Please wait - finding best movies...
Dr Victor Frankenstein dies frozen to death and the creature buries him at the cemetery of his family. However he is attacked by demons but he kills one of them and Gargoyles save him and take him to a Cathedral where the Gargoyles Order gathers. The Queen of the Gargoyles Leonore keeps Dr. Frankens β¦tein's journal together with the treasures of the Order and gives the name of Adam to the creature. Then she explains to Adam that there is an ancient war between the Gargoyles that are angels and demons under the command of the Prince Naberius. She also invites Adam to join the Gargoyles in the war against demons, but Adam prefers to isolate in a remote place. Two hundred years later, Adam returns and finds a modern society. Soon he learns that Naberius has the intention of creating an army of soulless corpses to be possessed by demons. The scientist Terra is researching a process to create life and Naberius is seeking Dr Frankenstein's journal to help Terra and raise his army. (Read More)
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powermurder of a police officertheatredeceptionmonstertorturebetrayalkidnappingmurderdeathsurrealismrevenge |
Locations: | train stationabandoned factorylaboratorywoodsnightclubcemeterysnowforestchurchtrain |
Characters: | babe scientistaction herowarriortough guyhostage |
Story: | dead ratsecret laboratoryfacial scarbook burningfemale warriorone man armyfrankenstein's monsterhand to hand combatbased on comic bookperson on firethreatened with a knifefoot chasereference to archangel michaeldisobey direct ordersecret war β¦crashing through a wallstitching a woundabandoned theaterthrown through a wallaurora borealis1790sstained glass windowcollapsing buildinglifted by the throatanimal testingbuilding collapsegargoylemultiple time framestitle spoken by narratorreanimationgrave diggingmaceholy waterman with no namearmorypentagramsubterraneanimmortalbladecrashing through a windowmicroscopecathedralcapebased on graphic novelfrankensteinno title at beginningworld dominationmegalomaniacsuper strengthfemale fighterjournalstick fightdriftertorso cut in halfsecret identitydemonic possessiontragic herolightfemale doctorbody landing on a carlonerjumping through a windowstabbed in the legdark heroimmortality3 dimensionaldual wieldhaunted by the pastburialexploding buildingassassination attemptspearprincequeenneck breakingopening action sceneratexploding bodybodyguardscarkicked in the facetough girlskeletoncharacter repeating someone else's dialogueelectrocutionstabbed in the backtransformationpolice officer killedcreaturefictional warno opening creditsanti herosevered headtied to a chairsubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymountainaxestrangulationambushgood versus evildecapitationscientistcombatdemoninterrogationbookfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsecell phonevoice over narrationfiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested malefightviolenceflashbackblood (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powertorturekidnappingdeathrevengemurder |
Locations: | woodssnow |
Characters: | action herowarriortough guy |
Story: | facial scarfemale warriorone man armyhand to hand combatbased on comic bookperson on firethreatened with a knifefoot chasebuilding collapsesubterraneanworld dominationmegalomaniacstick fightdrifterdemonic possession β¦stabbed in the legdark hero3 dimensionaldual wieldassassination attemptspearneck breakingexploding bodyscarkicked in the facetough girlstabbed in the backcreaturefictional warno opening creditsanti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmountainaxeambushgood versus evildecapitationcombatdemoninterrogationfalling from heightbattleslow motion scenerescueblood splatterfistfightfirechaseknifeexplosioncharacter name in titlebare chested malebloodviolenceflashbackfight (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β¦s at a terrible cost. (Read More)
Themes: | supernatural powerdeceptionbetrayalkidnappingsurrealismrevengemurderdeath |
Locations: | woodsforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatperson on firethreatened with a knifearmoryimmortalcapeworld dominationsuper strengthtragic herostabbed in the legdark heroimmortalityhaunted by the pastburial β¦spearprincescarskeletonstabbed in the backtransformationno opening creditsanti herostabbed in the cheststabbed to deaththroat slittingimpalementarmymountainaxeambushgood versus evilcombatdemonfalling from heightbattlepunched in the faceslow motion scenerescueblood splattercorpsevoice over narrationfiresurprise endingchaseknifeexplosioncharacter name in titlebare chested maleviolencebloodflashback (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d β¦ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
Subgenre: | martial arts |
Themes: | deceptionmonstertorturebetrayalkidnappingrevengemurderdeath |
Locations: | cemeterychurchtrain |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookperson on firethreatened with a knifeman with no namesubterraneanbladebased on graphic novelworld dominationmegalomaniactorso cut in halfjumping through a windowstabbed in the leg β¦dark hero3 dimensionalneck breakingexploding bodyscarkicked in the facetough girlcharacter repeating someone else's dialogueelectrocutionstabbed in the backtransformationcreaturefictional warno opening creditsanti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementmountainambushgood versus evildecapitationcombatinterrogationfalling from heightbrawlbattlepunched in the facerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested maleviolenceflashbackfightblood (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles β¦ Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerdeceptiontorturebetrayaldeathmurder |
Locations: | train stationlaboratorysnowtrain |
Characters: | action herowarriortough guyhostage |
Story: | secret laboratoryfemale warriorhand to hand combatthreatened with a knifearmorysuper strengthfemale fightertorso cut in halfjumping through a windowstabbed in the legdual wieldhaunted by the pastassassination attemptspearneck breaking β¦opening action scenebodyguardkicked in the facetough girlcharacter repeating someone else's dialoguestabbed in the backtransformationfictional warno opening creditssevered headsubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymountainstrangulationambushdecapitationcombatinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationsurprise endingchaseknifeexplosionbare chested malefightviolenceflashbackblood (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingdeathmurdersurrealismrevenge |
Locations: | laboratorywoodscemeteryforestchurchtrain |
Characters: | babe scientistaction herowarriortough guyhostage |
Story: | secret laboratoryone man armyhand to hand combatthreatened with a knifefoot chasecollapsing buildingsubterraneanimmortalworld dominationmegalomaniacstick fightdemonic possessionstabbed in the legimmortalityburial β¦assassination attemptopening action sceneratscarskeletoncharacter repeating someone else's dialogueelectrocutiontransformationpolice officer killedno opening creditsanti herosubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingarmyaxestrangulationambushgood versus evilscientistcombatbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsefiresurprise endingchaseknifeexplosionbare chested malebloodviolenceflashbackfight (See All) |
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingmurdersurrealismdeathrevenge |
Locations: | woodsforest |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatthreatened with a knifefoot chasecollapsing buildingsubterraneansuper strengthdemonic possessiontragic herostabbed in the legdark herodual wieldhaunted by the pastassassination attemptspear β¦queenopening action sceneratexploding bodyscarcharacter repeating someone else's dialoguestabbed in the backtransformationcreaturefictional waranti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmyaxestrangulationambushgood versus evildecapitationcombatdemoninterrogationfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsefiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested malebloodviolenceflashbackfight (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god β¦ Horus. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingdeathmurdersurrealismrevenge |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatthreatened with a knifecollapsing buildingcapeworld dominationmegalomaniacsuper strengthstick fighttorso cut in halftragic herostabbed in the legdark heroimmortalityhaunted by the past β¦exploding buildingassassination attemptspearqueenopening action sceneskeletoncharacter repeating someone else's dialoguestabbed in the backtransformationcreaturefictional warno opening creditsanti herosevered headstabbed in the cheststabbed to deathmixed martial artsimpalementarmymountainaxeambushgood versus evildecapitationcombatdemonfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosionbare chested malefightviolenceflashbackblood (See All) |
In modern day Japan, Wolverine is out of his depth in an unknown world as he faces his ultimate nemesis in a life-or-death battle that will leave him forever changed. Vulnerable for the first time and pushed to his physical and emotional limits, he confronts not only lethal samurai steel but also hi β¦s inner struggle against his own near-immortality, emerging more powerful than we have ever seen him before. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerbetrayalkidnappingdeathmurderrevenge |
Locations: | laboratorywoodssnowforesttrain |
Characters: | babe scientistaction herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookthreatened with a knifefoot chaseno title at beginningfemale fighterdrifterfemale doctorlonerstabbed in the legdark heroimmortality3 dimensional β¦haunted by the pastassassination attemptneck breakingopening action scenebodyguardscartough girlcharacter repeating someone else's dialogueelectrocutionstabbed in the backno opening creditsanti herosubwaystabbed in the cheststabbed to deathmixed martial artsimpalementmountainaxestrangulationambushgood versus evilscientistfalling from heightbrawlbattlerescuefistfightsurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested malebloodviolenceflashbackfight (See All) |
Set in contemporary New York City, a seemingly ordinary teenager, Clary Fray, discovers she is the descendant of a line of Shadowhunters, a secret cadre of young half-angel warriors locked in an ancient battle to protect our world from demons. After the disappearance of her mother, Clary must join f β¦orces with a group of Shadow Hunters, who introduce her to a dangerous alternate New York called the Shadow World, filled with demons, warlocks, vampires, werewolves and other deadly creatures. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonstertorturebetrayalkidnappingdeathmurdersurrealismrevenge |
Locations: | nightclubcemeterychurch |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatthreatened with a knifefoot chasepentagramworld dominationmegalomaniacfemale fighterstick fightsecret identitydemonic possessionimmortalitydual wieldspearexploding body β¦scartough girlskeletonstabbed in the backtransformationcreaturefictional waranti herotied to a chairstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementambushgood versus evilcombatdemoninterrogationfalling from heightbrawlbattleslow motion scenerescuefistfightcell phonesurprise endingchaseknifeexplosionbare chested maleviolencebloodflashbackfight (See All) |
Through a revolutionary technology that unlocks his genetic memories, Callum Lynch (Michael Fassbender) experiences the adventures of his ancestor, Aguilar de Nerha, in 15th Century Spain. Callum discovers he is descended from a mysterious secret society, the Assassins, and amasses incredible knowle β¦dge and skills to take on the oppressive and powerful Templar organization in the present day. (Read More)
Subgenre: | martial arts |
Themes: | deceptionbetrayalkidnappingsurrealismrevengemurderdeath |
Locations: | laboratorychurch |
Characters: | babe scientistaction herowarriortough guyhostage |
Story: | female warriorhand to hand combatthreatened with a knifefoot chasearmorybladecrashing through a windowcathedralworld dominationfemale fighterstabbed in the legdark herohaunted by the pastspearprince β¦neck breakingscarkicked in the facetough girlcharacter repeating someone else's dialogueelectrocutionstabbed in the backfictional warno opening creditsanti herostabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmyaxestrangulationambushgood versus evilscientistcombatbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsefiresurprise endingchaseknifeexplosiontitle spoken by characterbare chested malefightviolencebloodflashback (See All) |
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingmurdersurrealismdeathrevenge |
Locations: | woodssnowforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatthreatened with a knifeworld dominationmegalomaniacstick fightimmortalitydual wieldassassination attemptspearqueenkicked in the facetough girlcharacter repeating someone else's dialogue β¦stabbed in the backtransformationcreaturefictional warno opening creditsanti herostabbed in the chestmixed martial artsimpalementarmymountainaxeambushgood versus evilcombatbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsevoice over narrationsurprise endingchaseknifeexplosioncharacter name in titlebare chested malefightbloodviolenceflashback (See All) |
John Gregory, who is a seventh son of a seventh son and also the local spook, has protected his country from witches, boggarts, ghouls and all manner of things that go bump in the night. However John is not young anymore, and has been seeking an apprentice to carry on his trade. Most have failed to β¦survive. The last hope is a young farmer's son named Thomas Ward. Will he survive the training to become the spook that so many others couldn't? Should he trust the girl with pointy shoes? How can Thomas stand a chance against Mother Malkin, the most dangerous witch in the county? (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingrevengemurdersurrealismdeath |
Locations: | woodssnowforestchurch |
Characters: | action herowarriortough guy |
Story: | hand to hand combatthreatened with a knifearmorybladeworld dominationfemale fighterdemonic possessiontragic herostabbed in the legdark hero3 dimensionaldual wieldassassination attemptspearqueen β¦exploding bodyskeletonstabbed in the backtransformationcreaturefictional warno opening creditsanti herostabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymountainaxestrangulationambushgood versus evilcombatdemonfalling from heightbrawlbattleslow motion scenerescuefistfightfiresurprise endingchaseknifeexplosiontitle spoken by characterfightviolence (See All) |
Since the dawn of civilization, he was worshiped as a god. Apocalypse, the first and most powerful mutant from Marvel's X-Men universe, amassed the powers of many other mutants, becoming immortal and invincible. Upon awakening after thousands of years, he is disillusioned with the world as he finds β¦it and recruits a team of powerful mutants, including a disheartened Magneto, to cleanse mankind and create a new world order, over which he will reign. As the fate of the Earth hangs in the balance, Raven with the help of Professor X must lead a team of young X-Men to stop their greatest nemesis and save mankind from complete destruction. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionbetrayalkidnappingdeathrevengesurrealismmurder |
Locations: | laboratorywoodssnowforest |
Characters: | action herowarriortough guyhostage |
Story: | secret laboratoryfemale warriorhand to hand combatbased on comic bookthreatened with a knifefoot chasecollapsing buildingsubterraneanimmortalcapeworld dominationmegalomaniacsuper strengthbody landing on a carjumping through a window β¦immortalitydual wieldexploding buildingspearneck breakingopening action scenebodyguardkicked in the facetough girlskeletonelectrocutiontransformationpolice officer killedfictional warno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmountainstrangulationambushgood versus evildecapitationscientistcombatfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsefiresurprise endingchaseknifeexplosioncharacter name in titlebare chested maleviolenceflashbackbloodfight (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter β¦mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonstertorturebetrayalkidnappingsurrealismmurderrevengedeath |
Locations: | laboratorynightclubsnow |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatbased on comic bookperson on firearmorysubterraneanmegalomaniacsuper strengthtorso cut in halftragic herobody landing on a carjumping through a windowdark heroimmortality3 dimensional β¦dual wieldhaunted by the pastneck breakingexploding bodybodyguardscarkicked in the facetough girlelectrocutionstabbed in the backtransformationcreaturefictional warno opening creditsanti herosevered headtied to a chairsubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmystrangulationambushdecapitationscientistcombatinterrogationfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescuefistfightcorpsefiresurprise endingknifeexplosiontitle spoken by characterbare chested maleflashbackfightviolence (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather β¦ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | martial arts |
Themes: | deceptionmonsterbetrayalkidnappingdeathmurderrevenge |
Locations: | laboratory |
Characters: | hostage |
Story: | secret laboratoryfemale warriorhand to hand combatperson on firethreatened with a knifearmorysubterraneanworld dominationmegalomaniacsuper strengthfemale fightertorso cut in halfbody landing on a carstabbed in the legdual wield β¦opening action sceneexploding bodyscarkicked in the facetough girlelectrocutionstabbed in the backcreaturefictional warno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmystrangulationambushgood versus evildecapitationscientistcombatinterrogationfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosionfightviolencebloodflashback (See All) |
In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr β¦incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiontorturebetrayaldeathrevengemurder |
Locations: | woodsforest |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatthreatened with a knifesuper strengthstabbed in the leg3 dimensionaldual wieldspearprincequeenneck breakingopening action scenekicked in the facecharacter repeating someone else's dialogueelectrocution β¦stabbed in the backno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmyaxeambushgood versus evildecapitationcombatfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenefistfightfiresurprise endingchaseknifeexplosioncharacter name in titlebare chested malefightviolenceblood (See All) |
After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h β¦is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)
Subgenre: | martial arts |
Themes: | deceptionmonstermurderdeathrevenge |
Locations: | woodssnowforest |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatperson on firefoot chasearmorysubterraneanfemale fightertorso cut in halfstabbed in the leg3 dimensionaldual wieldassassination attemptspearneck breakingscar β¦tough girlskeletoncharacter repeating someone else's dialoguestabbed in the backtransformationcreaturefictional warno opening creditssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymountainaxestrangulationambushgood versus evildecapitationcombatfalling from heightbrawlbattlewritten by directorrescueblood splatterfistfightfirechaseknifeexplosiontitle spoken by charactercharacter name in titlebloodfightviolenceflashback (See All) |
Marvel's "Doctor Strange" follows the story of the talented neurosurgeon Doctor Stephen Strange who, after a tragic car accident, must put ego aside and learn the secrets of a hidden world of mysticism and alternate dimensions. Based in New York City's Greenwich Village, Doctor Strange must act as a β¦n intermediary between the real world and what lies beyond, utilising a vast array of metaphysical abilities and artifacts to protect the Marvel Cinematic Universe. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionbetrayalmurdersurrealismdeath |
Locations: | snowchurch |
Characters: | action herowarriortough guy |
Story: | female warriorone man armyhand to hand combatbased on comic bookfoot chasecollapsing buildingimmortalno title at beginningworld dominationmegalomaniacfemale fighterfemale doctorimmortalitydual wieldexploding building β¦opening action sceneexploding bodykicked in the facetough girlelectrocutiontransformationno opening creditsanti herosevered headstabbed in the chestmixed martial artsimpalementambushgood versus evildecapitationcombatdemonfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescuefistfightcorpsecell phonefiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested maleflashbackfightviolence (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalkidnappingmurderdeathsurrealismrevenge |
Locations: | woodsforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookthreatened with a knifefoot chaseworld dominationfemale fighterjumping through a windowdual wieldhaunted by the pastexploding buildingspearprinceopening action scene β¦exploding bodykicked in the facetough girlskeletoncharacter repeating someone else's dialogueelectrocutiontransformationcreaturefictional warsevered headtied to a chairstabbed in the cheststabbed to deathmixed martial artsimpalementarmymountainaxeambushgood versus evildecapitationcombatdemonbookfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightfiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlebare chested maleflashbackviolencefight (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo β¦u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiontorturebetrayalkidnappingmurderdeathsurrealismrevenge |
Locations: | laboratorywoodsforest |
Characters: | babe scientistaction herowarriortough guyhostage |
Story: | secret laboratoryone man armyhand to hand combatperson on firefoot chasearmorycrashing through a windowworld dominationmegalomaniacsuper strengthfemale doctorbody landing on a carjumping through a windowstabbed in the legdual wield β¦assassination attemptneck breakingexploding bodybodyguardkicked in the faceelectrocutionstabbed in the backpolice officer killedanti herosevered headtied to a chairsubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmyaxestrangulationambushgood versus evildecapitationscientistcombatinterrogationfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsecell phonefiresurprise endingchaseknifeexplosioncharacter name in titlebare chested malebloodviolenceflashbackfight (See All) |
1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god β¦s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)
Subgenre: | martial arts |
Themes: | deceptionmonsterbetrayalkidnappingdeathmurderrevenge |
Locations: | snowforesttrain |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookperson on firethreatened with a knifebased on graphic novelmegalomaniactragic herostabbed in the legdark hero3 dimensionaldual wieldhaunted by the pastspear β¦princeneck breakingopening action scenekicked in the facetough girlstabbed in the backcreaturefictional warno opening creditssevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmymountainaxeambushgood versus evildecapitationcombatfalling from heightbattlepunched in the faceslow motion scenerescueblood splattercorpsefireknifetitle spoken by charactercharacter name in titlebare chested malebloodfightviolenceflashback (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, β¦Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
Themes: | supernatural powerdeceptionmonsterbetrayalmurdersurrealismdeathrevenge |
Locations: | woodssnowforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | book burningfemale warriorthreatened with a knifecollapsing buildingmacearmoryworld dominationmegalomaniacfemale fighterdemonic possessionburialexploding buildingprincequeenneck breaking β¦exploding bodyscarkicked in the facetough girlskeletoncharacter repeating someone else's dialogueelectrocutionstabbed in the backtransformationcreaturefictional warno opening creditsanti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmymountainaxestrangulationambushgood versus evildecapitationcombatdemoninterrogationbookfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosionbare chested maleviolencefightblood (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | martial arts |
Themes: | deceptionbetrayalkidnappingdeathmurderrevenge |
Locations: | woodscemeteryforest |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatthreatened with a knifefemale fightertragic herodark herodual wieldspearexploding bodybodyguardscartough girlstabbed in the backtransformation β¦fictional waranti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementaxeambushgood versus evildecapitationcombatfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosionbloodflashbackviolencefight (See All) |
Based on the popular video game of the same name "Mortal Kombat" tells the story of an ancient tournament where the best of the best of different Realms fight each other. The goal - ten wins to be able to legally invade the losing Realm. Outworld has so far collected nine wins against Earthrealm, so β¦ it's up to Lord Rayden and his fighters to stop Outworld from reaching the final victory... (Read More)
Subgenre: | martial arts |
Themes: | supernatural powermonsterkidnappingdeathsurrealismrevengemurder |
Locations: | woodsnightclubforest |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatbased on comic bookperson on firethrown through a wallimmortalworld dominationmegalomaniacstick fightspearprinceneck breakingexploding bodykicked in the facetough girl β¦character repeating someone else's dialoguecreatureno opening creditssevered headmixed martial artsimpalementgood versus evilfalling from heightpunched in the faceslow motion scenerescueblood splatterknifetitle spoken by characterbare chested malefightflashbackviolenceblood (See All) |
A young boy learns that he has extraordinary powers and is not of this Earth. As a young man, he journeys to discover where he came from and what he was sent here to do. But the hero in him must emerge if he is to save the world from annihilation and become the symbol of hope for all mankind.
Subgenre: | martial arts |
Themes: | supernatural powertorturekidnappingmurderrevengedeath |
Locations: | laboratorycemeterysnowchurch |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatbased on comic bookperson on firethrown through a wallcollapsing buildinglifted by the throatcrashing through a windowcapeno title at beginningworld dominationmegalomaniacsuper strengthdriftersecret identity β¦lonerjumping through a window3 dimensionalexploding buildingneck breakingexploding bodykicked in the faceskeletoncharacter repeating someone else's dialoguecreaturefictional warno opening creditsstabbed in the cheststabbed to deathmixed martial artsimpalementarmygood versus evilscientistcombatinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightcell phonefiresurprise endingchaseknifeexplosionbare chested maleviolencefightflashback (See All) |
Subgenre: | martial arts |
Themes: | deceptionbetrayalrevengedeathmurder |
Locations: | train |
Characters: | action herowarriortough guy |
Story: | female warriorone man armyhand to hand combatthreatened with a knifefoot chasearmorycrashing through a windowtragic herobody landing on a carlonerstabbed in the legdark herodual wieldassassination attemptneck breaking β¦opening action scenebodyguardkicked in the facetough girlcharacter repeating someone else's dialoguestabbed in the backno opening creditsanti herosubwaystabbed in the cheststabbed to deathmixed martial artsthroat slittingstrangulationambushfalling from heightbrawlpunched in the faceslow motion sceneblood splatterfistfightcorpsecell phonefiresurprise endingchaseknifeexplosioncharacter name in titleviolencebloodflashbackfight (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi β¦nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonstertorturebetrayalkidnappingdeathmurderrevenge |
Locations: | laboratorywoodscemeterysnowforest |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookthreatened with a knifethrown through a wallcollapsing buildingbuilding collapsesubterraneancrashing through a windowcapesuper strengthsecret identitybody landing on a carjumping through a window β¦dark heroimmortalityhaunted by the pastexploding buildingspearopening action sceneexploding bodybodyguardscarkicked in the facetough girlelectrocutionstabbed in the backtransformationcreaturefictional waranti herotied to a chairstabbed in the cheststabbed to deathimpalementarmymountainstrangulationambushgood versus evilscientistcombatdemonfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsecell phonefiresurprise endingknifeexplosioncharacter name in titlebare chested malefightviolencebloodflashback (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | supernatural |
Themes: | supernatural powerdeceptionbetrayalkidnappingdeathrevengemurdersurrealism |
Locations: | train |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armythreatened with a knifefoot chasemaceimmortallightfemale doctorexploding buildingopening action scenetough girlcharacter repeating someone else's dialoguestabbed in the backtransformationfictional war β¦no opening creditsanti herosevered headsubwaystabbed in the cheststabbed to deathimpalementarmyaxeambushgood versus evildecapitationbrawlbattlepunched in the faceslow motion scenerescueblood splattercorpsecell phonevoice over narrationsurprise endingchaseknifeexplosiontitle spoken by characterbare chested malefightbloodviolenceflashback (See All) |
Johnny Blaze, a man who made a deal with the Devil who called himself Mephistopheles at the time (now Roarke), is on the run trying to make sure no-one is harmed by his alter ego, The Ghost Rider. He is approached by a Monk named Moreau who tells him that he can help be him free of the Rider, but fi β¦rst, he needs Johnny's help to protect a boy, whom Roarke has plans for, to help him take human form. (Read More)
Themes: | supernatural powerdeceptionkidnappingsurrealismdeathmurder |
Locations: | train stationnightclub |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatbased on comic bookperson on firethreatened with a knifefoot chasedrifterdemonic possessiontragic herolonerdark hero3 dimensionalneck breakingexploding bodyscar β¦skeletontransformationno opening creditsanti heroambushgood versus evildecapitationcombatdemoninterrogationbrawlrescuefistfightcell phonefirechaseknifeexplosiontitle spoken by charactercharacter name in titleflashbackviolencefight (See All) |
Set in 79 A.D., POMPEII tells the epic story of Milo (Kit Harington), a slave turned invincible gladiator who finds himself in a race against time to save his true love Cassia (Emily Browning), the beautiful daughter of a wealthy merchant who has been unwillingly betrothed to a corrupt Roman Senator β¦. As Mount Vesuvius erupts in a torrent of blazing lava, Milo must fight his way out of the arena in order to save his beloved as the once magnificent Pompeii crumbles around him. (Read More)
Subgenre: | martial arts |
Themes: | deceptiontorturekidnappingdeathmurderrevenge |
Locations: | woodsforest |
Characters: | action herowarriortough guyhostage |
Story: | one man armyhand to hand combatperson on firethreatened with a knifebuilding collapsemacestabbed in the leg3 dimensionaldual wieldexploding buildingspearneck breakingexploding bodykicked in the facestabbed in the back β¦anti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementarmymountainaxestrangulationdecapitationcombatfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightfirechaseknifeexplosiontitle spoken by characterbare chested maleviolencebloodfightflashback (See All) |
In the future, the mutants and the humans that help them are slaughtered by powerful robots named Sentinels. Professor Xavier, Wolverine, Magneto, Storm, Kitty Pryde and her friends meet at a monastery in China and Xavier explains that the invincible Sentinels were created using the DNA of Mystique β¦that was captured in 1973 when she tried to assassinate their creator Dr. Bolivar Trask. Xavier tells that their only chance is return to 1973 using Pryde's ability to join Charles Xavier and Erik Lehnsherr to convince Mystique to give up of her intention. . However, only Wolverine can withstand the damages of the time travel. Will he succeed in stopping Mystique and the Sentinel Program and save the mutants and their human friends from annihilation? (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionrevengemurdersurrealismdeath |
Locations: | laboratorynightclubsnowtrain |
Characters: | action herotough guy |
Story: | hand to hand combatbased on comic bookperson on firefoot chaseimmortalmicroscopecapebased on graphic novelsuper strengthjumping through a window3 dimensionalspearneck breakingexploding bodykicked in the face β¦tough girlskeletonstabbed in the backtransformationfictional warno opening creditsanti herosevered headsubwaystabbed in the cheststabbed to deathmixed martial artsimpalementmountainstrangulationdecapitationscientistcombatfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationsurprise endingchaseknifeexplosionbare chested maleviolencebloodflashbackfight (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t β¦o end all wars, Diana will discover her full powers and her true destiny. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiontorturebetrayalrevengedeathmurdersurrealism |
Locations: | train stationlaboratorywoodssnowforestchurchtrain |
Characters: | action herowarriortough guy |
Story: | female warriorhand to hand combatbased on comic bookthreatened with a knifeimmortalno title at beginningworld dominationmegalomaniacsuper strengthfemale fightersecret identityjumping through a windowimmortalitydual wieldexploding building β¦assassination attemptspearqueenexploding bodyscarkicked in the facetough girlcharacter repeating someone else's dialogueelectrocutionno opening creditsanti herostabbed in the cheststabbed to deathmixed martial artsarmyaxegood versus evilscientistcombatinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosioncharacter name in titlebare chested maleflashbackfightviolence (See All) |
Nick Fury is the director of S.H.I.E.L.D., an international peace-keeping agency. The agency is a who's who of Marvel Super Heroes, with Iron Man, The Incredible Hulk, Thor, Captain America, Hawkeye and Black Widow. When global security is threatened by Loki and his cohorts, Nick Fury and his team w β¦ill need all their powers to save the world from disaster. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonsterbetrayalrevenge |
Locations: | laboratoryforest |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatbased on comic bookthrown through a wallimmortalcrashing through a windowworld dominationsuper strengthbody landing on a carjumping through a window3 dimensionaldual wieldexploding buildingspearexploding body β¦bodyguardtough girlcharacter repeating someone else's dialogueelectrocutionstabbed in the backtransformationfictional warno opening creditsanti herotied to a chairstabbed to deathmixed martial artsimpalementarmygood versus evilscientistcombatinterrogationfalling from heightbrawlbattlepunched in the facerescuefistfightcell phonechaseknifeexplosiontitle spoken by characterbare chested malefightflashback (See All) |
After its victory over Leonidas' 300, the Persian Army under the command of Xerxes marches towards the major Greek city-states. The Democratic city of Athens, first on the path of Xerxes' army, bases its strength on its fleet, led by admiral Themistocles. Themistocles is forced to an unwilling allia β¦nce with the traditional rival of Athens, oligarchic Sparta whose might lies with its superior infantry troops. But Xerxes still reigns supreme in numbers over sea and land. (Read More)
Themes: | deceptionbetrayaldeathmurderrevenge |
Characters: | action herowarriortough guy |
Story: | female warriorhand to hand combatperson on firethreatened with a knifebased on graphic novelstabbed in the leg3 dimensionaldual wieldspearqueenneck breakingexploding bodyscarkicked in the facetough girl β¦skeletonstabbed in the backtransformationno opening creditsanti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmyambushgood versus evildecapitationcombatfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingknifeexplosionbare chested maleflashbackviolenceblood (See All) |
The warrior Thor (Hemsworth) is cast out of the fantastic realm of Asgard by his father Odin (Hopkins) for his arrogance and sent to Earth to live among humans. Falling in love with scientist Jane Foster (Portman) teaches Thor much-needed lessons, and his new-found strength comes into play as a vill β¦ain from his homeland sends dark forces toward Earth. (Read More)
Subgenre: | martial arts |
Themes: | deceptionmonsterbetrayal |
Locations: | snow |
Characters: | babe scientistaction herowarriortough guy |
Story: | female warriorone man armyhand to hand combatbased on comic bookimmortalcapeno title at beginningsuper strengthbody landing on a carexploding buildingspearprincequeenelectrocutionstabbed in the back β¦creaturefictional warno opening creditsanti heroarmymountainaxegood versus evilscientistcombatinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenefistfightcell phonevoice over narrationexplosiontitle spoken by charactercharacter name in titlebare chested maleflashbackviolence (See All) |
This is the origin story of former Special Forces operative turned mercenary Wade Wilson, who after being subjected to a rogue experiment that leaves him with accelerated healing powers, adopts the alter ego Deadpool. Armed with his new abilities and a dark, twisted sense of humor, Deadpool hunts do β¦wn the man who nearly destroyed his life. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiontorturebetrayalkidnappingrevengemurderdeath |
Locations: | laboratorysnow |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatbased on comic bookperson on firethreatened with a knifelifted by the throatimmortalsuper strengthfemale fighterstick fighttragic herofemale doctorbody landing on a carstabbed in the leg β¦dark heroimmortalitydual wieldneck breakingopening action sceneexploding bodybodyguardscarkicked in the facetough girlstabbed in the backtransformationanti herosevered headstabbed in the cheststabbed to deathmixed martial artsimpalementaxestrangulationambushgood versus evildecapitationscientistinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsecell phonevoice over narrationfirechaseknifeexplosioncharacter name in titlebare chested malebloodfightviolenceflashback (See All) |
Tony Stark creates the Ultron Program to protect the world, but when the peacekeeping program becomes hostile, The Avengers go into action to try and defeat a virtually impossible enemy together. Earth's mightiest heroes must come together once again to protect the world from global extinction.
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiondeathrevengemurder |
Locations: | laboratorywoodssnowforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatbased on comic bookbuilding collapsearmorycapeworld dominationmegalomaniacsuper strengthtorso cut in halfbody landing on a carfemale doctorjumping through a window3 dimensionalhaunted by the past β¦exploding buildingopening action sceneexploding bodytough girlcharacter repeating someone else's dialogueelectrocutiontransformationno opening creditssevered headmixed martial artsarmyaxeambushgood versus evildecapitationscientistcombatfalling from heightbrawlbattleslow motion scenerescuefistfightcorpsesurprise endingexplosioncharacter name in titlebare chested maleviolenceflashback (See All) |
Trained since childhood to be a lethal killer, Raizo has since turned his back on the Ozunu clan that raised him and now seeks revenge for their heartless murders. Teaming up with Europol investigator Mika, Raizo steadily butchers his enemies while inching ever closer to the long-awaited bloody reun β¦ion with his former master. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powermurder of a police officerrevengemurderdeath |
Characters: | action herowarriortough guy |
Story: | one man armyhand to hand combatfoot chasethrown through a walltorso cut in halftragic herolightlonerstabbed in the legdark herodual wieldhaunted by the pastassassination attemptopening action scenescar β¦stabbed in the backno opening creditsanti herosevered headstabbed in the cheststabbed to deathmixed martial artsimpalementmountaingood versus evildecapitationcombatfalling from heightbrawlslow motion scenerescueblood splatterfistfightfirechaseexplosionbare chested maleviolenceflashbackbloodfight (See All) |
When John Connor ('Jason Clarke (I)' (qv)), leader of the human resistance, sends Sgt. Kyle Reese ('Jai Courtney' (qv)) back to 1984 to protect Sarah Connor ('Emilia Clarke' (qv)) and safeguard the future, an unexpected turn of events creates a fractured time-line. Now, Sgt. Reese finds himself in a β¦ new and unfamiliar version of the past, where he is faced with unlikely allies, including the Guardian ('Arnold Schwarzenegger' (qv)), dangerous new enemies, and an unexpected new mission: To reset the future... (Read More)
Themes: | murder of a police officerdeceptionbetrayaldeathmurder |
Locations: | laboratory |
Characters: | action herotough guy |
Story: | facial scarfemale warriorone man armyhand to hand combatperson on firefoot chasethrown through a walllifted by the throatarmorysubterraneansuper strengthbody landing on a carjumping through a window3 dimensionaldual wield β¦exploding buildingassassination attemptexploding bodytough girlcharacter repeating someone else's dialogueelectrocutionstabbed in the backtransformationfictional warsevered headstabbed in the cheststabbed to deathimpalementambushgood versus evildecapitationscientistinterrogationbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsecell phonevoice over narrationsurprise endingknifeexplosioncharacter name in titlebare chested maleflashback (See All) |
HITMAN: AGENT 47 centers on an elite assassin who was genetically engineered from conception to be the perfect killing machine, and is known only by the last two digits on the barcode tattooed on the back of his neck. He is the culmination of decades of research and forty-six earlier Agent clones -- β¦ endowing him with unprecedented strength, speed, stamina and intelligence. His latest target is a mega-corporation that plans to unlock the secret of Agent 47's past to create an army of killers whose powers surpass even his own. Teaming up with a young woman who may hold the secret to overcoming their powerful and clandestine enemies, 47 confronts stunning revelations about his own origins and squares off in an epic battle with his deadliest foe. (Read More)
Themes: | supernatural powerdeceptiontorturebetrayalkidnappingdeathrevengemurder |
Locations: | laboratory |
Characters: | action herotough guyhostage |
Story: | female warriorone man armyhand to hand combatthreatened with a knifefoot chaseman with no namearmorycrashing through a windowsuper strengthbody landing on a carlonerjumping through a windowdual wieldneck breakingopening action scene β¦exploding bodybodyguardkicked in the facetough girlelectrocutionanti herotied to a chairstabbed in the cheststabbed to deathmixed martial artsimpalementarmystrangulationambushdecapitationinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescueblood splatterfistfightcorpsecell phonevoice over narrationsurprise endingknifeexplosioncharacter name in titleflashbackviolence (See All) |
Jupiter Jones was born under a night sky, with signs predicting that she was destined for great things. Now grown, Jupiter dreams of the stars but wakes up to the cold reality of a job cleaning other people's houses and an endless run of bad breaks. Only when Caine Wise, a genetically engineered ex- β¦military hunter, arrives on Earth to track her down does Jupiter begin to glimpse the fate that has been waiting for her all along - her genetic signature marks her as next in line for an extraordinary inheritance that could alter the balance of the cosmos. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptionmonstertorturebetrayalkidnappingsurrealismdeathrevengemurder |
Locations: | church |
Characters: | action herowarriortough guyhostage |
Story: | female warriorone man armyhand to hand combatcollapsing buildingcathedralworld dominationtragic herojumping through a windowdark heroimmortality3 dimensionaldual wieldhaunted by the pastexploding buildingassassination attempt β¦opening action sceneelectrocutioncreaturefictional warno opening creditsanti heromixed martial artsarmyambushgood versus evilcombatinterrogationfalling from heightbrawlbattlewritten by directorslow motion scenerescuefistfightcell phonevoice over narrationfiresurprise endingchaseknifeexplosioncharacter name in titlebare chested maleviolencefight (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga β¦to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
Themes: | supernatural powerdeceptionmonsterkidnappingmurdersurrealismdeathrevenge |
Locations: | woodscemeterysnowforest |
Characters: | action herowarriortough guyhostage |
Story: | person on firefoot chasetitle spoken by narratorarmorysubterraneantragic herodark hero3 dimensionalburialexploding buildingspearneck breakingexploding bodystabbed in the backcreature β¦no opening creditssevered headstabbed in the cheststabbed to deaththroat slittingimpalementarmymountainaxeambushdecapitationcombatdemonbattlerescueblood splattercorpsefiresurprise endingchaseknifeexplosiontitle spoken by characterbare chested maleflashbackbloodviolence (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks β¦the colonists in a whole new environment. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powermonstermurderdeath |
Locations: | laboratorywoodsforest |
Characters: | babe scientisttough guy |
Story: | hand to hand combatthreatened with a knifearmorymicroscopefemale fightertorso cut in halffemale doctorjumping through a windowdual wieldexploding buildingneck breakingexploding bodykicked in the facetough girlelectrocution β¦stabbed in the backtransformationcreaturesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementstrangulationambushdecapitationscientistfalling from heightpunched in the facerescueblood splatterfistfightcorpsefiresurprise endingchaseknifeexplosioncharacter name in titlebare chested maleflashbackfightviolenceblood (See All) |
Subgenre: | martial arts |
Themes: | deceptionbetrayalkidnappingrevengemurderdeath |
Locations: | laboratorywoodsforest |
Characters: | babe scientisthostage |
Story: | secret laboratoryhand to hand combatthreatened with a knifefoot chasesuper strengthstick fightfemale doctorneck breakingkicked in the facecharacter repeating someone else's dialoguestabbed in the backstabbed in the cheststabbed to deathmixed martial artsimpalement β¦strangulationambushscientistinterrogationbrawlpunched in the facerescueblood splatterfistfightcorpsecell phonesurprise endingchaseknifetitle spoken by charactercharacter name in titlebare chested maleviolencefightflashbackblood (See All) |
Subgenre: | martial arts |
Themes: | deceptionbetrayalkidnappingdeathmurderrevengesurrealism |
Locations: | woodsforest |
Characters: | warriorhostage |
Story: | female warriorhand to hand combatthreatened with a knifesubterraneanfemale fighterimmortality3 dimensionaldual wieldspearexploding bodykicked in the facetough girlskeletoncharacter repeating someone else's dialoguecreature β¦fictional warno opening creditsmixed martial artsmountainaxeambushgood versus evilcombatfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightvoice over narrationfiresurprise endingchaseknifeexplosiontitle spoken by charactercharacter name in titlefightviolence (See All) |
With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c β¦ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powerdeceptiontorturebetrayalkidnappingmurderrevengedeath |
Locations: | abandoned factorylaboratorysnowforestchurch |
Characters: | action herowarriortough guyhostage |
Story: | secret laboratoryfemale warriorone man armyhand to hand combatbased on comic bookthreatened with a knifefoot chasearmorysubterraneancrashing through a windowno title at beginningsuper strengthfemale fighterbody landing on a carjumping through a window β¦dark herohaunted by the pastexploding buildingprinceneck breakingopening action sceneexploding bodybodyguardkicked in the facetough girlelectrocutiontransformationno opening creditsstabbed in the chestmixed martial artsmountainstrangulationambushscientistcombatinterrogationfalling from heightbrawlbattlepunched in the faceslow motion scenerescuefistfightcorpsecell phonefiresurprise endingchaseknifeexplosioncharacter name in titlebare chested malefightflashbackviolenceblood (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th β¦e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
Subgenre: | martial arts |
Themes: | supernatural powermonsterkidnappingmurderrevengedeath |
Locations: | laboratory |
Characters: | warriorhostage |
Story: | female warriorhand to hand combatsuper strengthtorso cut in halfbody landing on a carjumping through a windowstabbed in the leg3 dimensionalneck breakingexploding bodykicked in the facetough girlcharacter repeating someone else's dialoguestabbed in the backtransformation β¦creaturefictional warno opening creditsanti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementaxestrangulationgood versus evildecapitationscientistcombatfalling from heightbrawlbattlepunched in the facerescueblood splatterfistfightcorpsefiresurprise endingchaseknifeexplosionbare chested malebloodviolence (See All) |
After Nick is murdered by his own partner, he joins the Rest in Peace Department to protect the world from the undeads. While working with his new partner, many undeads are seen gathering in Boston. Soon he realizes that someone close to him is behind all a plot to bring on the apocalypse.
Subgenre: | supernaturalmartial arts |
Themes: | supernatural powerdeceptionmonstertorturebetrayalkidnappingsurrealismmurderdeath |
Locations: | cemetery |
Characters: | action herowarriorhostage |
Story: | hand to hand combatbased on comic bookfoot chasecollapsing buildingbuilding collapsecrashing through a windowworld dominationmegalomaniacsecret identitybody landing on a carjumping through a window3 dimensionaldual wieldexploding bodypolice officer killed β¦creatureno opening creditsanti herogood versus evildemoninterrogationfalling from heightbrawlrescuefistfightchaseexplosiontitle spoken by characterfightviolence (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
Subgenre: | martial arts |
Themes: | deceptionbetrayaldeathmurder |
Locations: | snow |
Characters: | action herowarriortough guyhostage |
Story: | female warriorhand to hand combatthreatened with a knifefoot chasecollapsing buildingfemale fighterstabbed in the leghaunted by the pastexploding buildingspearexploding bodytough girlstabbed in the backcreatureanti hero β¦severed headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementaxeambushgood versus evildecapitationcombatfalling from heightbrawlbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsevoice over narrationfiresurprise endingchaseknifeexplosiontitle spoken by characterviolencebloodfightflashback (See All) |