men, who call each other Paul and Peter among other names, approach a family on vacation. They are, apparently, friends of the neighbors, and, at the beginning, their true intentions are not known, but soon, the family is imprisoned and tortured in its own house vio β€¦lently, which the viewers are forced mostly to imagine and to share a certain complicity with the criminals. It might be some kind of game with the lives of husband, wife, son, and dog, but why are they doing it? (Read More)

Subgenre:
independent filmpost modern
Themes:
psychopathdeathmurderkidnappingtortureescapegriefhumiliationsadismhome invasionmurder of family
Mood:
breaking the fourth wall
Locations:
kitchenlaketrying to escape
Characters:
serial killerhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsterrorboy in underwear
Story:
family vacationeggvacationscreamingcorpsecell phonechasebloodviolencedogtwo word titleknifesurprise endingcryingface slap β€¦watching tvwritten by directorundressingvomitingrifleprayertelevisionoperachild in perilcontroversylooking at the cameradrowningtalking to the cameragunshotdeath of childlong taketied upcharacter says i love yougamekilling an animaloverallsbroken legremote controlinvasionbuddyloss of sonmurder of a childtitle at the endbetduct tapeloss of husbandphysical abusebag over headforced to stripdockkilling a dogdead childrengolf clubsailboatmind gamewetting pantsloss of childactual animal killedpsychological torturedeath by drowningdeath by gunshotbloody body of a childglovechild with a gunno survivorsaustrianno music during end creditshair dryerchild killerfamily in dangergolf ballremadehorror movie remadesailing boathit with a golf clubmurderer duochild shot in the headblood on wallrewindescape out a windowcar stereoman slaps manescape out windowkilling a petgolf bagbroken eggwet underwearmurdered couplerewinding actionvacation resort (See All)

Flightplan (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Flightplan (2005)

The husband of aviation engineer Kyle Pratt has just died in Berlin. Now she is flying back to New York with his coffin and their six-year-old daughter Julia. Three hours into the flight Kyle awakens to find that Julia is gone! It's a big double-decker plane, so very concerned mother has a lot of te β€¦rritory to cover in order to find her daughter. But as Kyle fights to discern the truth, she takes matters into her own hands. (Read More)

Subgenre:
suspenseconspiracypsycho thriller
Themes:
death of fathermurderdeathkidnappingmoneyfeartorturememoryrobberyparanoiadrug useredemptiongriefpanicdeath of daughter β€¦missing child (See All)
Mood:
rain
Locations:
helicopterhotelhospitalnew york citytrainsnowairplanebustaxiairportelevatorapartmentpolice cargermanyairplane accident β€¦airplane tripairplane explosionairplane bombairplane cockpit (See All)
Characters:
grandfather granddaughter relationshipgrandmother granddaughter relationshipgirlmother daughter relationshiphusband wife relationshipfather son relationshippoliceboyfemale protagonistpolice officerpolicemanlittle girlsingle motherpolice detectiveaunt niece relationship β€¦german soldierairplane stewardessairplane crew (See All)
Story:
hitchcockiancoffinbathroomdead bodycorpsechasebloodf ratedone word titleflashbackgunfightexplosionsurprise endingpistol β€¦telephone callfoodmirrorslow motion scenepunched in the facewatching tvliebombrunninghandcuffsflashlightterroristambulancewomansubwayfalse accusationapologychildsearchpilotfbiliarmistaken identitysuitcasedisappearancedeath of husbandloss of fatherdie hard scenariosleepingstrong female characterberlin germanyiceapplausecaptainmedicineheroinemorguewatching a movietherapistswat teamimpersonationteddy bearstrong female leadhomecompassionaction heroineransombloody nosepillssurveillance cameraburglaryanxietyplanemedicationsafearabsnowingloss of husbandgovernment agentflighthysteriabreak infire extinguisherbroken windowbroken mirrorknocked unconsciousurineunconsciousnessflight attendanthead injuryhandcuffedhijackingenglishmancircular staircaseracial discriminationaccusationlifting person in aircaskethijackmissing daughterfalling off a rooffemale sitting on a toiletdetonatoroxygen masksleeping pillslost childfire enginebreaking a car windowcockpitid cardhandcuffed womankiss on the foreheaddistractionairport securitystuffed animal toycourtyardhit on the head with a fire extinguisherco pilotairplane pilotjet plane6 year oldcargonewfoundlandworried motherhit with a fire extinguishercontainmentdetonationairplane hijackingair marshaldeath by explosionairplane passengerpost 911video screenescape from handcuffstoy bearhandcuffed manpanic roomtalking to a dead bodymother searches for missing daughterwriting on fogged windowankle holstercarrying a childhotel billtalking to one's dead husbandairplane toiletbomb detonation devicecarrying a girlparent searches for childshooting a lock openworried about daughter (See All)

Open Your Eyes (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Open Your Eyes (1997)

A once handsome playboy, Cesar finds himself in a mental facility and he can't remember why. All he can remember is meeting the love of his life for one day, and then getting into a car accident which left his face horribly disfigured. But the pain of becoming physically undesirable may help him to  β€¦find the truth. (Read More)

Subgenre:
cyberpunk
Themes:
wealthdeath of motherdeath of fatherdeathmurderfriendshiplovesurrealismsuicidejealousyprisondrinkingdrunkennessmonstermemory β€¦angerparanoiaabuseamnesia (See All)
Mood:
nightmare
Locations:
churchnightclubrooftop
Characters:
friendfather son relationshipmother son relationshippoliceboyfriend girlfriend relationshipdoctorchildrenpolicemandancerlawyerlove triangleactressbest friendreference to godsecurity guard β€¦psychiatristsecretaryhispanicself pity (See All)
Story:
men's bathroompsychologistcar crashcar accidentfemale frontal nudityfemale nuditynuditybloodinterviewflashbackgunsex scenekissdancingnipples β€¦photographthree word titleshowervoice over narrationbeatingdreamwatching tvcomputercatdrinkkissingmaskshootingvomitingrunningbirthdaysubjective cameratoiletaccidentdream sequencedrawingflash forwardparkcharacter's point of view camera shotactinghandgunsurgerysyringecomavirtual realitywomanizerdrug overdoseremote controlpillssufferingresurrectionmental hospitalimmortalitymakeupinfectiondisfigurementprison cellsurgeonpajamasswearingsymbolismatheistcontractsuffocationcartoon on tvimperative in titleplastic surgerymetaphorcoca colainsane asylumaccidental shootingvanitydisfigured facetv interviewmimeanorexiaarm wrestlingfrenchmandreamingtalking while drivingfamous lineeyessurgical operationsubconsciousreference to walt disneyreligion versus sciencedeus ex machinalynchiantranquilizerdream worldvertigosmotheringcaterercautionary talesense of sightcryonicsvanishingdream sequence within a dream sequencepsychiatricreference to jules verneprosthesismental problemracket ballatheism versus christianityreference to the phantom of the operafrench giallolife extensionspanish giallocryogenic technologyrhinoplasty (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Gothika (2003) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
suspensesupernaturalparanormalpsycho thriller
Themes:
psychopathmurderdeathsuicidekidnappingmarriagerapeghostprisonfeartortureescapememorysupernatural powerparanoia β€¦drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessnightmaregorerainneo noirslasher
Locations:
bathtubhospitalswimming poolcartaxipolice stationpolice car
Characters:
serial killerfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipspolicedoctortattoofemale protagonistnursepolicemanlawyerreference to godkiller β€¦security guardvillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
reckless drivingmurdererpursuitscreamingcar crashcar accidentcorpsecell phonechasefemale frontal nudityfemale nuditybloodsexf ratedviolence β€¦interviewflashbackbare chested malegunkissfightphotographexplosionknifesurprise endingpistolshowertelephone callfirecryingdreamblood splattermirrorshotgunwatching tvcomputershootingrifletearsrunninghallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophoneperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionstalkingdeath of husbandtrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreeowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Man Bites Dog (1992)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Man Bites Dog (1992)

A camera crew follows a serial killer/thief around as he exercises his craft. He expounds on art, music, nature, society, and life as he offs mailmen, pensioners, and random people. Slowly he begins involving the camera crew in his activities, and they begin wondering if what they're doing is such a β€¦ good idea, particularly when the killer kills a rival and the rival's brother sends a threatening letter. (Read More)

Subgenre:
black comedycult filmmockumentarydark comedyfound footagefake documentarydocumentary filmmakingpsychological thriller
Themes:
death of motherdeath of fatherpsychopathmurderdeathlovekidnappingmarriagerapechristmasmoneypregnancydrinkingfeardrunkenness β€¦escapefilmmakingnaturelonelinessbrutalityinsanitysadismevilcrueltymurder of familyrape and murder (See All)
Mood:
goresatireavant gardeslashermurder of a boy
Locations:
bathtubhospitalbarbeachrestauranttraintaxikitchenapartmentrooftoptaxi driversex in a kitchen
Characters:
serial killerhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipshomosexualboyfriend girlfriend relationshipchildrensingerboyactorlawyerkillervillainfilm director β€¦terrorgrandfather grandson relationshipgrandmother grandson relationshipbaby boydeath of a boy (See All)
Story:
dentisteccentricpoemmurdererchampagnedead bodycorpsechasefemale frontal nudityfemale nuditynuditybloodmale nudityviolenceflashback β€¦male frontal nuditymale rear nuditydogguncigarette smokingmale full frontal nuditysingingpantiessongshootoutbeatingdreamshot to deathunderwearblood splatterfoodmirrorshot in the chesturinationshot in the headpunched in the facewatching tvdrinkvomitingbeerbirthdaybedlow budget filmcafepianojailreference to jesus christmale pubic hairrevolvershot in the backreportersubjective cameraswimminggood versus evilgay slurwineold manstrangulationeatingpoliticiantoiletboxingaccidentbirdbirthday partycontroversypantyhoseold womantalking to the camerashot in the foreheadmicrophonestabbed in the backunderground filmdeath of childchristmas treeskeletonringactor shares first name with characterpianisttragic eventfilm within a filmneck breakingratpubeuropechild murderheart attackmaniacbirthday cakeitaliantv newswaiterclaim in titlebulletbreaking and enteringmass murdercakesociopatharchitecturesexual abusemutilationboxerskullrape victimrailway stationart gallerydead womanteamkickingmercilessnessdark humorshot in the facearabdisembowelmentgang rapeperversionmurder of a childslaughterdead woman with eyes openkilling spreenude woman murderedpigeonabandoned buildingblood on camera lensserial murdervillain played by lead actordefecationevictionhuman monsterfilm crewflutetelevision newssexual violencegun held to headhomicidal maniacfilm projectorhideouttv reportercameramancoca colafilm cameraseagullcredit cardaccidental shootingbody in a trunkbelgiummailboxracial prejudicesense of smellcorrupt politiciannaked dead womancinema veriteextreme violencemetal detectorsex on tablecamouflagemailmanjailbreaktoy gunneck bracesadistic psychopathdeath of parentspsychotronic filmoff screen murdermurder spreetelevision reportergrindhouse filmhungarianfleeingcrime spreespotlightinfanticidedeeply disturbed persondocumentary crewserial rapistno survivorsdecomposing bodybigotquarryfalse teethfloatingdead babynight watchmanmodel airplanehousing projectwoman strangled to deathmidnight moviebrussels belgiumchristmas decorationpower plantsparklerelderly womansex on a tablebowelsstreakingmovie businessrailroad stationcementfirst communionpostal workerskylightelderly manmoroccanmutilated bodyflutiststocking capdirect cinemareference to brigitte bardotaestheticsnaked dead manfrench shock cinemasardinesound manepileptic fitfrench cinemareference to jean cocteauwrapped in a bedsheetmurder of a nude manscared to deathbiting handmusic conservatorydisturbed personreference to frank lloyd wrightgin and tonichead bashingunprovoked violencehigh rise apartment buildingpigstywashroom attendantdouche bagold woman murderedlow incomereference to jacques cousteaureference to jean gabinlow income housingnightingalereference to jean maraisrolled up rugdead body rolled up in a ruginsane violencesanta claus beardshooting through the ceilingid braceletrewound film sequencesignet (See All)

Elizabethtown (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Elizabethtown (2005)

After causing a loss of almost one billion dollars in his company, the shoe designer Drew Baylor decides to commit suicide. However, in the exact moment of his act of despair, he receives a phone call from his sister telling him that his beloved father had just died in Elizabethtown, and he should b β€¦ring him back since his mother had problem with the relatives of his father. He travels in an empty red eye flight and meets the attendant Claire Colburn, who changes his view and perspective of life. (Read More)

Subgenre:
black comedy
Themes:
death of fatherfuneraldeathlovemarriagechristmasmoneydrinkingdrunkennessweddingtraveldysfunctional familygrief
Mood:
rainnight
Locations:
helicopterhotelchurchcemeterysmall townairplaneairportroad triptruckmuseumoffice party
Characters:
mother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsafrican americanchildrensingerboybrother sister relationshipdancerreference to godcousin cousin relationshipuncle nephew relationshipgrandfather grandson relationship β€¦self discoveryself referentialairplane stewardess (See All)
Period:
2000s
Story:
funeral homecremationscreamingcoffinbathroomdead bodycorpsecell phoneone word titleflashbackdogkissdancingphotographtitle spoken by character β€¦singingknifeerectiontelephone callfirevoice over narrationcryingsongdreamunderwearfoodurinationslow motion scenewatching tvcomputerdrinkpaintingvomitingtearsriveralcoholcookingbandbasketballeatingwidowsuicide attemptmapgraveyardhotel roomfired from the jobumbrellaon the roadstorytellingstatuecity name in titlebusinessamerican flagdeath of husbandloss of fatherheart attackhugginglistening to musichelmetburialwhiskeycivil rightsremote controlshoesmourninganimated sequencerejectioncorporationloss of husbandflightphoto albumsuccesshomecomingfamily reunionundertakerpartial female nuditybubble bathflight attendantsunriseeaglescholarshipashesfailurewakereference to john f. kennedycarouselkansasmerry go roundurnceodriving at nightmississippimemphis tennesseetap dancingkentuckygolf cartreference to martin luther king jr.death of parenteulogyrendezvousstovetalking to the deadrental carsuicide contemplationwashing clotheswoman in a bathtubmemorial servicerainy dayboeing 747disgraceseat beltsprinkler systemcoming homeloss of parentlouisville kentuckyjumbo jetreference to jim morrisonexercyclegarbagemanweeping manreference to norman rockwelloklahoma citywhiskey bottlechannel surfingfarmers marketmanic pixie dream girlid badgeopen casketfirebirdpopping balloonamerican legionbuilding housered hatreference to colonel sandersdeath in the familyfuneral receptionvolvo 240call waitingflying first classwatching video on tv (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Birth (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Birth (2004)

Anna is a young widow who is finally getting on with her life after the death of her husband, Sean. Now engaged to be married, Anna meets a ten-year-old boy who tells her he is Sean reincarnated. Though his story is both unsettling and absurd, Anna can't get the boy out of her mind. And much to the  β€¦concern of her fiance, her increased contact with him leads her to question the choices she has made in her life. (Read More)

Themes:
obsessionfuneraldeathmarriageinfidelitybetrayaljealousyadulterypregnancydrinkingweddingmemoryextramarital affairsupernatural powergrief β€¦unfaithfulness (See All)
Locations:
bathtubhospitalnew york citybarbeachrestaurantsnowcemeterytaxi
Characters:
grandfather granddaughter relationshipgrandmother granddaughter relationshipbabymother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipspolicedoctorsingerboyfemale protagonistteacherstudent β€¦policemanphotographersister sister relationshiplove triangleolder woman younger man relationshipaunt niece relationshipfiance fiancee relationshiplove letterbrother in law sister in law relationship (See All)
Story:
childbirthbathcoffincell phonefemale nuditysexmale nudityone word titleflashbackkissfightcigarette smokingsingingpartytelephone call β€¦cryingsongunderwearpunched in the facecameradrinkundressingbare buttlietearsrunningbirthdaycafepianoclassroommanhattan new york cityconcertwidowchild abuseapologygraveyardflash forwardgravepay phonepossessionpianistdeath of husbandclasstrustheart attackbirthday cakeice creamjoggingsanta clausbirthviolinorchestrareincarnationplaygroundmourningice skatingsnowingdeath of loved oneviolinistpedophiliacentral park manhattan new york cityabuse of powerchild molestationtombstonecelloobsessive loveclimbing a treemarriage engagement10 year oldenigmashared bathdoormandeath of lovermusic teacherremarriagecellistice rinkdeja vuhappy birthdaydead husbandlife after deathlocationparaphiliastring quartetnon sequituradult as childbetrayedtwo in a bathfreudianbetrayal of trustobsessive loverhansom cab10 years laterbetrayerparaphilebouncing a ballmonkey barsboy woman relationship (See All)

Untraceable (2008) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Untraceable (2008)

A secret service agent, Jennifer Marsh, gets caught in a very personal and deadly cat-and-mouse game with a serial killer who knows that people (being what they are - both curious and drawn to the dark side of things) will log onto an "untraceable" website where he conducts violent and painful murde β€¦rs LIVE on the net. The more people who log on and enter the website, the quicker and more violently the victim dies. (Read More)

Subgenre:
suspensevideo
Themes:
death of fatherpsychopathdeathmurderrevengesuicidekidnappingtortureinvestigationvoyeurismdatingsadismabductiondyingtechnology β€¦murder investigationsuicide of father (See All)
Mood:
gorerainpoetic justice
Locations:
motelstormschool bus
Characters:
grandmother granddaughter relationshipserial killergirlmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshippolicefemale protagonistpolicemansingle motherpolice detectivemuslimengineerchinese food β€¦death of killercomputer datingcat killer (See All)
Story:
dead body in a car trunkpursuitdead bodycar accidentcorpsecell phonechasebloodviolenceone word titlegunphotographtitle spoken by charactersurprise endingshower β€¦telephone callshot to deathblood splattershot in the chestshot in the headwatching tvcomputercatarrestfalling from heightshootingrunningbirthdayvoyeursubjective cameranewspaperbound and gaggedterroristvideo camerastabbingdeath of friendbridgewidowstabbed in the chestinternetfalse accusationman with glasseschild in perilbirthday partypolice officer killedfired from the jobfbipay phoneproduct placementcollege studenthangingshot in the shoulderamerican flagdatebasementloss of fatherhandgunnewspaper headlinehatesingle parentpizzatwenty somethingtv newsfalling down stairskilling an animalballoonloss of friendcaptivefbi agentloss of loved onevideotapeswat teampress conferenceskateboardstrong female leadremote controltensiondiamondsurveillance cameraironyco workerice hockeye mailbody landing on a carpolice raidduct tapeloss of husbandburned to deathpsychotictext messagingcar troublegardeningtaserdockwebsitedvdmotel roomdisposing of a dead bodytv reporteranimal crueltytraffic jamhanging upside downkittencomputer hackerbleedingpunching bagroller skatingbleeding to deathburnt bodyfilmed killingcodedead catradio newsportland oregonblogskateboardersnufftortured to deathaccomplicebreaking down a doorbreaking a car windowtiarabattering ramcyberspacemorse codehiding in a carkilling a catdriving in the raincementwatchingintravenousforensicpost itfalling off a bridgefemale fbi agentweather reporthemophiliaskate parkrollerskating rinku.s. congressmanonline chatburning fleshfelinepredator turns victimkilling machinecybercrimesports arenafalling from a rooftophouse catorgan musicid badgecomputer technologyeye blinkingsulphuric acidexsanguinationpussy catrat trapsnuff videothunderbirdchemistry teachertivopussycatbotvoice impersonatoracid deathbattery acidportland state universitypotassium chloridetrojan (See All)

Capote (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Capote (2005)

Famed writer 'Truman Capote' (qv), southern born and bred but now part of the New York City social circle, is growing weary of his current assignment of writing autobiographical type pieces for the New Yorker. After reading a newspaper article about the just occurred November 14, 1959 cold blooded m β€¦urders of the Clutter family in their rural Kansas home, Truman feels compelled to write about that event as his next article. So he and his personal assistant Nelle 'Harper Lee (I)' (qv), also a southern born New Yorker and an aspiring writer of her own, head to Kansas to research the story first-hand. Truman hopes to use his celebrity status to gain access to whomever he needs, such as to Laura Kinney, a friend of the Clutter daughter she who discovered the bodies, and to Alvin Dewey, the lead police investigator and also a Clutter family friend. If his celebrity doesn't work, Truman will grease the wheels by whatever means necessary. When the police eventually charge suspects, two young men named Dick Hickcock and Perry Smith, Truman uses those same tactics to gain access to them. Truman's fascination with the story makes him believe that he can revolutionize writing by expanding the germ of the article into what he calls a non-fiction novel. His personal involvement also changes as he grows emotionally attached to Perry, the seemingly sensitive and thus probable submissive in the criminal pairing, thus Truman becoming part of the story itself. Article or non-fiction novel, Trum… (Read More)

Subgenre:
gay interest
Themes:
writingdeathmurderfriendshiplovechristmasmoneyprisondrinkingdrunkennessinvestigationrobberyracismlonelinesstheft β€¦celebrityexecutiontheatrealcoholismmurder of family (See All)
Mood:
high schoolgore
Locations:
rural settinghotelnew york citybarrestauranttrainsnowairplanetaxipolice stationfarmpolice carcourtroomtaxi driverspain
Characters:
writerfriendhusband wife relationshipfather son relationshipmother son relationshipfamily relationshipshomosexualpoliceafrican americanboyfriend girlfriend relationshiptattooboybrother sister relationshipteenage girlteenage boy β€¦police officerstudentdetectivepolicemanphotographerpriestlawyerthiefartistnative americankillersheriffboyfriend boyfriend relationshippolice arreststepfather stepson relationshipself portraitbaby food (See All)
Period:
1960s1950syear 1960
Story:
funeral homeeccentricmagazinemurdererreadingcoffindead bodycorpsecharacter name in titlebloodviolenceone word titleinterviewgunkiss β€¦cigarette smokingphotographtitle spoken by characterpartytelephone callcryingbased on bookshot to deathshot in the headshotgunslow motion scenecameradrinklettershootingpaintingbooklierifletearscafeneighborjailreference to jesus christcriminalreporternewspaperthroat slittingjudgeapologyman with glassestrialdrawingjourneypainparklimousineauthormicrophoneliarpay phonechristmas treeflowershangingdiarycourtmanipulationspeechdeath of brotherisolationtied upblindfoldgay coupletypewritertrusteyeglassesapplausepornographywhat happened to epiloguecookjail cellgay lead characterpress conferencejournalismbrooklyn new york citycompassionguardburglargrocery storeprison guardresearchburglarynew orleans louisianatheatre audiencescissorsbribesafedeath of sisterprison cellnewspaper clippingphoto albumshamebag over headpublisherfarmhousejuryhugdeath rowdeath penaltyhandcuffedalabamanoosevanitymanuscripttelegramsorrowdeath of familycapital punishmentkansaslimppillowspoontoy gunchild abandonmentprison wardenhoodleg injurymartiniscrapbookrewarddeath by hangingshacklesmultiple homicidelord's prayercell mategallowsprairiesupreme courtpenitentiaryeffeminacyhunger strikesketchingnursingplan gone wrongstanding ovationtypingreference to elizabeth taylorreference to humphrey bogartaspirinbook readingsentenced to deathlispexecution by hangingforce feedinggincar rentaltrain compartmentamerican midwestnew york timesreading newspaperyear 1959prison visitationwheat fielddressing gownportersalonfuneral parlorwheatsurrogate brotherfalse friendbody searchharnessbefriendingreference to tennessee williamslegal appealmethodistreference to john hustonsuicide of brotherreference to henry david thoreausuicide of sisterfriskingreference to henri matisseconfession to murdernew yorker magazinecherokee tribehorn rimmed glassesinsanity plealast breathresearch assistanttruman capoteamigofort leavenworth kansasjail guardleavenworth penitentiarypublic readingreference to to kill a mockingbird the novelrobbery gone wrongsuicide watch (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Conviction (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Conviction (2010)

Betty Anne Waters (Swank) is a high school dropout who spent nearly two decades working as a single mother while putting herself through law school, tirelessly trying to beat the system and overturn her brother's (Rockwell) unjust murder conviction.

Themes:
death of fatherobsessionfuneralfriendshipdeathmurdermarriagerapechristmasmoneyjealousyprisondrinkingfearinvestigation β€¦divorceguiltforgivenessdancing with a baby (See All)
Mood:
high school
Locations:
barchurchpolice carcourtroomlake
Characters:
babygirlfriendmother daughter relationshipfather daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipspoliceboyfriend girlfriend relationshipchildrentattoobrother brother relationshipboy β€¦brother sister relationshipfemale protagonistpolicemandancerphotographerlawyerwaitressgrandfather grandson relationship (See All)
Period:
year 1980year 1993year 1983
Story:
death of grandfatherchampagnedead bodycorpsecell phonecharacter name in titlenuditybloodmale nudityviolenceone word titleflashbackmale rear nuditydogbare chested male β€¦gunfightcigarette smokingdancingphotographknifetelephone callcryingbeatingfoodmirrorface slappunched in the facewatching tvcomputercameradrinkarrestundressingbare buttletterliebeertearssunglassesrunninghandcuffsclassroomprayerstabbingbasketballwomaneatingdinertoiletfalse accusationjudgeapologytrialbartenderflash forwardlimousineliarchristmas treecourtamerican flaghairy chestisolationpolicewomancharacter says i love youcabinclasssacrificecorrupt copstrong female characterpickup trucksupermarketbreaking and enteringlawbarncookworking classnew year's evestrong female leadbar fightpromiseremote controlprison guardshopliftinginnocenceattorneyattempted suicidedespairbribeframe upprideevidenceaerial shotconvictvoice over letternotedead mothermarital problemshamebarbed wirecandytestimonyrunning awayhomecomingarmed robberyclimbing through a windowjuryhot dogdistrict attorneywrist slittingscene of the crimednawrongful convictionmassachusettsreturning homeflashback within a flashbacksolitary confinementtrespassingclimbing out a windowmiscarriage of justicecourthousechristmas decorationsshacklesfoster homemedia frenzyperjurybeer bottlemerry christmasransackingforensicsconvicted felonpopsicleman carrying a womanaudio flashbacklaw schooldna testingfalse accusation of murderpiggy back ridelife sentenceestranged daughterhappy new yeari.d.trailer housenotaryprison visitationimmunitychief of policetroubled childhoodshaving legsexonerationmace the repellentgednew york times the newspaperlaw professormale stripteasefriskingnon profit organizationpacing the floorpulling down pantsfacial scratchimitating a blow jobbar examrod and reelmissing evidenceunfit motherblood grouphitting a policemanreference to barbara bushrepairing a roofwitness tamperingdaughter slaps motherretractiontravesty of justice (See All)

Jersey Girl (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jersey Girl (2004)

Ollie Trinkie is a publicist, who has a great girlfriend, Gertrude, whom he marries and they are expecting a baby but while he is looking forward to being a father, he doesn't lighten his workload. Gertrude gives birth but dies in the process. Ollie doesn't live up to his responsibilities as a fathe β€¦r. Eventually the strain and pressure of losing his wife and being a father gets to him and he has breakdown, which leads to his termination. So with nothing much to do he tries to be good father to his daughter, Gertie. He also meets a young woman name Maya, who likes him but he is still not over his wife. (Read More)

Subgenre:
cult film
Themes:
funeraldeathfriendshipchristmaspregnancydrinkingdrunkennessseductiondeath of wifeunemploymentfalling in lovedeath in childbirthdying in childbirth
Locations:
hospitalnew york citybarcemetery
Characters:
grandfather granddaughter relationshipbabygirlfriendfather daughter relationshiphusband wife relationshipfather son relationshipfamily relationshipsboyteachernursedancersingle father
Period:
1990schristmas party
Story:
swingchildbirthcoffinbathroomfemale nuditynuditysexkisscigarette smokingdancingpartylabiashowerunderweardrink β€¦undressingliebeerpianoclassroommanhattan new york citydinertoiletbrunetteapologyman with glassesgraveyardfired from the jobwidowerclasskissing while having sexpizzaactor playing himselfwoman with glassesloss of wifepress conferenceembarrassmentcameonew jerseyschool uniformhorse and carriageshamepiano playerhandshakecentral park manhattan new york cityvideo storemusic industryfatherhoodkarmadead wifewatching a videoschool playpublic relationscelibacyplay within a filmpublicistblue bravideo store clerkmemorabiliagarbage collectorbook editoraneurysmflushing a toiletmother dies in childbirthslow clapgreasemoving furniturewatching a playstreet sweeperdeath by giving birthpress releasebaby powdermusic video awardslamaze classmother died at childbirthparenting class (See All)

Joker (2019) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Joker (2019)

Forever alone in a crowd, failed comedian Arthur Fleck seeks connection as he walks the streets of Gotham City. Arthur wears two masks -- the one he paints for his day job as a clown, and the guise he projects in a futile attempt to feel like he's part of the world around him. Isolated, bullied and  β€¦disregarded by society, Fleck begins a slow descent into madness as he transforms into the criminal mastermind known as the Joker. (Read More)

Subgenre:
suspenseblack comedycult filmstand up comedydark comedytragedypsychological thriller
Themes:
writingdeath of motherdeath of fatherobsessionpsychopathmurderdeathloverevengemoneybetrayaldrunkennessescapedancegangster β€¦investigationdeceptionangercorruptionlonelinessbrutalitydepressioninsanityhumiliationmental illnessevilabusehome invasionadoptioncrueltyunemploymentrevolutionpolice brutalitymadnessmurder investigationmurder of familychildhood traumapsychological trauma (See All)
Mood:
darknessgoreneo noirambiguous endingstand updownward spiral
Locations:
bathtubhospitalbuselevatorurban settingapartmentpolice carcitytaxi driver
Characters:
serial killermother son relationshippoliceafrican americanpolice officernursedetectivesingle motherinterracial relationshiplittle boypolice detectivevillainpsychiatristcomedianemployer employee relationship β€¦stand up comedianpolice chaseneighbor neighbor relationshipdysfunctional relationshippolice violencedeath wishrunning from the policedancing in underwear (See All)
Period:
1980syear 1981
Story:
men's bathroommurdererreadingargumentbathbathroomcar crashcar accidentchasecharacter name in titlebloodviolenceone word titleinterviewflashback β€¦bare chested malegunfightcigarette smokingdancingtitle spoken by charactersingingsurprise endingpistoltelephone callfirebeatingdreamshot to deathunderwearblood splattermirrorshot in the chesturinationshot in the headslow motion scenepunched in the facewatching tvwritten by directorarrestmasklettershootingbased on comiclieheld at gunpointrunningneighborpianohallucinationrevolvertelevisionfightingcriminaltelephoneshot in the backf wordfoot chasenewspaperorphanbased on comic bookambushdisguiseambulancemontagestabbed to deathdinerweaponsubwayjokechild abuseno opening creditsanti herohit by a cardouble crosscontroversynews reportshot in the legshot in the foreheadpainconfessionstalkermicrophonedangerportraitbusinessmanclownprotestlocker roomfired from the jobliarfantasy sequencepay phonekicked in the faceopening action scenediarydomestic violencelong takescarpianistbodyguardstalkingthreatisolationsadnessloss of fatherratsuspicionstageloss of motherprofanitylove interestvigilanteclass differencesgraffitinewspaper headlinekillingsingle parentmaniacriotinterracialapplausetv newslive broadcastanswering machinemedicinerevelationstreetheavy rainlooking at oneself in a mirrorsociopathfameragevandalismkicked in the stomachassaultmovie theaternosebleedvideotapeblockbusterimpersonationphone boothpsychotv showrape victimfollowing someoneschizophreniasocial commentarymasked manmale underwearblack womanapartment buildingmental institutionrampagedwarftensionface paintsufferingcynicismblood on facehatredkickingmercilessnessironychaosdiscussionrejectionstabbed in the neckmillionairemental hospitaldelusionescape attemptscissorsmedicationbutlerlaughteraccidental killingsocietyrefrigeratortuxedostabbed in the eyelonerdark pastdressing roomsocial workeropening a doorexistentialismbriefslaughingalienationdc comicsswearingcrowdpsycho killermedia coveragepiano playerserial murdervillain played by lead actorsuffocationmental patientmagic trickface maskalleynotebookoutcastdark secretstreet gangmoney problemsmental breakdownspiral staircasesubway stationjournalsuit and tiepiano playingstaircasestrikecheering crowdself defensehospital roomflareurban decayinsane asyluminterracial kissanarchynarcissismstrokeadopted sonnihilismstrong languageman kills a womanoffscreen killinggun violenceafrican american womanmale protagonistaltered version of studio logowhite briefstv studiofilmed killingalter egodeath of familybus ridematricideradio newsbloody violenceloss of familyhoodiecockney accentpsychotronic filmunwanted kissgarbage canreference to batmanweight lossfinger gunsocial decayevil clownextreme close upfictional citystabbed with scissorsstreet vendorabusive motherdeeply disturbed persontragic villainsubway traintv hosttalk show hostreading a lettermental asylumkiller clownmass mediamental disordermoral ambiguitycriminal mastermindel trainapplying makeupcomedy clubstreet performertelling a jokegreen hairburning carfictional talk showsick motherbad mothersmileanti villainhospital visitclown makeupsupervillaininfamybleeped dialoguefemale psychiatristpsychological tormentnickname as titlecharity benefitgarbage bagson murders motherjokerblood on walldancing in the streetorigin storyirrational behaviorsmothered with a pillowstrange behaviorsiren the alarmbanging head against wallquestioned by policeurban violenceill motherbad guy winsclown maskfighting the systemfalse friendcivil unrestback alleycriminally insanepublic transportinner conflictsocial unresttrash bagbloody footprintdysfunctional societymayoral candidateviolent outburstchildren's hospitalpsychological disorderarkham asylumdriven insaneopening creditspublic transitstreet riotlife of crimegotham cityhappy faceexit signkiller as protagonistsubway ridevillain as protagonistco worker co worker relationshipkilling a ratblood spattered faceerratic behaviorsad clownsubway platformsympathetic villainthe jokerwhite paintaccidentally firing a gunhit by a taxireference to wall streetuncontrollable laughterurban decadencedysfunctional personmass protestmurderer as protagoniststreet trashtrash can (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Closer (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Closer (2004)

Smart-but-ineffectual journalist Dan "We use euphemisms!" cannot decide between his girlfriend, loving-but-clingy waitress Alice, or his lover cold-but-intellectual photographer Anna; herself indecisive between Dan and honest-but-thuggish "You're bloody gorgeous!" doctor Larry. The film puts the fou β€¦r leading characters in a box and strips them apart. (Read More)

Subgenre:
independent filmmelodrama
Themes:
wealthdeath of motherdeath of fatherobsessionrevengemarriageinfidelitymoneybetrayaljealousyadulteryextramarital affairangerdivorce β€¦depressionguiltunfaithfulnessdatingrivalryphotographytheatrebreak upforgiveness (See All)
Mood:
rainambiguous ending
Locations:
hotelhospitalnew york citybarrestaurantbuslondon englandtaxiairportelevatorstrip clubtaxi driver
Characters:
writerhusband wife relationshipboyfriend girlfriend relationshipdoctorchildrenprostitutepolicemandancerphotographerlove trianglewaitresslustamericancheating on girlfriend
Story:
men's bathroomchance meetingvacationbathroomcar accidentfemale frontal nudityfemale nuditybloodone word titleflashbacksex scenekisscigarette smokingdancingphotograph β€¦pantiesbased on playcryingmirrorface slapslow motion scenecomputercamerathongbooklietearsbirthdaycafemanhattan new york citystrippercleavageoperajournalistbrainternetnonlinear timelineapologyscantily clad femalehit by a carbartenderflash forwardparkportraitmistaken identitywigstalkingcheating wifegirl in pantieseyeglassesshavingteadesirenipples visible through clothingballoonslow motionsexual attractionhappinesssecurity cameradysfunctional marriageimpersonationart galleryfollowing someonepassportphoto shootsufferingsurveillance camerabreakupunfaithful wifesex talklove at first sighttheatre audienceaquariumrosedivorceesurgeonpatriotismpractical jokeadulterous wifespit in the facepostcardexotic dancerpublisherphysicianeditorselfishnessfilm cameraemergency roomtimes square manhattan new york citymanuscriptdialogue drivenmemorialschizophrenicleg injuryexpatriatecustomsscreenplay adapted by authordouble decker busobituarycompanionfemale photographerpersonal adcybersexchat roomnipple slipexhibitpole dancefilm with ambiguous titleinstant messagingsextingriver thamesdialogue driven storylinedressing gowncompromiseintimatelinguistmedium format cameralove quadranglephoto exhibitinternet sexlondon bustheatre lobbymale slaps femaleinternet chatroompedestrian crossingdermatologistdeviousnessleica cameramuseum of modern art manhattan new york citybpd (See All)

Nocturnal Animals (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Nocturnal Animals (2016)

A "story inside a story," in which the first part follows a woman named Susan who receives a book manuscript from her ex-husband, a man whom she left 20 years earlier, asking for her opinion. The second element follows the actual manuscript, called "Nocturnal Animals," which revolves around a man wh β€¦ose family vacation turns violent and deadly. It also continues to follow the story of Susan, who finds herself recalling her first marriage and confronting some dark truths about herself. (Read More)

Subgenre:
suspenseindependent filmmelodramapsychological thriller
Themes:
psychopathmurderdeathloverevengekidnappingmarriageinfidelityrapefeardrunkennessescapedeceptionrobberyextramarital affair β€¦angerdivorcebrutalityparanoiacancerredemptiongriefhumiliationsadismdeath of wifepanicabortionjusticepolice brutalitydeath of daughtermurder of family (See All)
Mood:
neo noircar chase
Locations:
bathtubhotelnew york cityrestaurantsnowlos angeles californiadesertelevatorpolice stationpolice carroad tripmoteltexascar theftcar thief
Characters:
writermother daughter relationshipfather daughter relationshiphusband wife relationshipfamily relationshipshomosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlpolice officerdetectivehostageartist β€¦police detectiveex husband ex wife relationshipolder woman younger man relationshippolice lieutenantself inflicted gunshot wound (See All)
Period:
2010s
Story:
family vacationmurderervacationcar accidentcorpsecell phonefemale frontal nudityfemale nuditynuditybloodbased on novelmale nudityviolenceflashbackbare chested male β€¦gunfemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterpartyknifesurprise endingpistolshowershot to deathblood splattershot in the chestslow motion scenepunched in the facewritten by directorarrestbrawlpaintingshowdownheld at gunpointinterrogationhandcuffscriminalshot in the backf wordgay slurgangmansionwomanmontagedinertoiletnonlinear timelinechild in perildouble crossauthordangerbusinessmandeath of childmanipulationscarhairy chestlaptopshot in the armchild murderterminal illnessfireplaceheavy rainlooking at oneself in a mirrorsociopathscene during opening creditscowboy hatloss of wiferape victimart gallerycrying manrapisthitchhikerhitchhikingretirementredneckwoman in jeopardystealing a carcynicismunfaithful wifehatredmercilessnesstitle appears in writingnovelistescape attempthit on the headaerial shotlipstickmustachetrailernude woman murderedmoral dilemmaflat tiresouthern accentmale in showertext messagingman cryingmale objectificationfinal showdownspit in the facenoveldefecationloss of daughterfarmhousetrailer homedomineering motherinsomniaman kills a womanreading a bookplumbermanuscriptenglishmandeath of familycamera phoneloss of familygang memberoverbearing mothergang leaderdreadlocksex wifefreewaybritish actor playing american charactertrailer trashpolice vigilantismlung cancerelectriciantire ironpolice lineupex husbandart shownaked manboardroomart installationinsomniacstory within a storystanding in the rainstood uprunning a car off the roadno cell phone signalpaper cutoutdoor toiletsitting on the toiletstood up for dinnerstuck in the middle of nowheregallery owner (See All)

Bride Of Chucky (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bride Of Chucky (1998)

Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.

Subgenre:
black comedycult filmconspiracysupernatural
Themes:
psychopathmurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfearescapeweddingdeception β€¦seductionrobberybrutalitysupernatural powerparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All)
Mood:
high schoolgorecar chaseslasherpoetic justice
Locations:
bathtubhotelcemeterywaterkitchenpolice stationpolice carroad tripmotel
Characters:
serial killerhomosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepriesthostagethiefpolice detective β€¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All)
Period:
1990s
Story:
multiple murderchildbirthscreamingargumentcoffindead bodycar crashcar accidentcorpsecell phonechasecharacter name in titlebloodsexviolence β€¦sequelbare chested malegunkissfightcigarette smokingphotographknifesurprise endingpistolfirecryingbeatingshot to deathblood splattermirrorshot in the chestrescueslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musicmarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushstrangulationmansionmontagethroat slittingbridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonedrawinghit by a cardouble crossritualpolice officer killedvanfemme fatalegraveyardnews reportmarriage proposalon the runattempted murderstalkercharacter repeating someone else's dialoguedangerstabbed in the backlocker roomelectrocutionpay phonefugitiveumbrellarace against timedollknocked outbaseball batlightningskeletonringscarfishnet stockingsstalkingfilm within a filmexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated lineamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Kite Runner (2007) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Kite Runner (2007)

In the 70's in Afghanistan, the Pushtun boy Amir and the Hazara boy Hassan, who is his loyal friend and son of their Hazara servant Ali, are raised together in Amir's father house, playing and kiting on the streets of a peaceful Kabul. Amir feels that his wise and good father Baba blames him for the β€¦ death of his mother in the delivery, and also that his father loves and prefers Hassan to him. In return, Amir feels a great respect for his father's best friend Rahim Khan, who supports his intention to become a writer. After Amir winning a competition of kiting, Hassan runs to bring a kite to Amir, but he is beaten and raped by the brutal Assef in an empty street to protect Amir's kite; the coward Amir witness the assault but does not help the loyal Hassam. On the day after his birthday party, Amir hides his new watch in Hassam's bed to frame the boy as a thief and force his father to fire Ali, releasing his conscience from recalling his cowardice and betrayal. In 1979, the Russians invade Afghanistan and Baba and Amir escape to Pakistan. In 1988, they have a simple life in Fremont, California, when Amir graduates in a public college for the pride and joy of Baba. Later Amir meets his countrywoman Soraya and they get married. In 2000, after the death of Baba, Amir is a famous novelist and receives a phone call from the terminal Rahim Khan, who discloses secrets about his family, forcing Amir to return to Peshawar, in Pakistan, in a journey of redemption. (Read More)

Themes:
poetrydeath of motherdeath of fatherfuneraldeathfriendshipmurderlovemarriagerapereligionmoneybetrayalpoliticsdrinking β€¦escapeweddingmemorytraveltheftredemptionguiltillnessabuseexecutionhopechildhooddyingjusticecourageforgivenessrevolutiondeath in childbirth (See All)
Locations:
hospitalbarsnowcemeterytaxiairporttaxi driversan francisco california
Characters:
writerbabyfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipschildrensingerbrother brother relationshipboydancerreference to god β€¦bullylittle boymuslimrussianuncle nephew relationshipsingle fatheraunt nephew relationshiprussian soldier (See All)
Period:
1980s1970s2000s
Story:
mobile phonepoemchildbirthpursuitreadingcoffinbathroomchasebloodsexbased on novelviolenceflashbackdoggun β€¦kisscigarette smokingdancingphotographsingingpartythree word titletelephone callcryingsongbeatingshot to deathfoodmachine gunmirrorsecretletterbooklieriflebeertearsbombrunningbirthdayprayerorphansoccerbandold mancaliforniamountainimmigrantdinnerchild abusefalse accusationbirthday partycontroversysearchgraveyardold womanpainflash forwardtreeauthorliarstorytellingsuitcasetankflowersspeechcontestwitnessloss of mothergeneralfireworksrefugeetypewritersingle parentpickup trucktearevelationlawsexual abuseislamcommunistwatching a movieservantbrideorphanagehonorgoatstreet lifemovie theatreshoesinvasionsmugglingkickingbutcherdespairafghanistantheatre audiencebribefriendship between boysvoice over lettersnowingstadiumsodomypigeonwedding receptionphoto albumsinshamegraduationwedding ceremonystreet marketborder crossingpakistanwatchmale rapesmugglerlistening to a radioquitting a jobkitekindnessmosquegroomslingshotford mustangreading a newspaperradio newsmorphinechild rapecourtshipfleeingtalibansurrogate fatherillegitimate sonhappy birthdayturbanmirror ballcrutchstorytellerfake beardauthor cameotypingaudio flashbackreference to allahflea marketafghan warbazaarkite flyinglearning to readsurrogate soniciclefootbridgeboyhood friendcommunity collegestepbrotherstoningoutdoor cafeafghancollege graduationburqachaperonetanker truckhuman smugglingsurrogate brotherdishonorpomegranatemullahsellingkabul afghanistanrumisoviet invasionpashtuncarving into tree barkreckoningstoned to deathbuzkashione leggedhazarapeshawar pakistanfuel truckwuthering heights (See All)

Wedding Crashers (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wedding Crashers (2005)

Two friends, John (played by Owen Wilson) and Jeremy (Vince Vaughn), crash weddings to pick up women. One day they crash the wedding of the daughter of the Treasury Secretary, Secretary Cleary (Christopher Walken). Instead of short-term flings they end up being invited to the Clearys' island estate, β€¦ and potentially meet the loves of their lives... (Read More)

Subgenre:
screwball comedy
Themes:
death of motherdeath of fatherfuneralfriendshipdeathmarriageinfidelityrapechristmasadulterydrinkingweddinginvestigationseductionextramarital affair β€¦angerdivorcedepressionredemptionguiltunfaithfulnessdatingillnesshuntingdeath of best friend (See All)
Locations:
hotelbeachtrainchurchcemeterybicycleyachtwedding party
Characters:
grandmother granddaughter relationshipgirlfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfamily relationshipshomosexualtattooboyprostitutedancerlawyer β€¦sister sister relationshipbest friendreference to godlustasianmaidolder woman younger man relationshipfiance fiancee relationshipjewish weddingcheating on one's girlfriendfather daughter dancetattoo on lower back (See All)
Period:
2000s
Story:
diarrheareadingchampagnescreamingargumentcoffinbathroomfemale frontal nudityfemale nuditymale nuditymasturbationmale rear nuditybondagekissfemale rear nudity β€¦dancingpartyleg spreadingpantiestelephone callfondlingcryingbeatingunderwearfoodblondepunched in the facedrinkbare buttletterpaintingbookvomitinglieriflebeerbirthdaylingeriebedsex standing upvoyeurprayercleavagegay slurflashlightbandmontageeatingpoliticiantoiletapologychildpainterscantily clad femalebreast fondlinggraveyardcigar smokingold womanmarriage proposalconfessionmicrophonevirginliarmini skirtpoisonstorytellingflowersconvertiblefemale removes her clothespremarital sextied upredheadwashington d.c.private detectiveflirtingwaiterballoonred dresstied to a bedamerican footballassaultblockbusterimpersonationirishtennisskateboardwomanizercompassionbreakfastwatching televisionbuddhistbloody nosehypocrisyministerimpostorgunshot woundlove at first sightbutlergay sonarizonadeceitvegetarianthirty somethingbettuxedofamily dinnerduct tapeethnic slurferrysports carwedding receptionfast motion scenechauffeurdrugged drinkpervertmagic trickcartoon on tvpromiscuous womanhiding in a closetpink pantiesremorseblue pantiessailboatsailingphone sexmedalrabbiimaginary friendkittengiving a toastimmaturitywhite trashcathedralcrotch grabmartyrbachelor partyhypocritespitting bloodunwanted kissman childrehabbride and groomu.s. senatorwedding cakewoman initiating sextantrumgross out humorsleeping bagimpersonatorbridesmaidmarylandvermontrole modelreference to oprah winfreycountry estatesalt lake city utahhouseguestreference to the biblenew hampshirebullfighterpink bradenver coloradobest manmultiple cameossocksuicide contemplationengagement partytourette's syndromeboat ridetaxesklingonsex montagefrat packlaxativeblue brashot in the buttcatch phraselesbian slurreference to franklin d. rooseveltsavanthang glidingsteroidfamily treeparty crashingchastitytwisted ankledrum setkiwieye dropspromiscuous daughterwatching a cartoon on tvdry humpinghead in toiletkneed in the crotchpurple hearthail marynunchucktasmanian devilenvironmental groupsucker punchoatmealpublic break upflower vendorreference to the dalai lamabreast examinationreference to eleanor roosevelttantrawedding bouquetwedding guestflower girlsyrupreference to jodie fosterwedding giftquailadult living with motherballoon animalmicronesiamaple syruplincoln memorial washington d.c.mazel tovbroken marriage engagementknee woundtouch footballsconewashington monument washington d.c.wedding crasherblazerpulling tablecloth from under dishesreference to carrot topsemanticstackling someonehand on man's crotchjewish templemeatloafbaseball on tvfalse virginityflower marketorthopedistscalloptempuraventure capitalist (See All)

Grave Of The Fireflies (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grave Of The Fireflies (1988)

The story of Seita and Satsuko, two young Japanese siblings, living in the declining days of World War II. When an American firebombing separates the two children from their parents, the two siblings must rely completely on one another while they struggle to fight for their survival.

Subgenre:
tragedysemi autobiographical
Themes:
death of motherdeath of fatherfriendshipdeathsurrealismmoneyghostfearmemoryrobberylonelinesstheftillnessdyinghomelessness β€¦starvationradiation (See All)
Mood:
nightmarerainanime
Locations:
bathtubhospitalbeachtrainschoolcemeteryairplaneboatbicyclewaterjapanshiptruckstormtrain station β€¦fire station (See All)
Characters:
girlfriendmother daughter relationshipfather daughter relationshipfather son relationshipmother son relationshipfamily relationshipsteenagerdoctorchildrensingerboybrother sister relationshipteenage boyphotographer β€¦thiefjapanesemothercousin cousin relationshipaunt niece relationshipaunt nephew relationshipjapanese soldier (See All)
Period:
world war two1940syear 1945
Story:
diarrheacremationswingreadingbathdead bodycorpsebloodbased on novelflashbackphotographexplosionsingingthree word titlebased on true story β€¦firevoice over narrationcryingsongbeatingfoodhorseurinationcatcameraundressinglettertearsbombrunningneighborswimmingsurvivalorphanbandeatingsubwayapologybirdgraveyardgravetreeattackumbrelladolldeath of childringfarmercountrysideflowersleepingfireworksrecord playersisterdisastericedestructionmedicineinjuryrecordingtold in flashbackstealingfrogtorchburialjanitortokyo japaninnocencebombingshoesfanhungerinsectscissorsdead childdaydreamdeath of sisterraidmineduckhorse and carriagepumpkinpost world war twocandyanti warruinsbandagebugelementary school14 year oldemperorseagullclimbingflypursestretcherantmailboxkimonoashestomatowatermelonair raidin medias ressurrendergymnasticspotatoburn victimorganshelterfleeingphonographtoothbrushstrawberrybroomfloodingricewagontantrumbucketwashingmosquitowashing dishesdeath of parentemaciationcartabandoned minebomb shelterjapanese armyleechstovefireflyimitationcuttingolder actors younger roleshummingmelonplayingmalnutritionmarblesibling relationshipgrapepiggy back ridefirst aidjapanese flagdebriskamikazemale tearswartimerailroad stationfirebombcombcartwheelimperial japannoodlesrationingstrawbutterrashacid raincharcoaltin canradiation poisoningburning a dead bodybeanstalkheart troubleself sufficiencyfallout shelterstrafinghorrors of warsandboxwater canteenwadingmintfirehouseherringplumjapanese navykobe japanhair clipworld warribcageolder brother younger sisteremperor of japanbroken water pipeimitating the firing of a gunmosquito nettingshovelling (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Guest (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Guest (2014)

Subgenre:
suspenseblack comedyindependent film
Themes:
death of motherdeath of fatherpsychopathmurderdeathfriendshiprevengebetrayaldeceptionblackmailgriefbullying
Mood:
high schoolcar chase
Locations:
rural settingbarrestaurantsmall townfarmfire truck
Characters:
mother daughter relationshipfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsteenagerafrican americanboyfriend girlfriend relationshipbrother sister relationshipteenage boytough guybullywaitressex soldier β€¦military police (See All)
Story:
car crashcorpsebloodviolencebare breastsbare chested malesex scenekisscigarette smokingphotographexplosionpartyknifesurprise endingpistol β€¦fireshootoutwoman on topbeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facewatching tvarrestbrawlbeermarijuanaclassroomrevolvershot in the backf wordsubjective camerahalloweengay slurflashlightstrangulationambulancedeath of frienddrug dealerthroat slittingstabbed to deathdinerstabbed in the chestno opening creditsone man armydouble crossshot in the legshot in the foreheadbartenderone against manycharacter repeating someone else's dialoguestabbed in the backhalloween costumeshot in the shoulderdeath of brotherhigh school studentdeath of sonlaptoppremarital sexsuspicioncharacter says i love youmercenarykissing while having sexnewspaper headlinepickup truckpot smokinggrenadeelectronic music scorejoggingnosebleedstrangerfaked deathfollowing someonefalse identitybar fightbroken legstealing a carbloody noseguestunderage drinkingstabbed in the neckpost traumatic stress disorderspecial forcesstabbed in the legjumping through a windowassault rifletitle at the endcellphonebruisekilling spreehalloween partyframed for murderfirefighterberettabeing followedshot through a windowvillain played by lead actorharassmentmysterious manshot in the neckmazehomagearms dealermajorbully comeuppancemedalcdcrashing through a windowscarecrowexperiment gone wrongshot in the foothiding under a bedoverhead camera shotdetentionvillain not really dead clichebreaking a bottle over someone's headman with no namejack o'lantern555 phone numberescaped mental patientwoman wearing black lingeriejob promotionprotective malestrobe lightdog tagquarryrunning for your lifebritish actor playing american characterhundred dollar billshot through a wallbalisonghigh school principaldrink thrown into someone's faceclotheslinepumpkin carving20 year oldhalloween decorationfalse accusation of murderbeer kegman wearing a towelhomemade haunted house attraction360 degree well shothall of mirrorsunderground parking garagebloody footprinthead on collisionneo 80scrawling on the floorface spattered with bloodbashing someone's head into a wallchained doorhit with a pool cuecosmopolitan the drink (See All)

10 Cloverfield Lane (2016) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

10 Cloverfield Lane (2016)

After a car accident, Michelle awakens to find herself in a mysterious bunker with two men named Howard and Emmett. Howard offers her a pair of crutches to help her remain mobile with her leg injury sustained from the car crash and tells her to "get good on those" before leaving the bunker. She has  β€¦been given the information that there has been an alien attack and the outside world is poisoned. However, Howard and Emmett's intentions soon become questionable and Michelle is faced with a question: Is it better in here or out there? (Read More)

Subgenre:
suspenseblack comedyconspiracypost apocalypsepsycho thrillerpsychological thriller
Themes:
murderdeathkidnappingbetrayalfearescapemonsterdeceptionmemoryangerparanoiabreak uppanicapocalypsecourage β€¦self sacrificenear death experienceregretalien abduction (See All)
Mood:
darknessnightambiguous ending
Locations:
rural settingcarwaterkitchenapartmentfarmtruckgas stationusashed
Characters:
female protagonistalienhostageex military
Period:
2010s
Story:
hitchcockianeccentricmagazinereadingscreamingargumentdead bodycar crashcar accidentcorpsecell phonechasebloodnumber in titlesequel β€¦flashbackbare chested malegunphotographexplosionknifethree word titlesurprise endingpistolshowertelephone callfiredigit in titleshot to deathfoodshot in the headslow motion scenewatching tvbrawlsecretbookliebeersecond partbedinterrogationneighborhandcuffsrevolversurvivalflashlightambushwomanmontagebridgetoiletstabbed in the chestmapaccidentfishdinnerexploding cardrivingno opening creditsbirdradiodisarming someonedrawingdouble crossspaceshipcreaturenews reportgunshotcharacter repeating someone else's dialoguedangerkeyattackmissing persontough girllightningscreammanipulationscarstalkingthreatpigbasementsuspiciondie hard scenariothreatened with a knifedirectorial debutufoarsonstrong female characterpickup truckanswering machineburned aliverevelationspearheroinebeer drinkingsociopathbarncaptivebeardspacecraftwatching a movievideotapeladderstrong female leadpuzzletorchend of the worldschizophreniasocial commentarybroken legfemale warriorgas maskwatching televisioncamera shot of feetredneckwhiskeyalien invasionbarefootwoman in jeopardydamsel in distresstensionbraverycynicismconfrontationnew orleans louisianadeath threattitle appears in writingescape attemptscissorscigarette lighterpedophileaerial shotdisfigurementbarefoot femalebroken armduct tapeburned to deathgunfiresmokemoral dilemmavodkaclose up of eyesmolotov cocktailminimal castlouisianadead animalmisogynistscene before opening creditshuman monstermetaphorcrutchesdvdalarmwalletblackoutjukeboxacidcamera shot of bare feetdisposing of a dead bodyvacuum cleanerfarmhousebunkerearringfish tankburnt facegoldfishmind gamecornfieldone linerbaseball captentaclefemale herohead injuryoffscreen killingheld captivelocked doorvhsgasorchestral music scorealien contactcar radiooverhead camera shotchild molesterboard gameexploding shipdistrustsubterraneanwatching a videoradio newssole survivorpsychotronic filmimprovised weaponschizophrenicdriving at nightbreaking a bottle over someone's headvideo cassetteleg injurysecret roomarm slingcat and mousevinyldeeply disturbed personcontaminationkeysdoomsdayreference to santa clausdinner tablerunning for your lifepsychological manipulationconspiracy theoristcar keyssnorricamhazmat suitpadlockabandoned carhidden truthjigsaw puzzlesingle set productionleg bracepoison gasruralambiguitybeer bottlebomb shelterham radiovhs tapestreet in titleanti villainreference to paris franceaddress as titlecar alarmwater bottlebiohazardunconsciousyelling for helpword gamematcheswatching a movie on tvair ventsurvivalisthandcuffed to a pipesmart phonefeature film directorial debutintravenousstitchesbox cutterliquid nitrogenshower curtainunderground bunkernight drivingcharadesfalloutdreadmonopolytoolboxchemical weaponslocked roomclaustrophobicchemical weaponamateur radioairlockmatchbookdead pigface burncontainmentinjured legreading a magazineargument between couplematchboxdown blouseemergency broadcast systemself sufficiencyfallout sheltershort term memory lossfashion designstitching a woundmatchstickreference to al qaedaunidentified flying objectwhiskey bottleanimal carcassbus ticketelectrical fireshort term memoryparanoid schizophrenicacid burnex navygas attackopening creditssingle settingbaton rouge louisianaforehead cutfrancophileman shoutingwatching a video on tvcar keymonopoly gamethreaten to killegg timerinjured womanplaying a gamepain medicationplaying a board gamereading magazinewhite lightiv linepuzzle piecereference to houston texasrunning from dangerwoman using crutches55 gallon drumshared universe (See All)

Hesher (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hesher (2010)

T.J., a high school freshman, lost his mother two months before in a car accident: his father pops pills and sits on the couch; his grandmother holds things together, chatting and cooking. T.J. wants the car back from the salvage yard where the owner's son is a bully. By happenstance, Hesher, a foul β€¦-mouthed squatter, moves in with T.J's family. T.J. also meets Nicole, a grocery clerk near poverty who helps him once. Hesher involves T.J. in crime, the bully is omnipresent, mom's car is slipping away, dad has checked out, T.J. watches Nicole at work, and his grandma invites him to join her morning walk: the odds are long that T.J. can assemble a family to help him thrive. (Read More)

Themes:
death of motherfuneralfriendshipdeathmurderrevengerapemoneyjealousydrinkingmemorydepressiondrug usegriefbullying β€¦home invasiondeath of wifehomelessnessdeath of daughtermurder of daughter (See All)
Mood:
high schoolraincar chase
Locations:
bathtubschoolswimming poolcarbicyclesinging in a carcar firebicycle accident
Characters:
friendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationshippolicedoctortattoosingerteenage boyteacherpolicemanbullyuncle nephew relationship β€¦older woman younger man relationshipgrandmother grandson relationshipfuneral director (See All)
Story:
death of grandmothertow truckreckless drivingpursuitbathcoffincar accidentchasecharacter name in titlebloodviolenceone word titleflashback β€¦masturbationbare chested malesex scenefightcigarette smokingfingeringphotographexplosionsingingtelephone callfirecryingsongbeatingunderweartesticlesfoodurinationrescueslow motion scenepunched in the facewatching tvdrinkarrestundressingfalling from heightvomitingliebeertearsrunningmarijuanajailreference to jesus christclassroomguitarf wordswimminggangstrangulationeatingsnakeapologyvanold womanpainprologuesuburbliarstorytellingflowersstalkingdirectorial debutloss of motherclasssleepingobscene finger gesturetherapyarsonpizzatwenty somethingeyeglassesanswering machineshavingpot smokingbreaking and enteringlistening to musicwoman with glassesmousevandalismguitaristhidingloss of wifefollowing someonemilkremote controlgrocery storebloody nosepillssufferingboxer shortsconstruction sitekicked in the crotchscissorscigarette lighterfrustrationraised middle fingerbriefssports carparking lotbeing followedbongjunkyardmetaphorwalletlooking out a windowabandoned houseclimbing through a windowgroup therapymisfitbreaking a windowurinalwalkingsurrogate mothermugshotteenage crushwashing machinehoodiesquattermentor protege relationshipice cream conesing alongthreat to killcaught in the actautomated teller machinejoke tellinglooking in a windowbloody mouthbreaking a car windowstained glass windowransackingcounselingarsonistbrokewashing clothesmalnutritionspitting on someonediving boardarm castbelchingmale with long hairdestruction of propertyclimbing a fenceboys' bathroomheadbangerwatching a porn videojumping into a swimming poolderelictfelonyface woundheavy metal musicpushed into a swimming poolanti social behaviorkilled in a car accidentreference to metallicafingerprintinglawn chairlistening to a car radioarm in a castgas canbad influencebrushing one's teethhit by a vanpeanuthouse for salechoking someonethrowing a stone at a windowsetting a car on firetraffic ticketrear ending a carthrowing a chairlead pipemagic markerpabst blue ribbon beerreading a porn magazineself medicationselling a carautomobile graveyardbicycle lockgrocery store clerktin snipsauto insurancedamaged carreference to r2d2reference to motorheadwatching a porn video on tvclimbing a polegrief therapyobscene drawingkicking a carsitting in the darkwitness to sex (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Bucket List (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Bucket List (2007)

Corporate billionaire Edward Cole and working class mechanic Carter Chambers have nothing in common except for their terminal illnesses. While sharing a hospital room together, they decide to leave it and do all the things they have ever wanted to do before they die according to their bucket list. I β€¦n the process, both of them heal each other, become unlikely friends, and ultimately find joy in life. (Read More)

Subgenre:
black comedy
Themes:
obsessionfuneralfriendshipdeathlovesuicidemarriagemoneydrinkingcancerillnessfaithdyingphilosophy
Locations:
bathtubhospitalrestaurantairplanelos angeles californiataxiroad tripcourtroomafricaroad movie
Characters:
grandfather granddaughter relationshipfriendfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipfamily relationshipsdoctortattoosingerprostitutenursereference to godex husband ex wife relationshipgrandfather grandson relationship
Story:
cremationmobile phonechampagnedead bodycorpsecell phoneguncigarette smokingphotographsingingthree word titletelephone callvoice over narrationcryingsong β€¦mirrorwatching tvlettervomitingtearscafeprayerorgyold manmountainno opening creditsanimalroommatejourneyold womancoffeelimousinehotel roomprologuebusinessmantentflowerscourtterminal illnesssurgeryhypodermic needletold in flashbackhong kongelephantmale bondinginterracial friendshipmechanicbuddyegyptmillionairecard playinglaughterlionparachutebelief in godvoice over letterfamily dinnermarital problemviolinistearphoneshomecomingstreet marketrace carbillionaireno title at beginningbubble bathpyramidbleedingbeliefauto mechanicashesgurneytibetfirst person narrationcar racingcoughing bloodprivate jetreturning homeceomountain climbingmortalityracetrackbrain tumorchemotherapyskydivingsurgical operationfather daughter reuniontriviabuddy moviewish fulfillmentcairo egyptbrain surgeryreference to oprah winfreyeulogyzebranarration from the gravereference to walt disneytanzaniahospital visitsafarihimalayasbumper cartaj mahallistshaving headmount everesttoilet bowlgreat wall of chinamile high clubbusiness meetingcaviarmedical treatmentjohannesburg south africamountain climbercollege dropoutelderly protagonistsavannahto do listblack white relationsreference to nikola teslafrench rivieraelectric razortin canabused wifecote d'azurwealthy manoncologistreference to chuck berryreference to michelle pfeiffercathetergin rummygreat pyramidreference to herbert hooverlife expectancythings to do before you dietv quiz showreference to spiro agnewveldtaperitiflegal hearingmalignant tumorreference to marconi (See All)

The Air I Breathe (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Air I Breathe (2007)

A frustrated and clumsy bank clerk overhears the conversation of three coworkers in the toilet about a fix in a horse race, and bets a large amount. He loses the bet and owes the money to the dangerous and powerful mobster Fingers. A gangster who works for Fingers has the ability of foreseeing piece β€¦s of the future; he is assigned to collect money for the boss, with his troublemaker nephew Tony, and is beaten up by a gang. The manager of pop-star Trista loses her contract to Fingers without her agreement and she is threatened by the gangster. A dedicated doctor seeks a blood donor that might have a rare blood type to save the life of his secret and unrequited passion, a beautiful epidemiologist who's married to a friend. (Read More)

Subgenre:
independent film
Themes:
death of fatherdeathmurderfriendshiplovesuicidemoneypregnancydrinkingtorturedrunkennessgangstertheftbrutalitygambling β€¦sadismunrequited lovehome invasionabortionobsessive compulsive disorder (See All)
Mood:
nightmarerainneo noirdancing in the rain
Locations:
helicopterhospitalbarrestaurantbusairporturban settingpolice carofficerooftopstrip clublaboratory
Characters:
girlfriendfather daughter relationshiphusband wife relationshippolicedoctorsingerboyprostitutenursepolicemandancerphotographerthieflove triangle β€¦sniperolder man younger woman relationshipuncle nephew relationshipdeath of boysuicide by jumping off a building (See All)
Period:
seeing the future
Story:
men's bathroomreckless drivingmobile phonepursuitbathroomcar accidentcell phonechasefemale nuditybloodsexviolenceinterviewflashbackgun β€¦kissfightcigarette smokingdancingphotographsingingpantiespistolvoice over narrationsongbeatingshot to deathunderwearhorsemirrorshot in the chestslow motion scenepunched in the facewatching tvcameradrinkfalling from heightshootingrifleheld at gunpointrunninglingeriecafeclassroomstrippershot in the backfoot chasebrabound and gaggedgangconcertmontagesuicide attempttied to a chairsnakenonlinear timelineman with glasseshit by a caron the runflash forwardorganized crimecharacter repeating someone else's dialoguebusinessmanpoisonumbrellamassagedebtkicked in the facedeath of childbankshot in the shoulderscardeath of brothersadnessmanagercharacter says i love youbank robberyclasspsychicfreeze framehenchmancrime bossdestinyhead buttlooking at oneself in a mirrorlistening to musichappinessloss of loved onekicked in the stomachswat teamdesperationhome moviepop starstreet liferemote controlswitchbladenicknamebloody nosesevered fingerattempted suicidebackstagekickingpunched in the stomachco workermentorensemble castbutterflybettuxedodressing roombriefcasefast motion scenejoysaving a lifebag of moneyalleyfire extinguisherhead woundstairwayautographgun held to headyoung version of characterbank robberstretcherpremonitionstreet fightcdman punching a womanslot machinefinger cut offtv studiodesksorrowhorse racefictional reality showpleasuregambling debtbreaking through a doorsnake biteclothing storeclairvoyantflash cameramentor protege relationshipwoman wearing black lingeriefalling off a roofpredictioncut armplastic surgeonblood transfusionwhorehousebrass knucklesbitten on the armfictional tv showhead bandageinterlinked storiesclairvoyancemedical researchprotegehit with a frying pancollege friendvenomfilm starts with quotereference to moby dickeurocopter as350 squirrelclimbing over a fence360 degree well shotcanned foodhiding in a bathroomhit with a metal pipebegins with a quotefull circle4 storiesbegins with a quotationdriving in the wrong directionlovelorncarrying a womanhush moneyblood typewatching a music video (See All)

The Boy In The Striped Pajamas (2008) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Boy In The Striped Pajamas (2008)

Young Bruno lives a wealthy lifestyle in prewar Germany along with his mother, elder sister, and SS Commandant father. The family relocates to the countryside where his father is assigned to take command a prison camp. A few days later, Bruno befriends another youth, strangely dressed in striped paj β€¦amas, named Shmuel who lives behind an electrified fence. Bruno will soon find out that he is not permitted to befriend his new friend as he is a Jew, and that the neighboring yard is actually a prison camp for Jews awaiting extermination. (Read More)

Themes:
death of motherfriendshipmilitaryillnessexecutionholocauststarvation
Mood:
rain
Locations:
traincemeterybicyclekitchennazi germany
Characters:
grandfather granddaughter relationshipgrandmother granddaughter relationshipgirlfriendfather daughter relationshipmother daughter relationshiphusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsdoctorchildrensingerboybrother sister relationship β€¦dancerjewishlittle boymaidjewgermangrandfather grandson relationshipgrandmother grandson relationshipgerman soldier (See All)
Period:
world war two1940s
Story:
death of grandmothercrematoriumswingmagazinereadingbased on noveldogbare chested malecigarette smokingdancingsingingpartyshowertelephone callcrying β€¦songbeatingfoodundressingsecretbooklietearsrunningneighborprayersubjective cameranewspaperflashlightwinebandeatingprisonerdrawingsearchgraveyardnecklacetreemicrophoneliaruniformcharacter's point of view camera shotdolldeath of childfilm within a filmsix word titleberlin germanyeyeglasseswatching a moviedysfunctional marriageservantguardanti semitismchild's point of viewshovelconcentration campblack eyefriendship between boysfamily dinnerswitzerlandbarbed wirehandshakeboredomsandwichswastikagerman shepherdreading aloudblonde womanfencedeportationdiggingnaivetywhisperinglistening to a radiobare chested boylistening to radiotutormilitary uniformmoving inlighting a cigaretteknittingssbow tieclimbing out a windowleg injuryguard dogovenfuneral processiongerman armywheelbarrowemaciationlost childpoison gaschimneygas chamberinnocence losttennis racketcrime against humanityeight year oldnazi concentration campwar gameslow dancingheil hitlertoy airplaneanti nazipogromexploringwashing carfuneral cortegegender in titletree swingguard towerhorse drawn hearsescrubbing floorknee woundspare tirespilled wine (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Proof (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Proof (2005)

The daughter of a brilliant but mentally disturbed mathematician (recently deceased) tries to come to grips with her possible inheritance: his insanity. Complicating matters are one of her father's ex-students who wants to search through his papers and her estranged sister who shows up to help settl β€¦e his affairs. (Read More)

Themes:
inheritancewritingdeath of fatherfuneraldeathfriendshiplovedrinkingdrunkennessparanoiadrug usegriefillnessmental illnesseducation β€¦cheating (See All)
Mood:
rain
Locations:
new york citysnowbicycleairportkitchenlakechicago illinois
Characters:
writerfriendfather daughter relationshipfamily relationshipspoliceboyfriend girlfriend relationshipteacherstudentpolicemansister sister relationshipteacher student relationshipfiance fiancee relationshipbabe scientistself delusion
Story:
mobile phoneeggreadingchampagnesexf ratedone word titleflashbackkisstitle spoken by characterpartybased on playtelephone callcryingwatching tv β€¦drinkundressingbooktearsbirthdaycollegehallucinationclassroomsciencewinerock bandnonlinear timelinepainflash forwardumbrellacollege studentuniversitysadnessloss of fatherclassstrong female charactertwenty somethingnerddressstrong female leadparking garageschizophreniaremote controlsufferingmourningbackpackshoppingdrummercigarette lighterrefrigeratorsnowingnervous breakdowngeekbenchmelancholygeniusdrumsreflectiondementianotebookdead fatherjournaltv commercialescalatormathematicscheesecollege professoruniversity studentcampuswakedeskestrangementmemorialwisconsinpackingsleeping on a couchhappy birthdayphysicisttalking to selfuniversity professorgraduate studentpulitzer prize sourcecollisionmathematicianporchphdsixty somethingamphetaminestring quartetnumbersestranged family membertalking with the deadaneurysmacademiaproofdrumstickstony award sourceprime numbersnorthwestern universityuniversity of chicagoo'hare airport chicagooverbearing sisterreference to cosmopolitan magazineevanston illinoisacademic advisorhair conditionertalking to one's dead father (See All)

New Nightmare (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

New Nightmare (1994)

It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β€¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)

Subgenre:
suspenseindependent filmcult filmfairy talepost modernpsychological thriller
Themes:
writingdeath of fatherfuneraldeathmurdersurrealismkidnappingfearescapemonsterfilmmakingdeceptionbrutalitysupernatural powerparanoia β€¦couragenear death experience (See All)
Mood:
nightmaregoreslasher
Locations:
hospitalswimming poolcarcemeterylos angeles californiawaterwheelchairtrucksinging in a cartruck accident
Characters:
serial killerfather daughter relationshiphusband wife relationshipfather son relationshipmother son relationshipboypolice officernurseactorpriesthostageactresssecurity guarddirectormaid β€¦film directorself referentialcoroner (See All)
Period:
1990s
Story:
screamingcar crashcar accidentcorpsecell phonechasebloodviolencesequelinterviewexplosionknifesurprise endingfiredream β€¦blood splatterblonderescueslow motion scenefalling from heightpaintingvomitingshowdownsunglassesrunningbeddemonhallucinationtelevisiontelephonegood versus evilfoot chaseambushcaliforniastrangulationmansionstabbingdeath of friendwidowstabbed to deathstabbed in the chestsnakebrunetteno opening creditsdream sequencechild in perilhit by a cartonguenews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineburned aliveelectronic music scorewoundhypodermic needleslow motioninjurybabysitterlifting someone into the airmorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setstabbed in the legfilm settitle at the endalternate realityeye gougingdisfigurementstabbed in the eyefemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All)

The Shining (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Shining (1980)

Signing a contract, Jack Torrance, a normal writer and former teacher agrees to take care of a hotel which has a long, violent past that puts everyone in the hotel in a nervous situation. While Jack slowly gets more violent and angry of his life, his son, Danny, tries to use a special talent, the "S β€¦hining", to inform the people outside about whatever that is going on in the hotel. (Read More)

Subgenre:
cult filmamerican horrorbritish horrorcult classic
Themes:
writingpsychopathmurdersurrealismmarriageghostsupernatural powerdysfunctional familyinsanitycannibalismwilderness
Mood:
nightmareambiguous ending
Locations:
bathtubhelicopterhotelbarsnowairplaneairportelevatorkitchen
Characters:
writerhusband wife relationshipmother son relationshipfather son relationshipfamily relationshipsdoctor
Period:
1980swinter
Story:
bathroomchasefemale frontal nudityfemale nuditybloodbased on noveltwo word titlefemale full frontal nudityphotographtitle spoken by charactersurprise endingmirrorslow motion scenehallucinationgood versus evil β€¦axewomanfemale pubic hairchild abusecultchild in perilbartenderracial slurcostumepossessionbaseball batskeletonactor shares first name with characterdomestic violencelong takeisolationhauntingtypewriterpsychicchild murdermaniactv newsfalling down stairselectronic music scorelifting someone into the airice creamcookblockbusternew year's evehomereincarnationjob interviewmiami floridabutlerhit on the headabusive fatheraxe murdertelepathyvillain played by lead actorpsychopathic killercartoon on tvmazehomicidal maniacrestroomimaginary friendcoloradopremonitionwriter's blockidentical twinssole black character dies clichefamous scoreoverhead camera shotcaretakerchapter headingsbutcher knifemass murdererfamous linetranceradio broadcastvolkswagen beetleballroom dancinglabyrinthtoy carsnowstormfreezerfrozen bodyextrasensory perceptiontricyclebreaking down a doorghost childtwin sistersfilicidedenver coloradorepetitionable to see the deadbased on the works of stephen kingrocky mountainshorror movie remadehypothermialifting a male into the airpediatricianuxoricidestore roomcanned foodforest rangeralcoholic relapsefreezing to deathpantryshot in sequencemagical negro stereotypehaunted hotelhedge mazehome sweet homebear suitpsychological disintegrationcabin feverfilmed in mirrorwriting backwardsadvice from bartenderescape through a bathroom windowtwo way radio (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Before I Go To Sleep (2014) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Before I Go To Sleep (2014)

Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen β€¦ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)

Subgenre:
suspenseindependent filmtragedypsychological thrillerfamily tragedy
Themes:
friendshiplovemarriageinfidelitybetrayaladulterypregnancyfearescapeinvestigationdeceptionmemoryextramarital affairangerdivorce β€¦brutalityparanoiaguiltgriefunfaithfulnessillnessmental illnesspanictraumaamnesiaforgiveness (See All)
Mood:
nightmareneo noir
Locations:
hotelhospitalschoolairplanelondon englandairportelevatorkitchenpolice carenglandfire truck
Characters:
babyfriendhusband wife relationshipfather son relationshipmother son relationshipdoctorboyteenage boyfemale protagonistteacherbest friendlittle boypsychiatristex husband ex wife relationshippregnant woman β€¦self discoverydoctor patient relationship (See All)
Period:
1990s2000s2010syear 1999year 2013year 2007
Story:
hitchcockiansurprisemobile phonepsychologistscreamingargumentbathroomcar accidentcell phonechasefemale nuditynuditybloodsexbased on novel β€¦violenceflashbacksex scenekissfemale rear nudityfightcigarette smokingphotographpartysurprise endingshowertelephone callcryingbeatingdreamblood splatterfoodmirrorface slapslow motion scenepunched in the facecamerawritten by directorarrestbare buttsecretletterlierunningbedsex standing uphallucinationbritishtelephonef wordsubjective camerafoot chasebedroomstrangulationambulancemontageeatingaccidentfalse accusationapologyno opening creditsdream sequencedrawingdouble crosssearchon the runflash forwardparkattempted murderhotel roomdangerkeyattackliarcharacter's point of view camera shotknocked outdiarydomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framesyringerevelationwarehousehypodermic needleheavy rainlooking at oneself in a mirrorlistening to musicsociopathcrying womantherapistnosebleedbarefoot maleparking garagefalse identitypresumed deadreverse footagetensionbloody noseblood on faceintrigueloss of sonimpostorbroken glasshousewifeescape attempthit on the headevidencewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identitytwist endingfriendship between womenhospital roomhospital bedwhisperinghearing voicesnewspaper articlehead injuryscene of the crimelocked doordomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehiding placedistrustfully clothed sexwaking upwet clothesflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanwedding anniversaryman slaps a womanwrapped in a towelred herringman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativefemale star appears nudepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefrepeated dialoguemysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All)

Confessions Of A Dangerous Mind (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Confessions Of A Dangerous Mind (2002)

Television made him famous, but his biggest hits happened off screen. "Confessions of a Dangerous Mind" is the story of a legendary showman's double life - television producer by day, CIA assassin by night. At the height of his TV career, Chuck Barris was recruited by the CIA and trained to become a β€¦ covert operative. Or so Barris said. (Read More)

Subgenre:
black comedybased on autobiography
Themes:
funeralmurderdeathsuicidemarriageinfidelityadulterypregnancydrinkingtortureweddingextramarital affairlonelinessparanoiaunfaithfulness β€¦dating (See All)
Locations:
bathtubhotelnew york citybarrestaurantswimming poolsnowairplanelos angeles californiadeserttruckmexicotunnelsex in shower
Characters:
girlfather son relationshipmother son relationshiphomosexualsingerboybrother sister relationshipprostitutedancerjewishreference to godhitmanbiblejew
Period:
1980s1970s1960s1940s1950s1930s
Story:
men's bathroomdiarrheadentistbathcoffinbathroomdead bodybloodsexviolenceflashbackmasturbationdog β€¦gunkissfightcigarette smokingdancingphotographsingingpistolshowervoice over narrationbased on booksongdreamshot to deathblood splattershot in the chestface slapshot in the headpunched in the facewatching tvcameradrinksecretshootingvomitingriflebeerbirthdayinterrogationhallucinationreference to jesus christmanhattan new york cityshot in the backspygay slurassassinwinestrangulationnonlinear timelineassassinationmarriage proposalflash forwardpoisonauditionflowerslong takesplit screenpremarital sexdirectorial debutsecret agentsilencertwinpsychicciaberlin germanycold warfamecowboy hatgoatbar fightmovie theatrecameotarget practiceexplosiveintriguehippiespanishboston massachusettstitle appears in writingtheatre audiencereference to satanamusement parkaccidental killingblack eyeundercover agentskiingsongwriterrefrigeratorphiladelphia pennsylvaniawilhelm screamreference to elvis presleyshynessface maskalleybag over headpistol whipmental breakdowndouble lifereality showaustriaferris wheeltelevision showreference to albert einsteinkgbtour guidetv studiobroken noseforgeryberlin wallelvis impersonatorapemolescrabbledouble agentman with no namesurprise partyvolkswagen beetlehelsinki finlandhappy birthdayfired from a jobnew housecaught in the actchemistrytv cameragenitaliatv producerfear of commitmenttv pilotreference to friedrich nietzschetoilet stalldiving boardwest berlin west germanymicrofilmgame show hostillegitimacycommunist partyreference to fidel castroreference to mao tse tunganti communismtelevision industrypeace signcontract killingplayboy mansionchaperoneroller skatergrottoreference to the old testamentdead body in swimming poolinsurance salesmanlife magazinetelevision broadcastingcondemnationdeath of twinrockefeller center manhattan new york citysugar cubestagehandreference to nikita khrushchevguard towerhandednesssistine chapelfccgovernment assassinprisoner exchangenitroglycerinereference to nat king colego go bootsneckingu.s. national anthemamerican broadcasting companynational broadcasting companypitch meetingreference to sal mineotea leavestv audiencecia operativeshaving one's beardtv executivefederal communications commissionnitric acidreference to dick clarkreference to rosemary clooneyreference to vladimir nabokovtargeted killing (See All)

American Psycho (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

American Psycho (2000)

Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.

Subgenre:
suspenseblack comedyindependent filmcult filmpsycho thrillerpsychological thrilleramerican horror
Themes:
wealthpsychopathfriendshipmurderdeathrevengeinfidelitydrugsrapechristmasmoneyjealousydrinkingfeartorture β€¦drunkennessescapeweddinginvestigationdeceptionmemoryangerdivorcebrutalityparanoiablackmaildrug useinsanitymental illnessrivalryevilabuseexecutionbreak upgreedpaniccannibalismhomelessnessfashionmadness (See All)
Mood:
goresatireneo noirslasherambiguous ending
Locations:
bathtubhelicopternew york citybarrestaurantnightclubtaxiapartmentpolice caroffice
Characters:
serial killerhomosexualpoliceboyfriend girlfriend relationshipprostitutepolice officerdetectivepolicemanlawyerkillerlustsecurity guardvillainsecretaryterror β€¦cousin cousin relationshipamericanpolice shootoutpolice chasehomeless manslasher killerserial murdererjewish americanself narrationcheating on one's girlfriendsex with prostitutesex killer (See All)
Period:
1980schristmas party
Story:
men's bathroomeccentricmurdererchampagnescreamingdead bodycar crashcar accidentcorpsecell phonechasefemale frontal nudityfemale nuditybloodf rated β€¦based on novelmale nudityviolencethreesomemale frontal nuditymale rear nuditydogtwo word titlebare chested malegunsex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplesphotographexplosionpartyknifeleg spreadingsurprise endingpantiespistolshowerfirevoice over narrationfondlingcryingshootouttitle directed by femalebeatingshot to deathunderwearblood splatterfoodmirrorshot in the chesturinationblondeshot in the headwatching tvcatcameradrinkundressinggunfightsex in bedthongbare buttheld at gunpointsunglassesrunninglingeriebedinterrogationvoyeurrevolvermanhattan new york citytelephonemenage a troisf worddecapitationcleavagefoot chasegay slurbrawinenew yorkstrangulationaxevideo cameraambulancestabbingwomanmontageimpalementcocainestabbed to deathstabbed in the chestexploding carmodelsevered headscantily clad femaledrawingdouble crosscontroversypolice officer killedvoice overcigar smokingshot in the foreheadbartenderracial slurconfessionattempted murderlimousineblack pantiesbusinessmanpay phonesex with shoes onmassagemistaken identitymissing personevil mankicked in the facechristmas treescreamshot in the shoulderfemale removes her clothesdatepigpremarital sexfirst parthandgunkillingblood spattersplattermaniacprivate detectivesurgerychainsawmachismoeyeglassescloseted homosexualpornographywaiteranswering machinefireplacerevelationmass murderlooking at oneself in a mirrortape recordersociopathscene during opening creditslifting someone into the airragevirusexercisewatching a moviebuttocksgossipimpersonationphone boothpsychocovered in bloodvictimbrooklyn new york cityblack humorrapistschizophreniarealitymale underwearguardrampagebarefootwoman in jeopardyremote controljanitorrear entry sextensiontelescopecouchhatredfitnessimpostorcannibaldark humorbutcherheadphonesescape attemptlaughtersketchslaughterrefrigeratortuxedobody countduct tapeaxe murderbriefcasenervous breakdownalienationcharacters killed one by oneethnic slurkilling spreeworld trade center manhattan new york citysirenpsycho killerdrugged drinkwoman in bathtubpervertserial murdervillain played by lead actorpsychopathic killervideo tapefianceebad guyhysteriamadmanface masklaundrynotebookkilling a dogmisogynisthuman monsterspiral staircasefemale removes her dresssnorting cocainejournalmini dresssexual perversionhomicidal maniacrestroomskyscrapermasseuselaundromatslashingcall girlsplit personalitycredit cardbody in a trunknarcissismreference to donald trumpdance clubwoman in bra and pantiesnihilismyuppiedruggedbathrobebusiness cardoffscreen killingcdeastersense of smellbumpearl necklaceurinalcarnage80s musicsole black character dies clichevanityfur coatsushihomeless personreference to ronald reaganoverhead camera shotrealtorbloody violencehobopool of bloodfemale bartenderfemale victimlunaticsadistic psychopathcocaine snortingceohedonismvice presidentanimal killingmass murdererdisturbed individualjerkbutcherywalkmaninnocent person killedsuspenderscrime spreehigh societyidentity crisismaterialismstairwellmartinideeply disturbed personserial rapistcityscapekilled during sexbroken engagementcult figureborderline personality disordercorporate executivenail gunwall street manhattan new york cityaxe in the headsex act reflected in mirroranswering machine messageruthlessnessbritish actor playing american characterautomated teller machinebottled watercreepycompact discexercisingspiked drinkraincoatmisanthropeambiguitytwin towerscuisinemultiple personality disordervideotaped sexworld trade centersadisticstockbrokerharvard universitynylonswashroomdissectionover the tophigh risedouble murderdragging a dead bodygory violenceeast coastsickolock of hairstreet walkeraxe murdererchauvinismmanicureunreliable narratorgruesomepornographic videotanning bedfirst lesbian experiencelasciviousnessmistletoemurder confessionbloodlustchainsaw murdermusic fansavagerywall streetsexual experimentationinvestment bankermurdered womanreservationsteroidlistening to music on headphonesvoice imitationyale universitydry cleaningemployee employee relationshiphacked to deathsex maniacbedsheetbrutalmergerreference to ted bundycheating on one's boyfriendoffice jobreference to mikhail gorbachevdecolletagestain27 year oldnarcissistic personality disorderparanoiacsadistic killeranti consumerismfemale victimsfrenzylithiumovercoatinner monologueslashed to deathstuffed toy animalxanaxreference to whitney houstoncouturefeet on deskreference to genesiswhite collarantisocial personality disorderblack nylon stockingsclothes hangerhiding evidencepet pigfalse alibikentucky derbysadistic sexsound systemreference to dorian graycorporate raiderdead body in bathroomreference to ed geinreference to phil collinswoman kicks a manchild of divorcechinese laundryhead in refrigeratorskin caresnorting coketruth taken as a jokecranberry juicepretend telephone callreference to elvis costellorope skippingcoasterharvard business schoolreference to ivana trump (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β€¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
suspenseblack comedyindependent filmcult filmb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
deathmurderfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion β€¦exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
goreraincar chaseambiguous ending
Locations:
bathtubhospitalforestbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed
Characters:
father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog
Period:
2000s
Story:
fevereccentricvacationscreamingdead bodycar accidentcorpsecell phonechasefemale frontal nudityfemale nuditybloodviolenceflashbackmasturbation β€¦dogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifesurprise endingpantiespistolshowerfirewoman on topbeatingshot to deathblood splatterhorseshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerlow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushaxemassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkarateperson on fireproduct placementstorytellingknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntercovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordcorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Rope (1948) is one of the best movies like Harry, Un Ami Qui Vous Veut Du Bien (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Rope (1948)

Brandon and Philip are two young men who share a New York apartment. They consider themselves intellectually superior to their friend David Kentley and as a consequence decide to murder him. Together they strangle David with a rope and placing the body in an old chest, they proceed to hold a small p β€¦arty. The guests include David's father, his fiancee Janet and their old schoolteacher Rupert from whom they mistakenly took their ideas. As Brandon becomes increasingly more daring, Rupert begins to suspect. (Read More)

Subgenre:
suspensegay interestcult filmexperimental film
Themes:
wealthpsychopathmurderdeathfriendshipdrinkingfearpovertyguiltunemploymentphilosophy
Locations:
new york cityapartment
Characters:
writerfriendmother son relationshipfather son relationshipteacherteacher student relationshipmaidaunt nephew relationshiphomosexual killer
Story:
murdererchampagnedead bodycorpsebloodone word titletitle spoken by characterpartybased on true storybased on playtelephone callface slapremakedrinkbook β€¦pianoconcertstrangulationroommategunshotstorytellingevil manlong takesuspicionchickensacrificeropereference to adolf hitlerhatambitionmoralitybroken glasshousekeeperarrogancegeniuspiano playerdirector cameoethicsdinner partyminimal castpublishershot in the handdecadencehomosexual subtextaltartrunkoff screen murderegointellectualcut handbanquetreal timecat and mousechestideologycandelabrapreparatory schoolsingle set productiongay subtextschoolmateskylinehoroscopeno musicmetronometracking shotreference to cary grantprivilegecigarette casehidden corpsewaiting in lineold bookreference to errol flynnweaknesscrime and punishmentsupperwooden chestnightfallcontemptchampagne glassmorbidityreference to mary pickfordcutting handreference to james masonperfect murderassumed superiorityhousemaster (See All)

Insomnia (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Insomnia (2002)

Sent from the city to investigate the murder of a teenage girl in a small Alaska town, a police detective (Pacino) accidentally shoots his own partner while trying to apprehend a suspect. Instead of admitting his guilt, the detective is given an unexpected alibi, but this "solution" only multiplies  β€¦the emotional complexity and guilt over his partner's death. He's also still got a murder to solve, in addition to the blackmail and framing of an innocent bystander being orchestrated by the man they were chasing. There's also a local detective (Swank) who is conducting her own personal investigation... of his partner's death. Will it all come crashing down on him? (Read More)

Subgenre:
tragedypolice procedural
Themes:
poetrydeath of fatherpsychopathmurderdeathlovebetrayalinvestigationblackmailredemptionguiltmurder investigationmurder of a police officer
Mood:
high schoolrainneo noir
Locations:
rural settinghotelhospitalbeachrestaurantschoolsnowsmall townairplanepolice stationtrucktunnelalaskafishing village
Characters:
writergirlmother daughter relationshippoliceteenagerboyfriend girlfriend relationshipboyteenage girldetectivepolicemanpolice detectiveolder man younger woman relationshipcolleague colleague relationshipcheating on girlfriend
Period:
2000s
Story:
pursuitdead bodycorpsechasefemale nuditybloodnudityflashbackdoggunfightcigarette smokingphotographpistoltelephone call β€¦shootoutbeatingshot to deathshot in the chestremakeshotgunshootingbookvomitingrifleheld at gunpointinterrogationhallucinationtelephonefoot chasedinerfemale pubic hairfishingpolice officer killedshot in the leglatex glovesbeaten to deathfbistorytellingcover updiarydeath of husbandpolicewomancabinwaterfalltypewriterchild murderbulletflyingbreaking and enteringtape recordershot in the stomachmorgueaccidental deathdead womanhomicidemoralitybackpackpartnergunshot woundnovelistpolice officer shotframe uppedophileautopsyevidencefognude woman murderedalarm clockferrygunfirefemale detectivelyingdead dogdead girlhairdead animaljournalgun held to headfalling into waterdouble barreled shotguninsomniaaccidental shootingadult actress playing teenage girlstakeoutcabin in the woodsquarrelscene of the crimeunderage smokingmurder suspectnaked dead womanfemale copdirty copsleeplessnessabusive boyfriendglacierschizophreniccriminal investigationbludgeoninglapdhotel managerinternal affairsloggingsunlightgarbage dumpforensic evidencelodgeplanting evidencesleep deprivationgarbage bagmurder confessionlos angeles police departmentsunshineconfession of crimeplanted evidencewindshield wiperfingernailarctic circlemystery writernaked dead bodytrapped underwatercrime writercrime confessionshell casingnude pictureplaying chickenremoving a bulletballisticspolice proceduretoenailmidnight sunnude bodycrime reconstructionhalibuthypothetical flashbacklost in fognude corpsephone call from suspectremake of norwegian film (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Harry, Un Ami Qui Vous Veut Du Bien?
<< FIND THEM HERE! >>