Please wait - finding best movies...
A motley crew of tourists embark on a boat ride of the haunted Louisiana bayous where they learn the terrifying tale of local legend "Victor Crowley"; a horribly disfigured man who was tragically and accidentally killed with a hatchet by the hands of his own father. But when the boat sinks and the g β¦host story turns out to be real, the group tries desperately to escape the swamp with their lives...and all of their pieces. (Read More)
Subgenre: | survival horrorslasher flickabsurdism |
Themes: | lesbianismdeathmurder |
Mood: | ambiguous endingslasherspoofgore |
Locations: | school busboatcemetery |
Characters: | slasher killerteenage boyteenage girlfriend |
Story: | tour boattour guideperson on firerun agroundhorror iconlifting a male into the airbeadsincest jokesplit headblonde stereotypecliffhanger endinglifting a female into the airmardi grasdead teenagerharpoon β¦bayouno survivorsskepticismextreme violenceraccoondeformityunsubtitled foreign languagesouthern u.s.louisianatorso cut in halfcharacters killed one by onebody counttourswampimmortalitycamplifting someone into the airmaniacfirst partcabinneck breakingstorytellingsurvivaldecapitationcollegevomitingblood splatterfirepistolsurprise endinglesbian kisstitle spoken by characterone word titlefemale nuditybloodviolence (See All) |
Subgenre: | survival horrorslasher flickindependent filmcult filmblack comedysuspensefish out of waterteen movieteen horrorpsychological thriller |
Themes: | murderdeathfriendshiprevengekidnappingfeartortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | slashergore |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | slasher killerteenage boyteenage girlteenagerboyfriend girlfriend relationshippolice officerhostageinterracial relationshipself mutilation |
Period: | 2000s |
Story: | person on firedead teenagercharacters killed one by onebody countfirst partsurvivaldecapitationcollegeblood splatterfirepistolsurprise endingbloodviolencesex β¦cigarette smokingexplosionknifechasecryingcell phonebeatingcorpseshot to deathcar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanashot in the backfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingfirst of seriesdollcollege studentscene during end creditsprankstalkingthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolineaxe murdersevered legarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned carwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | slasher flickindependent filmcult filmpsycho thrillerparanormal phenomenateen horroramerican horror |
Themes: | murderdeathrevengemonsterpsychopathsupernatural powerevildrug addictionmurder of a police officer |
Mood: | slashergorerainhigh school |
Locations: | boatnew york citywoodsseacityamericasewer |
Characters: | slasher killerteenage boyteenage girlzombiepolice officerserial killerkillervillainteacher student relationshipterrormysterious villainserial murderer |
Period: | 1980s |
Story: | lifting a female into the airdead teenagerharpoondeformitycharacters killed one by onebody countlifting someone into the airmaniacdecapitationblood splatterfemale nuditybloodviolencecharacter name in titlenumber in title β¦sequelbare chested maleexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york cityflashlightgangnew yorkstrangulationaxevideo camerastabbingthroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadhypodermic needlemutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastelunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightninghockey masktwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
Themes: | deathmurdertorturepsychopathbrutalitysupernatural powerinsanitysadismevil |
Mood: | slashergorebreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | slasher killerteenage boyteenage girlbrother sister relationshipserial killerkillervillainterrormysterious villainserial murderermysterious killer |
Period: | 1980s |
Story: | lifting a female into the airextreme violencedeformitycharacters killed one by onebody countcamplifting someone into the airmaniaccabindecapitationblood splattersurprise endingfemale nuditybloodviolence β¦sexnumber in titlemale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiescorpseunderwearmasklow budget filmsubjective camerastrangulationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurdererloss of motherobscene finger gesturekillingsexual attractionragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carkilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womangraphic violencestabbed in the facemasked villainknife murderbloody violencelunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey maskruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | slasher flickindependent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror |
Themes: | murderdeathrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of motherinsanity β¦evilabductiontraumafear of water (See All) |
Mood: | slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore |
Locations: | cemeteryforestsmall townpolice stationlakeschool nurse |
Characters: | slasher killerteenage boyteenage girlfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipzombieserial killerlittle girlkillervillainsheriffterrormysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | person on firedead teenagerdeformitytorso cut in halfcharacters killed one by onebody countlifting someone into the airmaniaccabinneck breakingdecapitationblood splatterfirepistolsurprise ending β¦violencebloodcharacter name in titlesequelflashbackphotographexplosionpartyshowervoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashdemonfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingpremarital sexmurderersevered armdismembermentkillingundeadsplatterchild murderburned aliveheroinemass murdermachetecomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterdemonic possessionkilling spreegeekburned to deathmasked killernewspaper clippingpsycho killerblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencefemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chesthockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | slasher flickindependent filmcult filmteen horroramerican horror |
Themes: | murderdeathrevengefeardeceptionpsychopathsurveillanceevilmurder of a police officer |
Mood: | slashergoresatire |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | slasher killerteenage boyteenage girlserial killernursekillersecurity guardvillainpsychiatristcoroner |
Period: | 2000s |
Story: | lifting a female into the airdead teenagercharacters killed one by onebody countlifting someone into the airmaniacneck breakingdecapitationblood splatterfiresurprise endingfemale nudityviolencebloodsequel β¦flashbacktwo word titlefightknifechasecell phonecorpsefistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameragood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearancemurdererthreatened with a knifesevered armobscene finger gesturekillingchainsawheavy rainsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | survival horrorslasher flickindependent filmteen movieteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
Themes: | murderdeathfriendshiprevengesurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic β¦self sacrificenear death experience (See All) |
Mood: | ambiguous endingslasherspoofsatirehigh schoolparody |
Locations: | hospitalforestwoodssinging in a car |
Characters: | slasher killerteenage boyteenage girlhomosexualteenagermother daughter relationshipdoctortattoofemale protagonistgirlserial killernursehostagekillermother β¦ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All) |
Period: | 1980syear 1986year 1987 |
Story: | person on firecharacters killed one by onebody countcampneck breakingsurvivaldecapitationvomitingfiresurprise endingviolenceflashbacktwo word titlebare chested malecigarette smoking β¦dancingexplosionknifechasethree word titlepantiescell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingshowdowncar crashvoyeurf wordgood versus evilcleavagefoot chasegay slurorphansword fightambushmontageimpalementstabbed to deathdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaserace against timelightningprankscarhigh school studentfilm within a filmrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosshome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastgeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | slasher flickcult filmsupernaturalpsycho thrillerparanormal phenomenateen horroramerican horror |
Themes: | deathmurderprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
Mood: | slashergorecar chasedarknessbreaking the fourth wall |
Locations: | boatcemeteryforestsmall townwoodslakeamerica |
Characters: | slasher killerpoliceteenagerzombieserial killerkillervillainsheriffterrorserial murderer |
Period: | 1980s |
Story: | lifting a female into the airdead teenagerbody countlifting someone into the airmaniacneck breakingdecapitationblood splattersurprise endingviolencesexcharacter name in titlenumber in titlesequelflashback β¦masknumbered sequeldemonflashlightmassacreambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermass murdergothicmachetemutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightninghockey maskdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
Subgenre: | slasher flicksuspensebody horroramerican horrorsadistic horrorspanish horrorcanadian horror |
Themes: | murdersuicidefeartorturedeceptioncannibalism |
Mood: | slashergorerainnightmareblood and gore |
Locations: | boatnew york cityvillagejungleamericarain forest |
Characters: | slasher killerfather daughter relationshiptattoolawyervillainterroramerican abroad |
Story: | extreme violencetorso cut in halfcharacters killed one by onebody countdecapitationcollegevomitingblood splatterpistollesbian kissfemale nudityviolencemale frontal nuditymale rear nuditybare chested male β¦three word titlecell phoneshot to deathshot in the chesturinationwritten by directormarijuanaislandmale pubic haircolor in titlerivershot in the backcookingthroat slittingimpalementsevered headdream sequenceritualroommatenecklaceshot in the foreheadcharacter repeating someone else's dialogueprotestcollege studentscene during end creditsuniversityshot in the shoulderpigsevered armshot in the armdismembermentkillingblood spattersplattermachetemutilationspidercovered in bloodvictimbroken legmasked maneaten alivemale masturbationcannibalfalling to deathpsychotroniclesbian coupleairplane crashtitle at the endeye gougingslaughterstabbed in the eyebroken armsevered legenvironmentalismcapitalismactivistsatellitemarijuana jointbad guykillshot in the neckunited nationshomagehuman monsterflutenaivetyamazonslashingveganantbleeding to deathkiller childmiddle classperugraphic violencereference to twittertied up while barefootcamera phonebloody violencedeforestationignorancesadistic psychopathenvironmentalistpsychotronic filmbulldozerdiarrheabody partreference to madonnagpsblood drinkingculture shockbitten on the armreference to brad pitttranquilizer dartsevered tonguetorturerjaguarmasked womananthropophagusgory violenceeast coasteating human fleshfemale genital mutilationman eaterbody partshead on a stakemachete mutilationugly americanbrutalcannibal tribeindian tribereference to scooby dooflesh eaterthrowback (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c β¦olleagues (Read More)
Subgenre: | survival horrorslasher flickcult filmblack comedysuspense |
Themes: | deathmurderrevengesurrealismrapedrinkingfearescapevoyeurismangerpsychopathsupernatural powerparanoiainsanitysurveillance β¦evilpanictechnologymadness (See All) |
Mood: | slasher |
Locations: | restaurantswimming poolelevatorlaboratory |
Characters: | slasher killerboyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientist |
Period: | 1990s2000s |
Story: | person on firecharacters killed one by onebody countlifting someone into the airfirst partneck breakingsurvivalvomitingblood splatterfirefemale nuditybloodviolencefemale frontal nuditymale rear nudity β¦dogbare chested malegunkissfightnipplesexplosionchasepantiesshowertelephone calldreamcorpseunderwearmirrorshot in the chesturinationface slappunched in the facecomputerdrinkthongmaskshowdownsunglassesbombdead bodycafebathroomvoyeursciencescientistfoot chasestrangulationimpalementman with glassesanti herounderwater scenedrowningtransformationstalkerdangerstabbed in the backsuburbelectrocutioninjectionpursuitstalkingratcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathstabbed in the stomachmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance cameraresearchthirty somethinglasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abuseelectric shockgiving a toastseizuretop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
Subgenre: | slasher flickindependent filmcult filmblack comedydark comedystop motion animationdark fantasygross out comedyamerican horrorsupernatural horror |
Themes: | murderdeathrapeghostdancesupernatural powersadismevilsupernatural rapebook of evil |
Mood: | slashergoreone night |
Locations: | forestcarwoodssinging in a car |
Characters: | teenage boyteenage girlfriendboyfriend girlfriend relationshipbrother sister relationshipstudentself mutilationself cannibalism |
Period: | 1980s |
Story: | dead teenagerextreme violencecharacters killed one by onefirst partcabindecapitationcollegeblood splatterfiresurprise endingfemale nudityviolencebloodkissthree word title β¦remakeshot in the headshotgunwritten by directorshootingbooklow budget filmdemonriversubjective cameraaxestabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingdirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camgrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is β¦the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
Subgenre: | slasher flickpsycho thrilleraustralian horrorteen horror |
Themes: | murderdeathtorturefuneralbrutalityyouthabusecampingghost town |
Mood: | slashergorehorror movie remake |
Locations: | churchforestsmall townroad tripcampfire |
Characters: | slasher killerboyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshipserial killerpriesttough guyinterracial relationshipvillainsheriff |
Story: | person on firedeformitycharacters killed one by onebody countcamplifting someone into the airdecapitationvomitingfiresurprise endingtitle spoken by characterbloodviolencemale nuditymale rear nudity β¦bare chested malefightknifechasethree word titlepantiescryingcell phonecorpseshot in the chesturinationface slapshot in the headshotgunundressingbare buttlingeriegood versus evilbravideo cameradeath of friendimpalementstabbed to deathstabbed in the chestchild abusesevered headscantily clad femalebeaten to deathstripteasetentkicked in the facebaseball batinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowgroup of friendsloss of friendamerican footballhidingfloridarednecksevered fingercrossbowgash in the facestabbed in the necktitle appears in writingscissorsstabbed in the legred pantiestank topcar troublegroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingswrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β¦ you? (Read More)
Subgenre: | slasher flickindependent filmcult filmteen movieteen horroramerican horrorindependent horror |
Themes: | murderrevengesurrealismfuneralpsychopathsupernatural powerevil |
Mood: | slashergorehigh schoolnightmareavant garde |
Locations: | cemeterybathtubpolice station |
Characters: | slasher killerteenage girlhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipserial killerkilleralcoholicvillainterrorpolice chaseself mutilationmysterious villain β¦serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | person on firedead teenagercharacters killed one by onebody countlifting someone into the airmaniacfirst partblood splattersurprise endingbloodviolencebare chested malecigarette smokingdreamcorpse β¦mirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothichatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementcellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | survival horrorabsurdismindependent filmcult filmblack comedysuspenseb moviepsychological thrillerbody horror |
Themes: | murderdeathfriendshiprevengedrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion β¦exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | ambiguous endinggoreraincar chase |
Locations: | hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | person on fireno survivorstorso cut in halfcharacters killed one by onecabinstorytellingsurvivaldecapitationcollegevomitingblood splatterfirepistolsurprise endingfemale nudity β¦violencebloodfemale frontal nudityflashbackmasturbationdogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiesshowercell phonewoman on topbeatingcorpseshot to deathhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingcleavagefoot chasegay slurambushaxemassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingproduct placementvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legflat tiresouthern accentwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boybanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | slasher flickcult filmamerican horror |
Themes: | deathmurderpsychopathabductionexploitation |
Mood: | slashergoredarkness |
Locations: | lake |
Characters: | slasher killerteenage boyteenage girlteenagerboyfriend girlfriend relationshipserial killerkillervillainterrorserial murdererlow self esteemmysterious killer |
Period: | 1980s |
Story: | extreme violencedeformitytorso cut in halfcharacters killed one by onelifting someone into the airmaniaccabinbloodsexnuditynumber in titlesequelshowerdigit in titlebikini β¦masknumbered sequelsubjective cameraaxeimpalementthird partcharacter's point of view camera shotevil manmurderersevered armdismembermentsplattermass murdermacheteragebarnroman numeral in titlepsychosevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyesequel to cult favoritekilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmandefecationhuman monstersexual violencehomicidal maniacslashingshot in the eyehillbillyeyeballhammockfamous scoremasked villainknittingpitchforksole survivorsadistic psychopathpsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
3 backpackers are in Amsterdam where they get locked out of their youth hostel. They are invited into a man's house where he tells them of a hostel somewhere in eastern Europe where the women are all incredibly hot and have a taste for American men. When they get there, everything is too good to be β¦true - the hostel is "to die for" (Read More)
Subgenre: | survival horrorslasher flickcult filmconspiracysadistic horror |
Themes: | murderdeathrevengesuicidekidnappingdrinkingfeartortureescapedeceptionseductiontravelpsychopathbrutality β¦sadismpolice brutality (See All) |
Mood: | slashergorecar chase |
Locations: | trainpolice stationbrothelmuseumtrain stationsex in a bathroom |
Characters: | slasher killerfriendprostituteserial killeramerican abroad |
Story: | extreme violenceunsubtitled foreign languagetourfirst partvomitingblood splatterpistoltitle spoken by characterone word titlefemale nudityviolencebloodthreesomefemale frontal nuditymale rear nudity β¦bare chested malefemale rear nuditydancingphotographpantiescell phonebeatingcorpseshot to deathshot in the chestface slapheld at gunpointprostitutionhandcuffsshot in the backsubjective camerafoot chasebound and gaggedstrangulationdeath of friendthroat slittingtied to a chairsevered headchild in perilhit by a carcontroversysearchfemme fataleshot in the foreheadpainon the runbeaten to deathscreamingcharacter's point of view camera shotmissing personcover upcollege studentdisappearanceglassestrappremarital sexwhippingeuropedismembermentsurgerychainsawpot smokingwarehousegothicmachetemutilationdesperationsevered handcovered in bloodsadomasochismcrying manpassportsexual desirecameorear entry sexstealing a carwhipmercilessnesspunched in the stomachtitle appears in writingscissorstitle at the endvegetarianeye gougingsevered legsurprise after end creditsdrugged drinkpsychopathic killermysterious manbongbag over headforeignerburnt faceamsterdam netherlandshead bashed inscalpelwoman in bra and pantiesicelandwhistlingbusiness cardfinger cut offcrushed headcorrupt policekiller childspaslaughterhousedrillcut into pieceshit with a hammersole survivorlocked in a roomstupid victimnude photographhit by a traintorture chamberpower drillbodily dismembermentbubble gumblowtorchhostelhit with a rocksledge hammerbackpackersaladhit on the head with a rockdrill in the headburn injuryslovakiaachilles tendon cuthead in a toiletugly americanhit by a doorsevered toebegging for lifefanny packthrown out of a barbratislavareflection in glasshousehold cleaning gloveswhimperingkid gangtitle appears in text on screensearching for friendsearching for missing friend (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | slasher flickindependent filmcult filmsuspensepsycho thrillerteen moviemurder mysteryteen horroramerican horror |
Themes: | murderdeathrevengefearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
Mood: | slashergorenightdarknessblood and gore |
Locations: | boatcarmotorcyclewaterwoodsrural settingpolice carlaketruck |
Characters: | slasher killerteenage boyfriendpoliceteenagerpolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driver β¦mysterious villainserial murderer (See All) |
Period: | 1970s1950ssummer |
Story: | dead teenagerextreme violencecharacters killed one by onebody countcampmaniacfirst partcabindecapitationblood splattersurprise endingfemale nudityviolencesexnumber in title β¦male nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipplesthree word titlepantiesbeatingcorpsedigit in titlefistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective camerabedroombracandleold manaxemassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterlens flareaxe murderroomkilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanfamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, β¦ but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
Subgenre: | slasher flickblack comedysupernaturalteen horrorsupernatural horrorreality spoof |
Themes: | murdersurrealismsuicideghostdrunkennessmonstergamblingsurveillanceapocalypse |
Mood: | slashergoresatire |
Locations: | lakegas stationtunnelcave in |
Characters: | teenagerboyfriend girlfriend relationshipzombiesecurity guardwitchbabe scientistself referential |
Period: | 2000s20th century1900s21st centuryyear 2009 |
Story: | person on firehorror iconblonde stereotypedead teenagerno survivorscharacters killed one by onecabindecapitationcollegeblood splatterpistolsurprise endingfemale nuditybloodflashback β¦bare chested maletelephone callshot to deathmachine gunshot in the chestshot in the headcar crashrobotf wordmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassescreaturegravecharacter repeating someone else's dialoguevirginstabbed in the backclowndiarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationgroup of friendsswat teamsevered handcovered in bloodend of the worldeaten alivecelebrationredneckcameostabbed in the throatdark humorfalling to deathstabbed in the headthrown through a windowtitle at the endstabbed in the eyeaxe murderethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbonghuman sacrificestonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagescarecrowjocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternbear trapgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakegrappling hookno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro β¦fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)
Subgenre: | slasher flickteen movieteen horror |
Themes: | murderdeathrevengepsychopath |
Mood: | slashergoreraincar chase |
Locations: | swimming poolgas stationsinging in a car |
Characters: | friendteenagerfemale protagonistserial killersecurity guardprofessormysterious killer |
Story: | lifting a male into the airdead teenagercharacters killed one by onelifting someone into the airfirst partdecapitationcollegevomitingblood splatterpistolsurprise endingviolencebloodflashbackgun β¦sex scenesingingpartychasecorpsecomputerfalling from heighttelephonejournalistbound and gaggedcandlestrangulationaxedeath of friendbridgeimpalementradioroommateproduct placementlightninghangingsuspiciongothicheavy raintied to a bedstabbed in the stomachvillainessjournalismparking garagefemale killerjanitorrear entry sexthunderstormrainstormaxe murdercar troubleurban legendscene before opening creditsfemale psychopathradio stationspreadeaglefraternitybody in a trunkscalpelcampusdisc jockeycollege campusorchestral music scoregoth girloff screen murdervillain not really dead clichered herringmicrowave ovenpoodledorm roomfall to deathfemale serial killermicrowavepepsitalk radioradio hosthanged boyconvicted felondark and stormy nightchat roomsource musicyelling for helproommate issuesdead body in a car trunkradio talk showshot with a guncollege roommatecry for helpcall for helploss of best friendcrying for helpbody in a car trunksinging along with radiostuck during sexwest highland white terrierkilled in a carradio call in showfalse scareradio callerthrown through windshieldannoying roommate (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | survival horrorslasher flickindependent filmcult filmblack comedysuspensetragedypsycho thrillerteen horroramerican horrorindependent horror |
Themes: | deathmurderfriendshipkidnappingfeartortureescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation β¦paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | ambiguous endingslasheravant gardedarkness |
Locations: | cemeterycarkitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | slasher killerteenage boyteenage girlfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipserial killerhostagekillervillainterrorself mutilationtruck driver β¦serial murdererself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | lifting a female into the airdead teenagercharacters killed one by onebody countlifting someone into the airmaniacfirst partsurvivaldecapitationcollegevomitingblood splattersurprise endingviolenceblood β¦photographknifechasevoice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightsunglassesrunninglow budget filmfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckchainsawropegothicgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdisturbinggeneratorstate in titlebonesruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | slasher flickindependent filmcult filmdark comedycreature featuresadistic horror |
Themes: | deathmurdersurrealismkidnappingrapejealousyfeartorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness β¦sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | slashergorerainnightmare |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | slasher killerfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | person on fireno survivorstorso cut in halftourlifting someone into the airmaniacblood splatterfirepistolsurprise endingbloodviolencenumber in titleflashbackbare chested male β¦dancingphotographknifechasebeatingdreamcorpsedigit in titleshot to deathcar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialoguecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directorpoemtv newsundergroundmass murdertape recordertied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequinhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapisttv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | deathmurderrevengesuiciderapetorturepsychopathinsanityevilcannibalismrape and revenge |
Mood: | slashergore |
Locations: | desertwaternew mexico |
Characters: | slasher killerserial killervillainterror |
Period: | year 2007 |
Story: | extreme violencedeformitytorso cut in halfbody countcampmaniacsurvivalblood splatterfirepistolsurprise endingfemale nuditynuditybare breastssequel β¦fightexplosionlickingcorpseshot to deathshot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilgay slurstabbingarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murderkilling spreenude woman murderedpsycho killerfemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathgraphic violencestabbed in the facedrillunwanted pregnancybloody violencesadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
After an accident on a winding road, four teens make the fatal mistake of dumping their victim's body into the sea. But exactly one year later, the dead man returns from his watery grave and he's looking for more than an apology.
Subgenre: | slasher flickcult filmteen movieteen horror |
Themes: | murderrevengedrunkennesspsychopathblackmailguilt |
Mood: | slasherhigh school |
Locations: | boathospitalbeach |
Characters: | slasher killerteenage boyteenage girlteenagermother daughter relationshipboyfriend girlfriend relationshipserial killersister sister relationshipfisherman |
Period: | 1990s |
Story: | dead teenagercharacters killed one by onefirst partstorytellingcollegesurprise endingtitle spoken by characterbloodbased on novelbare chested malephotographchasecorpseblondepunched in the face β¦bikinisecretfalling from heightlettercleavagedeath of friendstabbed to deathstabbed in the chestscantily clad femalehit by a carunderwater scenepolice officer killedcharacter repeating someone else's dialoguelocker roomfirst of seriescharacter's point of view camera shotcover updeath of brotherreunionsuspicioncharacter says i love youclaim in titleoverallsblockbustersevered handparadefestivalhaircutunderage drinkingtitle appears in writingdeath of sisterfemale in showerreckless drivingmale in showerstorehiding in a closeturban legenddisposing of a dead bodybeauty pageantwhodunitbody in a trunknorth carolinacrabfourth of julyseason in titlestupid victimbreaking a mirrorhookmanslaughterman wearing towelno endingbeauty contestaliastiarareference to mother teresastabbed through the chinwriting on mirror (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | slasher flickcult filmcoming of ageblack comedysuspenseconspiracypost modernteen movieteen horrorpsychological thrillerhorror spoof |
Themes: | murderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | slashergoresatirehigh schooldarkness |
Locations: | school busforestsmall townwoodskitchenpolice station |
Characters: | slasher killerteenage boyteenage girlfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistserial killervillain β¦sheriffsingle fatherself referential (See All) |
Period: | 1990s |
Story: | dead teenagercharacters killed one by onelifting someone into the airfirst partsurvivalblood splatterfirepistolsurprise endingtitle spoken by characterone word titlebloodviolencef ratedbare chested male β¦cigarette smokingpartyknifechasecell phonecorpseshot to deathcar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerafoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinegroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportermasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned carhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | slasher flickindependent filmcult filmpsycho thrillerteen movieteen horroramerican horrorholiday horror |
Themes: | deathmurderfearcorruptionpsychopathparanoiaevilmurder of family |
Mood: | slasherhigh schoolnight |
Locations: | carsmall towncar theftkitchen knife |
Characters: | slasher killerteenage boyteenage girlhusband wife relationshipteenagerboyfemale protagonistgirlserial killerlittle girlkillerlittle boyvillainpsychiatristterror β¦doctor patient relationshipserial murderer (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | lifting a male into the airdead teenagerbody countlifting someone into the airmaniacfirst partblood splattersurprise endingtitle spoken by characterone word titlefemale nudityviolencenuditydoggun β¦cigarette smokingknifeshot to deathshot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationstabbingthroat slittingstabbed to deathchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingmurdererhandgunkillingpot smokingteen angstbulletelectronic music scorebabysittermutilationstabbed in the stomachblockbusterpsychogrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phoneheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadewoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | slasher flickindependent filmcult filmpsycho thrillerteen horroramerican horror |
Themes: | deathmurderdrugspsychopathparanoiainsanityevilabductionalcoholism |
Mood: | slasherhigh schoolnightmare |
Locations: | schoolsmall townelevatorkitchentruck |
Characters: | slasher killerteenage boyteenage girlfamily relationshipspolicemother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipgirlserial killernursepolicemansecurity guardalcoholic β¦villainsecretaryterrormysterious villain (See All) |
Period: | 1990syear 1998 |
Story: | lifting a male into the airdead teenagercharacters killed one by onebody countlifting someone into the airmaniacdecapitationpistolbloodviolencenumber in titlesequelknifechasecar accident β¦falling from heightmaskbirthdaydead bodyneighborhallucinationtelephonesubjective cameragood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancestabbingdeath of friendthroat slittingstabbed to deathtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityevil manactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinesurvivorrageloss of friendhidingpsychovictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdoor belllifting an adult into the airsadisticboogeymanjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
When a bumbling pair of employees at a medical supply warehouse accidentally release a deadly gas into the air, the vapors cause the dead to re-animate as they go on a rampage through Louisville, Kentucky seeking their favorite food, brains.
Subgenre: | survival horrorindependent filmcult filmblack comedypunk |
Themes: | deathsuicidedeceptioncannibalismblindnessmurder of a police officer |
Mood: | goreone night |
Locations: | cemeteryhelicopter |
Characters: | policezombiemilitary officer |
Period: | 1980s |
Story: | person on fireno survivorstorso cut in halffirst partdecapitationvomitingblood splatterpistolsurprise endingfemale nuditybloodfemale frontal nuditydogchase β¦shot to deathmachine guncar accidentshot in the chestshotgunwritten by directormassacreambulanceexploding carsevered headcultpart of serieshit by a carstrippingbusinessmanstripteasefirst of seriesskeletonconvertiblebasementsevered armdismembermentundeadmissilefalling down stairsburned alivewarehouseelectronic music scoreloss of friendexploding buildingeaten aliveswitchbladestabbed in the headstairsthunderstormjumping through a windowatticsiegenude woman murderedliving deadhit in the facecremationdead animalacidburnt faceparamedicbitten in the neckdisembodied headnaked dead womansan diego californiachapelarm cut offpsychotronic filmsledgehammerbarrelmortuarynuclear weaponmorticianthroat rippingpick axecrushed by a carcrematoriumcadaverpoison gasexposed brainsplit in twolouisville kentuckyhead chopped offripped in halfrigor mortisoffice clerkbody in a bag (See All) |
Three female college students take a detour from their partying, enticed by a beautiful European woman who promises seclusion, safety and maybe even romance. What they get is a living hell where they are sold to the highest bidder who's fondest wish is to kill them slowly. Hostel 2 also follows 2 Am β¦erican men who, on the flip side of the coin, are willing to pay to join an exclusive club where a life will end at their hands...any way they like. It's a story of human monsters and the almighty dollar as only Eli Roth could tell it. (Read More)
Subgenre: | slasher flickpsycho thrillersadistic horror |
Themes: | lesbianismmurderdeathkidnappingtorturearttravelpsychopathsadismevilcannibalism |
Mood: | slashergore |
Locations: | train |
Characters: | slasher killerchildrentattooprostituteamerican |
Story: | extreme violenceunsubtitled foreign languagedecapitationcollegeblood splattersurprise endingfemale nudityviolencebloodsequelfemale frontal nudityflashbackmale frontal nudity β¦dogknifedreamcorpsesecond partbound and gaggedthroat slittingtied to a chairsevered headfemme fataleelectrocutioneuropechainsawgolfmachetenude modelanimal attackeaten alivepassportbarefootball gaggash in the facedark humormurder of a childtitle at the endcastrationtied feetbloodbathauctionvideo surveillancereturning character killed offspit in the facepraguestandoffhanging upside downsawbleeding to deathtied up while barefootdog attackmurder of a nude womanscythesevered footdepravitybloody body of a childevil childtortured to deathtorture chambercountesscircular sawhostelsevered penisstrong sexual contentkilled in an elevatorchild shot in the headslovakiaugly americanstabbed in the earkilled by a dogbathorytied up nakedyouth hostelreference to elizabeth bathory (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
Subgenre: | survival horrorcult filmcreature featurebritish horror |
Themes: | deathmurderfriendshiprevengeinfidelitybetrayalghostdrinkingfearescapemonsterbrutalityguiltgriefpanic β¦cannibalismblindnessmurder of familyclaustrophobia (See All) |
Mood: | gorenightmare |
Locations: | hospitalforestcarwoodscavecave in |
Characters: | friendhusband wife relationshipfemale protagonistbest friendlittle girl |
Story: | lifting a female into the airlifting someone into the airfirst partcabinneck breakingsurvivalvomitingblood splattersurprise endingbloodviolencef ratedtwo word titlephotographknife β¦cryingbeatingcorpsecar accidentblondefalling from heightbookliehallucinationflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenecreaturenecklacesmokingbeaten to deathdolldarkisolationunderwaterwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorgroup of friendsvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidbonesinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
A double-bill of thrillers that recall both filmmakers' favorite exploitation films. "Grindhouse" (a downtown movie theater in disrepair since its glory days as a movie palace known for "grinding out" non-stop double-bill programs of B-movies) is presented as one full-length feature comprised of two β¦ individual films helmed separately by each director. "Death Proof," is a rip-roaring slasher flick where the killer pursues his victims with a car rather than a knife, while "Planet Terror" shows us a view of the world in the midst of a zombie outbreak. The films are joined together by clever faux trailers that recall the '50s exploitation drive-in classics. (Read More)
Subgenre: | slasher flickcult filmblack comedyb movieholiday horror |
Themes: | lesbianismmurderdeathfriendshiprevengeghostjealousyescapeextramarital affairpsychopathsupernatural powersadismexploitationcannibalismmurder of a police officer |
Mood: | slashergorecar chaseblood and gore |
Locations: | hospitalbarbeachrestauranthelicoptermotorcycleelevatorstrip clubmexicokiller car |
Characters: | teenage boyteenage girlmother son relationshipfather daughter relationshipdoctortattoobrother brother relationshipzombiesoldierserial killernursepriestactresssingle mother β¦killersherifftruck driver (See All) |
Period: | year 2007 |
Story: | person on firedeformitymaniacdecapitationfiretitle spoken by characterone word titleviolencebloodf ratedfemale frontal nuditysex sceneinterracial sex β¦shootoutshot to deathunderweartesticlesmachine guncar accidentshot in the headfalling from heightmarijuanagood versus evilstabbingbridgestabbed to deathdinerstabbed in the chestexploding carapologysevered headman with glassesassassinationhit by a cardouble crossshot in the legmarriage proposalshot in the foreheadracial slurbeaten to deathstabbed in the backringattempted rapescarcheerleaderfilm within a filmexploding bodybasementpremarital sexsevered armshot in the armdismembermentwerewolfsyringekilling an animalmachetewoman with glassesbabysittercookmad scientistmorguedrug abuseexploding buildingassaultgrindhouseparadeend of the worldinterracial friendshipeaten alivetensionsevered fingerloss of sonstabbed in the neckshot in the faceexploding headassault rifleinfectiondisfigurementsiegestabbed in the eyebarbecuecastrationsevered leggatling gungrenade launcherthanksgivingtext messagingserial murdercar troublestabbed in the handhomagehead blown offexotic dancerhuman monsterjukeboxhomicidal maniacold flamecameo appearancetennesseehit by a truckmilitary basesaxophoneretrotrampolinedirector also cinematographerflesh eating zombiedisc jockeywalking deadstuntmanbroken neckchild with gunaustin texasunwed pregnancyfake commercialmakeup artistbroken handfake trailerdirected by several directorsmultiple cameosanthropophaguswooden legthermometercinephiliachemical weaponsripped in halfaccidental suicidenazi experimentintentional goofmelting manreal twins playing twinsfilm breakon hood of moving car (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | slasher flickpsycho thriller |
Themes: | murderdeathrevengetorturedrunkennesspsychopathbrutalitydeath of motherevilmurder of a police officer |
Mood: | slashergoredarknesshorror movie remake |
Locations: | school busboatforestmotorcyclebathtubbicyclewaterwoodspolice carlakecampfiretunnelbackwoodssex in a tent |
Characters: | teenage girlafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
Period: | 1980s |
Story: | deformitycharacters killed one by onebody countcampmaniaccabindecapitationblood splatterfirepistolsurprise endingfemale nudityviolencebloodnudity β¦number in titlebare breastsfemale frontal nuditymasturbationdogbare chested malesex scenefemale rear nuditynippleschasetelephone calltopless female nuditywoman on topcorpsedigit in titleurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingflashlightbracandlestrangulationtoplessaxemassacrevideo camerastabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockspsychocovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyeaxe murdersevered legarrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting bloodtelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.
Subgenre: | survival horrorcult filmdisaster film |
Themes: | murderdeathfriendshiprevengepregnancyescapemilitarydeath of fatherinsanityexecutionself sacrificehuntingmurder of a police officermurder of familyghost town |
Mood: | ambiguous endinggorehigh schoolhorror movie remake |
Locations: | school busboatswimming poolhelicoptersmall townbusdesertrural settingpolice stationfarmpolice carlaketruckgas stationcar explosion β¦fire truckhumveetruck accidentcountry doctorcity on fire (See All) |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipdoctorzombiesoldiersecretarysheriffmayor |
Story: | person on fireswampsurvivalblood splatterfirepistolsurprise endingviolencebloodbare chested malefightexplosionknifecell phoneshootout β¦corpseshot to deathmachine guncar accidentshot in the chestface slapremakeshot in the headshotgunrescuepunched in the facecomputerrifleheld at gunpointrevolvershot in the backf wordbound and gaggedstrangulationmassacreambulancedeath of friendarmyimpalementstabbed to deathdinerstabbed in the chesttied to a chairexploding carno opening creditschild in perilcoffeeshot in the foreheadon the runfugitivecover uptankscene during end creditsfarmerdeath of husbandhandgunarsonchild murderriotdiseasevirusbarnjail cellwalkie talkiehuntermorguenosebleedgenocidegas maskpump action shotgunu.s. armystabbed in the throatchaosgash in the facepolice officer shotcigarette lighterassault rifleconcentration campinfectionautopsyparachuteblood on shirtbulletproof vestgasolinefemale doctormutationburned to deathflat tirefirefightersatelliteshot through a windowdementiastabbed in the handhiding in a closetepidemicpolice officer shot in the chestlockerhomicidal maniacplane crashdouble barreled shotguncar washcornfielddeputyhand over mouthwhistlingroadblockbaseball gamedeath of boyfriendstabbed in the shoulderquarantinefuneral homeopen endedoverturning carpitchforkiowanuclear explosionhouse on firebaseball fieldmortuarytrancekeystruck stopmushroom cloudcar wreckflame throwerbiological weaponset on firebottled waterhazmat suitcircular sawhigh school principalburning cargovernment coveruphanged womanlaundry drying on clothes lineno cellphone signalcatatoniamarshamerican midwestchain link fenceweird behaviorinfectious diseasemouth sewn shutcatatonic statemaniacombine harvestergift shopcontamination suiteyes sewn shutatomic explosionsemiautomatic riflestabbed with a pitchforkharvesterdead pilotknife through handfemale physicianpull the plugsatellite imageshadowy figureexposure to radiationfugitive herowheel bootwooden match (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | slasher flicktragedypsycho thrilleramerican horror |
Themes: | deathmurdersuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismevilhome invasionpolice investigationmurder of a police officer β¦mysterious death (See All) |
Mood: | slashergoredarknessblood and gore |
Locations: | small townstrip club |
Characters: | slasher killerteenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillervillainpsychiatristsheriffterrorserial murderer |
Period: | 1970s |
Story: | lifting a female into the airextreme violencecharacters killed one by onebody countlifting someone into the airmaniacblood splatterpistoltitle spoken by characterfemale nuditybloodviolencesexmale nudityfemale frontal nudity β¦female rear nudityfemale full frontal nudityphotographknifechasewoman on topbeatingcorpseremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbroken armduct tapekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitaldisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | survival horrorblack comedysuspensesuperherotragedypsycho thrillerteen horrorpsychological thrilleramerican horror |
Themes: | deathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeceptionvoyeurismpsychopathdeath of father β¦brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | slasher killerteenage girlfather daughter relationshipteenagerafrican americandoctorpolice officerserial killerhostagekillersecurity guardvillainpsychiatristterroruncle niece relationship β¦serial murdererpolice dog (See All) |
Period: | 2010s |
Story: | dead teenagertorso cut in halfcharacters killed one by onebody countmaniacsurvivalsurprise endingtitle spoken by characterone word titlebloodviolencesequelflashbackdogbare chested male β¦dancingpartyknifechasepantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective cameraorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastkilling spreechloroformpsycho killerhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)
Subgenre: | tragedypsycho thriller |
Themes: | deathmurderrevengesuicidekidnappingrapetorturepsychopathdeath of fatherbrutalitydeath of mothersadismevildeath of wifecannibalism β¦self sacrificemadnessmurder of familyghost town (See All) |
Mood: | slashergorehorror movie remake |
Locations: | desertcavegas stationsuv |
Characters: | teenage boyteenage girlfamily relationshipsbrother sister relationshipserial killerbabykillervillainterror |
Period: | year 2006 |
Story: | person on fireextreme violencedeformitybody countmaniacfirst partblood splatterpistolsurprise endingbloodviolencedogcar accidentshot in the chestshot in the head β¦shotgunfalling from heightcar crashrevolverfoot chaseaxeimpalementstabbed in the chestexploding carsevered headcontroversyshot in the foreheadstabbed in the backvacationevil manbaseball batamerican flagglassesmurderersevered armdismembermentkillingsplatterclaim in titleburned alivekilling an animalmutantragemutilationwalkie talkievictimrapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailermineaxe murdermutationsevered legkilling spreedeath of loved onemannequinserial murderpsychopathic killerbad guyhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violencehomicidal maniacexploding truckbitten in the neckburnt bodyminersiblinggraphic violencestabbed in the facecut into piecesbloody violencestupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j β¦ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | survival horrorslasher flickindependent filmcult filmsadistic horror |
Themes: | murderkidnappingmarriageinfidelitytortureescapeextramarital affairpsychopathcancerinsanityhome invasionclaustrophobiaself harm |
Mood: | slashergorecar chase |
Locations: | hospitalhotelurban setting |
Characters: | husband wife relationshippolicefather daughter relationshipdoctorserial killerdetectivephotographerhostagekillerpolice detectiveself mutilation |
Story: | person on fireextreme violencebody countfirst partpistolsurprise endingone word titleviolenceflashbackguncorpseshotguncamerasecretbathroom β¦revolverbound and gaggedthroat slittingstabbed to deathtoiletchild in perilpolice officer killedclownpuppetpoisonburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedmacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | murderdeathrevengefearpsychopathbrutalityinsanitysadismevilexploitationpolice investigation |
Mood: | slashergorerainnightmarenightdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | slasher killerpolicemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrormysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | extreme violencecharacters killed one by onebody countlifting someone into the airmaniacdecapitationblood splattersurprise endingfemale nuditybloodviolencesexnumber in titlebare breastssequel β¦female frontal nuditykissdancingchasepantiesdigit in titledead bodylow budget filmnumbered sequelsubjective camerasword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexchainsawmachetemutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyeaxe murderfifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headgraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | deathmurderfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | slashergorenightmarecar chasenightdarknessblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | slasher killerteenage girlfriendfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipfemale protagonistserial killerstudent β¦best friendkillervillainterrorfrenchbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | extreme violencecharacters killed one by onebody countmaniacsurvivaldecapitationblood splattersurprise endinglesbian kissfemale nuditybloodviolencef ratedbare breasts β¦female frontal nudityflashbackmasturbationdogguncigarette smokingphotographknifechaseshowertelephone calldreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameraflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultkilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanmurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh β¦erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)
Subgenre: | slasher flickb movie |
Themes: | deathmurderrevengevoyeurismmurder of a police officer |
Mood: | slashergorerain |
Locations: | cemeterybarpolice stationroad triptexas |
Characters: | slasher killerfather son relationshipbabylawyerkillerinterracial relationshipsheriffcousin cousin relationshipmayoryounger version of character |
Period: | 1990s1970s |
Story: | person on firehorror icontorso cut in halfcharacters killed one by oneblood splatterpistolfemale nuditybloodnuditybare breastssequelfemale frontal nudityflashbackbare chested malephotograph β¦pantiestopless female nudityshootoutcorpseshot to deathshot in the chestremakeshot in the headshotgunslow motion scenecar crashdead bodyvoyeurshot in the backcleavagehalloweenfoot chasebound and gaggedmassacremansionstabbingimpalementstabbed to deathstabbed in the chestsevered headscantily clad femalehit by a cargraveyardnecklaceshot in the foreheadblack pantiescharacter repeating someone else's dialoguebeaten to deathstabbed in the backknocked outkicked in the facescarfemale removes her clothesdismembermentcorrupt copbralessgirl in pantieschainsawfalling down stairssupermarketrevelationscene during opening creditsbarnstabbed in the stomachsevered handcarnivalhitchhikermasked manduct tape over mouthpump action shotguninterracial romancebra and pantiessevered finger3 dimensionalpool tablescene after end creditssevered legchainfifth partmasked killermarijuana jointliving deadreturning character killed offmolotov cocktailgateplaying pooldouble barreled shotguninterracial kissnude girlhead bashed indeputywoman in bra and pantiesferris wheelwoman wearing only a man's shirtcrotch grabgraphic violencedeath of grandmothercheating boyfriendslaughterhousecut into pieceshit with a hammerpsychotronic filmhouse firebonegrindhouse filmhatchetvinylwoman wearing black lingerieangry mobtrail of bloodshot through a wallhidden doorwine cellarmidnight moviesevered facetape over mouthduct tape gagbreast kissingchain link fencechainsaw murderblack man white woman relationshipwoman undressing for a manmeat grinderhung from a hookachilles tendon cuthacked to deathdead body in a freezerleatherface3d sequel to 2d filmopen graveskinningwearing human skinadopted girlretconstabbed with a pitchforkblood trailblack man white woman kissblack man white woman sexgroup photographhiding in a coffin (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | slasher flickcult filmsuspensepsycho thrilleramerican horrorholiday horror |
Themes: | deathmurderjealousyfeartorturevoyeurismmemoryseductionpsychopathbrutalityobsessionparanoiainsanityblindnesstrauma β¦madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
Mood: | slashergorenightdarkness |
Locations: | hospitalcarsmall townwheelchairpolice carhospital fire |
Characters: | slasher killerteenage girlpoliceteenagerboyfriend girlfriend relationshippolice officerserial killernursedetectivepolicemankillervillainsheriffterrorserial murderer |
Period: | 1970syear 1978 |
Story: | person on fireextreme violencecharacters killed one by onebody countlifting someone into the airmaniacblood splatterfirefemale nuditybloodviolencesexnuditynumber in titlemale nudity β¦bare breastssequelmale rear nuditytwo word titlekissfemale rear nuditycigarette smokingnipplesexplosionknifechasetelephone callcryingcar accidentshot in the chestblondewatching tvkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulancestabbingthroat slittingstabbed to deathaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologuescreaminguniformpoisoncharacter's point of view camera shotproduct placementcollege studentscreaminjectionstalkingglasseswitnesstrapmurderersplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractioncowboy hatmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychogrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebroken glassbutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastdead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerpsycho killerflat tirefemale stockinged feetdead girlserial murderpsychopathic killerbad guyconfusioncar troublemadmanmysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonehomicidal maniacsuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichebutcherygrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Paleontologist Kate Lloyd is invited by Dr. Sandor Halvorson to join his team who have found something extraordinary. Deep below the Arctic ice, they have found an alien spacecraft that has been there for perhaps 100,000 years. Not far from where the craft landed, they find the remains of the occupa β¦nt. It's cut out of the ice and taken back to their camp but as the ice melts, the creature reanimates and not only begins to attack them but manages to infect them, with team members devolving into the alien creature. (Read More)
Subgenre: | survival horrorbody horror |
Themes: | deathmurdermonsterdeceptionparanoia |
Mood: | gore |
Locations: | snowlaboratoryshed |
Characters: | doctoralienbabe scientist |
Period: | 1980syear 1982 |
Story: | person on firesplit headcharacters killed one by onecampblood splatterfirepistolsurprise endingtitle spoken by characterblooddogtwo word titleexplosionchasecorpse β¦shot to deathshot in the headfalling from heightscientistflashlightaxeimpalementstabbed to deathstabbed in the chestno opening creditsspaceshiptransformationscene during end creditsexploding bodyisolationsuspicionsevered armsubtitled scenesabotagegrenadeburned alivekilling an animalautopsyaerial shotlens flaremutationflamethrowerprequelflarehelicopter crashlanguage barriertentaclewrist slittingtestsole black character dies clichemicroscopeclawshapeshiftingdrillglacieralien creatureantarcticascientific researchhelicopter pilotsnowstormflame throwerfrozen bodyimitationfalling through icenorwegianoutpostbell 206 jet ranger helicopterassimilationsuspended animationpaleontologistshape shifting alienhusky dogfrozen alivehorror movie prequelmale wearing an earringtooth ripped outironic endingprequel to remakesikorsky hh 53 jolly green giantnorwegian flagpolar research station (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | cult filmsuspenseb horrorpsycho thrilleramerican horrorindependent horror |
Themes: | deathmurderfearpsychopathbrutalityinsanityevilexploitation |
Mood: | slashergoredarkness |
Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
Characters: | slasher killerteenagerboyfriend girlfriend relationshipserial killerkillervillainterrormysterious villainserial murderermysterious killer |
Period: | 1980ssummeryear 1984 |
Story: | lifting a female into the aircharacters killed one by onebody countcamplifting someone into the airmaniacdecapitationblood splattersurprise endingfemale nuditybloodviolencesexnumber in titlesequel β¦female frontal nudityflashbackkissfightnipplespantiestelephone callcorpsedigit in titleblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelsubjective cameraswimmingbrastrangulationmassacrethroat slittingimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotevil manopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexkillingsplatterchesschainsawfireplacespearnipples visible through clothingmass murdergothicmacheteragemutilationvillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorlens flarekilling spreepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killerbad guycar troublemadmanmysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violencehomicidal maniacslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbingtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks β¦the colonists in a whole new environment. (Read More)
Subgenre: | absurdismindependent filmmartial artsblack comedysuspensedark comedyb moviefish out of waterteen horror |
Themes: | deathmurderfearescapemonstermilitarypsychopathbrutalitysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia |
Mood: | ambiguous endingslashergore |
Locations: | woodslakeouter spacelaboratoryspace stationresearch stationship explosion |
Characters: | teenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyvillainteacher student relationshipprofessorterrorengineerbabe scientist |
Period: | 2000s |
Story: | extreme violencetorso cut in halfcharacters killed one by oneneck breakingsurvivaldecapitationblood splatterfirepistolsurprise endingfemale nudityviolencebloodcharacter name in titlenumber in title β¦sequelfemale frontal nudityflashbackbare chested malesex scenekissfightnipplesexplosionknifechasebeatingcorpseshot to deathfistfightmachine gunshot in the chestface slapshot in the headshotgunrescuepunched in the facecomputerfalling from heightmaskshowdownrifleheld at gunpointhand to hand combatnumbered sequelrobotkung fuscientistshot in the backflashlightambushstrangulationmassacrethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotstalkerbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timeevil mankicked in the facetough girlinjectionstalkingexploding bodythreatened with a knifemercenarysevered armlove interestkissing while having sexdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatmutilationroman numeral in titlestabbed in the stomachspacecraftsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadandroidmasked manpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramslaughterdisfigurementknife throwingfemale doctorsevered legtank topmasked killergatling gunshot multiple timesgrenade launcherlaser guntracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shouldermicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimmurder of a nude womanarmy basemass murdererstupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Subgenre: | black comedyteen movieteen horror |
Themes: | deathmurderrevengebetrayalfearescapedeceptionparanoiaguiltnear death experience |
Mood: | slashergorenightmare |
Locations: | boatcemeteryhospitalbarrestaurantchurchswimming poolhotelhelicoptersmall townairplanenightclubairportkitchenstorm β¦singing in a car (See All) |
Characters: | friendfather son relationshipteenagerboyfriend girlfriend relationshipdoctorserial killernursemaidfisherman |
Period: | 1990syear 1988 |
Story: | characters killed one by onelifting someone into the airsurvivalcollegevomitingblood splatterpistolsurprise endingbloodviolencesequelflashbackbare chested malefightdancing β¦knifechaseshowercorpseshot to deathfistfightcar accidentshot in the chestrescuepunched in the facebikinibrawlshowdownsecond partmarijuanahallucinationislandrevolvercleavageambushaxedeath of frienddrug dealerimpalementstabbed to deathstabbed in the chestfalse accusationno opening creditsdream sequencescantily clad femaleroommatebartenderattempted murdercharacter repeating someone else's dialoguestabbed in the backscreamingpay phonevacationrace against timecollege studentlightninggymthreatened with a knifefireplacespearheavy rainlooking at oneself in a mirrorkicked in the stomachpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facestabbed in the throatpower outagepunched in the stomachbroken glasskaraoketitle appears in writingstabbed in the headstabbed in the legaccidental killingatticrainstormpierlens flaresequel to cult favoritevoodoofemale in showermannequinengagement ringtombmarijuana jointyellingstabbed in the handconfessionalcomic reliefstonerradio stationhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshophiding under a bedfourth of julyseason in titlefemale bartenderreference to richard nixonstupid victimvillain not really dead clichetoothbrushhookarm slingred herringno endingfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodstabbed in the foothotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerdark and stormy nightfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | murderdeathdrugsrapetortureincestpsychopathbrutalityinsanityevilexploitationmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | slasher killerbrother sister relationshipprostituteserial killerkillervillainterrormysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | extreme violencebody countmaniacneck breakingdecapitationblood splattersurprise endingfemale nuditybloodviolencecharacter name in titlenuditybare breastsgun β¦shot to deathshot in the chestlow budget filmmarijuanacriminalbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingdismembermentkillingsplatterfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanvideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | slasher flickcult filmsupernaturalparanormalparanormal phenomenateen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | deathmurderfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurismpsychopathbrutalitysupernatural powerparanoia β¦sadismevilpanicmysterious deathshower murder (See All) |
Mood: | slashergorerainhigh schoolnightmaredarknesspoetic justice |
Locations: | school busbarschoolswimming poolsmall townbusdesertbaseballstormgay barbus driverabandoned factoryschool bus driver |
Characters: | slasher killerteenage boyteenage girlfriendfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationship β¦teachergirlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | person on firehorror iconlifting a male into the airbody countlifting someone into the airmaniacblood splatterfiresurprise endingbloodviolencecharacter name in titlenuditynumber in titlemale nudity β¦sequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartyknifechaseshowertelephone callcryingdreamdigit in titleunderwearface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomcharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musicjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classicburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting faceexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | slasher flickindependent filmblack comedysuspensepsycho thrillerpsychological thrillerholiday horrorchristmas horror |
Themes: | deathmurderrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessescapeinvestigationdeceptionlonelinesspsychopathobsession β¦paranoiainsanitymental illnesssurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
Mood: | slashergoreneo noircar chasedarknessone night |
Locations: | new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice |
Characters: | slasher killerpolicefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectivemysterious villain |
Period: | winter |
Story: | person on firecharacters killed one by onebody countmaniacsurvivalblood splatterfiresurprise endingone word titleviolencebloodnumber in titledogfightexplosion β¦partyknifechasetelephone callcryingcell phonehigh heelsbeatingcorpsedigit in titlefistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagefoot chasenewspaperflashlightbound and gaggedwinestrangulationaxevideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playerholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
When Wendy Christensen has a vision of an accident on the roller coaster, resulting in her and her friends' deaths, she instantly begins to panic and gets off the ride, causing a few of her friends to get off as well. The remaining friends, including Wendy's boyfriend, are stuck on the roller coaste β¦r and find themselves involved in the accident. With death waiting around the corner, Wendy and Kevin Fischer must try and work out death's plan, before they and the remaining survivors end up dead. (Read More)
Themes: | deathfuneralvoyeurismsupernatural powerguiltsadismcheating death |
Mood: | gorerain |
Locations: | new york citytruck accident |
Characters: | teenage girlbest friend |
Story: | person on firedead teenagerno survivorstorso cut in halfcharacters killed one by onedecapitationblood splatterfiresurprise endingfemale nuditybloodviolencesequelfemale frontal nuditydancing β¦photographexplosionpantiesdreamhorsecar accidentblondeshot in the headcomputercamerafalling from heightcar crashvoyeurmanhattan new york citycleavagevideo cameraambulanceimpalementsubwaysevered headscantily clad femalethird partelectrocutionmini skirtscreamskeletonconvertiblegymtragic eventratobscene finger gesturefireworksgirl in pantiespickup truckwolfburned aliveno pantiesheavy rainloss of friendfatecrushed to deathcannonfannippleamusement parkexploding headpanties pulled downshadowtrailerfortune tellerworld trade center manhattan new york citypigeongothgraduationhysteriacremationpink pantiesblue pantiesthong pantiesroller coasterpremonitionferris wheelkitelocked doorcrushed headcoincidencewarningjockdeath of boyfriendburnt bodyclueacoustic guitartheme parkscaregoth girlscytheimmolationextremetarot cardforkliftsignnail gundigital camerabodily dismembermentgrave side ceremonyhelium balloonloss of boyfriendfreak accidentsparklerlifting weightstrain crashwind chimehand cameratanning beddrive thrucannonballfootball practicehorseshoealternate endingvision of the futuredizzinesstrain derailmentflipping a cointanning salondesk bellsparksnarrow escapeforgeslurpingpopping balloonsoccer practiceapprehensionforeshadowgust of windhonking a hornrunaway vehiclevisible thong straps (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | slasher flickindependent filmcult filmsuperherosupernaturalparanormalstop motion animationbody horroramerican horrorurban fantasy |
Themes: | deathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism β¦eviltrauma (See All) |
Mood: | slashergorenightmare |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | slasher killerfriendfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernurse β¦babyartistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfathercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | horror iconlifting a male into the airlifting a female into the aircharacters killed one by onebody countlifting someone into the airmaniacblood splatterpistolsurprise endingfemale nuditybloodviolencesexf rated β¦nuditybare breastssequelflashbackbare chested malegunfemale rear nudityphotographpartyknifechaseshowertelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framewaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalegay stereotypeasylumfifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someoneplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classicfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedingcomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
When detective Eric Matthews is called to a crime scene of a victim of Jigsaw, he finds a lead to the place where he is hidden. Once there, he realizes that Jigsaw trapped his son Daniel Matthews with three women and four men in a shelter, and they are inhaling a lethal nerve gas. If they do not use β¦ an antidote within two hours, they will die. Eric follows with increasing desperation the death of each member of the group in monitors, while trying to convince Jigsaw to release his son. (Read More)
Subgenre: | survival horrorsadistic horror |
Themes: | murderdeathkidnappingtorturebrutalitydrug usecancersadismpanicdrug addictionpolice brutality |
Mood: | gorenightmare |
Locations: | bathtubelevator |
Characters: | father son relationshippolicepolice officerserial killerdetectiveself mutilation |
Story: | lifting a female into the aircharacters killed one by onelifting someone into the airvomitingblood splatterfirepistolsurprise endingbloodviolencesequelflashbackbare chested malecorpseshot to death β¦shot in the headslow motion scenesecond partflashlightdrug dealerthroat slittingimpalementsuicide attempttoiletstabbed in the chestchild in perillatex glovesargumentdrug addictelectrocutionbaseball battrapheroinarsoncorrupt copsyringeburned alivehypodermic needlegothictape recordercrying womanvillainesscrying manbroken legmale underwearsurveillance camerajunkiespecial forcessafebooby trapblood on shirtpolice raidjuvenile delinquentgothneedleshoutingmind gameshot in the eyedripping bloodrazor bladesawcowardcop killerflamepsychological torturespitting bloodman on firesole survivorracial stereotypetrapdoorsevered footcrooked copvcrknife in the chestantidoteevil dollcrematoriumoxygen maskbodily dismembermentbroken fingerlifting an adult into the airgame of deathfurnaceboxer briefsflamespig maskviolence against a childtorture deviceplaying godviolent copnerve gasvillain escapesfamous themeneedlesthroat slit (See All) |