Please wait - finding best movies...
During the Cold War, Soviet agents watch Professor Henry Jones when a young man brings him a coded message from an aged, demented colleague, Harold Oxley. Led by the brilliant Irina Spalko, the Soviets tail Jones and the young man, Mutt, to Peru. With Oxley's code, they find a legendary skull made o …f a single piece of quartz. If Jones can deliver the skull to its rightful place, all may be well; but if Irina takes it to its origin, she'll gain powers that could endanger the West. Aging professor and young buck join forces with a woman from Jones' past to face the dangers of the jungle, Russia, and the supernatural. (Read More)
| Themes: | supernatural power |
| Characters: | mother son relationshipfather son relationship |
| Period: | 1950s |
| Story: | ant attackark of the covenantcrystal skullhoming deviceamphibious vehicleel doradocommunist agentamazon rainforestnuclear testinglost citycar falling off a cliffancient astronautparapsychologyindiana jonesquicksand …gold cointranslationarchaeologistworld war two veteranalternate dimensionsecret passageflying saucerriddleperumilitary basemental breakdownadventureranimal attackrailway stationfourth parttemplehand grenadecold warak 47interrogationsequel (See All) |
Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse …d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)
| Subgenre: | martial artscult filmstop motion animationchrist allegorylow comedydieselpunk |
| Themes: | murderdeathlovefriendshipkidnappingtortureescapegangsterheromagicredemptionsadismcrueltyjusticestarvation |
| Mood: | gorepoetic justice |
| Locations: | airplanenightclubwatervillagejunglecampfireindiaairplane accidentnightclub shootoutmine car |
| Characters: | father son relationshipchildrensingerboywarrioraction herovillainamerican abroad |
| Period: | 1930s |
| Story: | indiana jonesarchaeologistsecret passageadventurertemplesequelcharacter name in titlebloodviolencebare chested malekisschasepistolfireshootout …fistfightblondeface slaprescueswordgunfightfalling from heightriflesecond partrivercleavagesword fightbridgeprisonerstabbed in the chestsnakecultdisarming someoneone man armyargumentcursedangerperson on firepoisonevil manskeletonhangingstreet shootouttraplove interestmonkeyoccultcard gamebow and arrowspearballoonheroinegothiclifting someone into the airslaveryroyaltyelephantblockbusterfemale singerpart of trilogyhonorcompassionmexican standoffcrushed to deathslaveeaten alivebarefootreverse footagediamondsevered fingerbraveryseven word titlewhipfalling to deathinsectfather figureairplane crashbooby trapheartfallmusical numbersexy womantuxedominepassionate kissvoodooprequelpalaceleather jacketheroismyellingbrainwashingspit in the facehuman sacrificecrocodilebugcomic reliefroller coasterforeignerraftadventure herofalling into watertriadlavaarcheologysoupunsubtitled foreign languagetyrantmacguffineyeballchild kidnappingkindnessfriends who live togetheralligatorperfumefamous scorearcheologistrighteous rageoutlaw gangshrineheart ripped outtommy gunbanquetchosen oneexploding airplaneimmolationlifting person in airheart in handtap dancingfedorahinduismbeetlecaged animalchild laborgross out humorantidoteshacklesscreaming in fearfaminestudio logo segues into filmchild driving cartyrannychild actoremaciationrickshawhand through chestlifting male in airbolt action riflebritish empirevoodoo dollrope bridgeconveyor beltmine shaftbelchshanghai chinawinkriver rapidschild driving a carbelchingburpcremated remainsburpingdeath trapgongsprayed with wateryawningsuspension bridgeplaying pokerturntablebritish colonialcheating at cardsprequel and sequelhallucinogeniclive chickenfemale dancervictim invited to dinnermusical sequence in non musical worksleddingthompson sub machine gunbeating heartlife raftreligious ceremonyeating brainsopening champagneflying batjourney shown on a mapkalimedium breastsyawnore cartwhite tuxedosplitsyear 1857ancient ritualcliffhangingeaten by a crocodilegrindstoneriding an elephantinnocent deaths avengedred carnationthuggeewhite dinner jacket (See All) |
The year is 1936. An archeology professor named Indiana Jones is venturing in the jungles of South America searching for a golden statue. Unfortunately, he sets off a deadly trap but miraculously escapes. Then, Jones hears from a museum curator named Marcus Brody about a biblical artifact called The … Ark of the Covenant, which can hold the key to humanly existence. Jones has to venture to vast places such as Nepal and Egypt to find this artifact. However, he will have to fight his enemy Rene Belloq and a band of Nazis in order to reach it. (Read More)
| Subgenre: | action adventure |
| Locations: | usa |
| Characters: | professorreligious history |
| Period: | world war two1930s |
| Story: | ark of the covenantindiana jonesarchaeologistriddlegunpistolarcade gamerevolvergovernmenthandgunhattreasurewhipegyptleather jacket …swastikastar warsarcheologyartifacttreasure huntsaving the worldarcheologistfedoranepalmedallionmediterraneanexcavationbased on cult favoritearcheological digancient civilizationmoseshimalayaancient culturenazi regimeimax versionten commandmentsdarth vaderthe covenantancient architecturecairo (See All) |
James Bond 007 is on the search for a Russian decoding machine, known as Lektor. Bond needs to find this machine, before the evil SPECTRE organization discovers it first. Whilst being romantically linked with Russian girl, Tatiana Romanova, Bond sneaks his way around Istanbul, whilst each SPECTRE ag …ent tries to pick him off, including the over powering Donald 'Red' Grant and ex-KGB agent Rosa Klebb who knows all the tricks in the books and even possesses an incredible poison tipped shoe! (Read More)
| Subgenre: | martial artscult film |
| Themes: | murderescapeterrorismsurveillance |
| Mood: |
| Locations: | trainhotelhelicopterlondon englandboat chase |
| Characters: | action herosniperrussian |
| Period: | 1960s |
| Story: | gold coinsecret passagerailway stationhand grenadecold warsequelbased on novelbare chested malefightphotographknifepistolfireshootout …maskrifleheld at gunpointbombsecond partspyassassinwinestrangulationdisguisestabbingdeath of friendwomandouble crossprologueperson on fireloss of fatherpremarital sexshot in the armhandgunsecret agentespionagechesseavesdroppingtape recordercatfighthatvillainessblockbusterimpersonationgypsysuper villaintitle appears in writingbooby trapbriefcasegadgetflamethrowerexploding helicopterturkey the countrydrugged drinkistanbul turkeyterritory name in titlefish tankbillboardfilm camerahelicopter crashembassyvenice italyyugoslaviakgbmacguffinmotorboatmosquestabbed in the shoulderfamous scoretwo way mirrorspeedboatspy herosubterraneanbutt slapflare gunclerkdouble agentcanalman wearing towelreturning character with different actorexploding boatcult figuresecret organizationgadget cargarroteferry boatbulgariasequel mentioned during end creditsfilm reeltear gasgondolabritish secret servicebritish intelligencebelly dancingbelly danceperiscopefake marriagedefectionsecret basebond girlreservoirpowdercryptographyarch villainsecret filmingmedium format cameraorient expresswhite catknife in shoeweapons trainingdining carlesbian stereotypeadriatic seaspectre the organizationzagreb croatiamauserofficial james bond seriesofficial bond filmdecodermauser c96 pistolmauser pistolrolleiflex camerabasilicaboat stuntbritish agentsecret master villaintitle written in movie (See All) |
A megalomaniac C.E.O. sends his son into the dangerous African Congo on a quest for a source of diamonds large enough and pure enough to function as powerful laser communications transmitters (or is it laser weapons?). When contact is lost with his son and the team, his sometime daughter- in-law is …sent after them. She is a former CIA operative and, accompanied by gee-whiz gadgetry and a few eccentric characters (including a mercenary, a researcher with a talking gorilla, and a a nutty Indiana-Jones-type looking for King Solomon's Mines), sets out to rescue her former fiance. What they all discover is that often what we most want turns out to be the source of our downfall. (Read More)
| Themes: | military |
| Locations: | airplaneairportafricacavejunglecampfire |
| Characters: | soldierprofessoramerican abroadbabe scientist |
| Period: | 1990s |
| Story: | lost cityanimal attacktempleak 47interrogationbased on novelone word titletitle spoken by characterexplosionpistolcorpseshot to deathmachine gunshotguncamera …paintingscientistdecapitationsurvivalambushmountainarmysnakeexploding carsevered headno opening creditsanimalritualcigar smokinglegendtentskeletonmercenaryuzicaptaincountry name in titleheavy raintalking animallifting someone into the airhuntersevered handskulllaserrocket launcherdiamondhit in the crotchlionairplane crashvolcanoparachuterainstormtribecorporationsign languagetorso cut in halfsatellitetranslatorreference to elvis presleyexpeditioneyegolf clubterritory name in titlegorillaflarelavaexplorerhouston texashot air balloonapeairfieldcoughing bloodreference to john wayneguideflare gunanimal killingexploding airplanegiraffechantingskydivingcongogolf cartromanianstudio logo segues into filmvolcanic eruptionhippopotamustanzaniasafariloud shirtanimal human communicationjumping from an airplaneex cia agentsimian fictionswahilifortune hunterzoologylaser cutterwhite water raftingcentral africaancient templehuman versus animalelectronics expertthrown from an airplanecharacter says have a nice daytalking gorillareference to prometheusprimatologistrobot sentry (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | martial artsblack comedytragedyepicaustralian fantasyaustralian science fictionaustralian horrorsword and fantasychrist allegoryscience fantasy |
| Themes: | supernatural powermurderdeathloverevengesurrealismkidnappingbetrayalfearescapemonsterdeceptionseductiondeath of fatherbrutality …redemptionfaithhopeapocalypseblindnesscourageself sacrificemythologynear death experienceafterlifeunlikely heroegyptian mythology (See All) |
| Mood: | darknesspoetic justiceaustralian supernatural |
| Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guywarrioraction heroex husband ex wife relationshipdeath of girlfriend |
| Story: | gold coinriddleanimal attacktemplebloodviolenceflashbackbare chested malekissfightexplosionknifechasesurprise endingfire …voice over narrationbeatingcorpsefistfighthorseshot in the chestrescueslow motion scenepunched in the facebattleswordbrawlfalling from heightshowdownhand to hand combatbeddemonorgycombatdecapitationgood versus evilsurvivalbedroomassassinsword fightambushold manaxemassacremountainbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armyfictional wardouble crossunderwater scenekingcreaturenecklacetransformationone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manlightningopening action sceneskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfallsevered armlove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionbow and arrowburned aliveflyingspearassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfatefemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestdark herosunbooby trapheartaerial shotknife fightwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherdaggerstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyesuper strengthgiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offcoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrolldouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
Johnny Blaze, a man who made a deal with the Devil who called himself Mephistopheles at the time (now Roarke), is on the run trying to make sure no-one is harmed by his alter ego, The Ghost Rider. He is approached by a Monk named Moreau who tells him that he can help be him free of the Rider, but fi …rst, he needs Johnny's help to protect a boy, whom Roarke has plans for, to help him take human form. (Read More)
| Subgenre: | superhero |
| Themes: | supernatural powermurderdeathsurrealismkidnappingdrunkennessescapegangsterdeceptionsurveillanceself sacrificedevil |
| Mood: | car chase |
| Locations: | hospitalrestaurantmotorcyclenightclubtruckcavetrain stationcar motorcycle chase |
| Characters: | mother son relationshiptattoopriesthostagetough guywarrioraction heroalcoholicsnipersniper rifle |
| Story: | hand grenadeak 47interrogationsequelcharacter name in titleviolenceflashbackfighttitle spoken by characterexplosionknifechasepistolfirepunctuation in title …cell phoneshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueswordbrawlshowdownheld at gunpointhand to hand combatsecond partcar crashdemonrevolvercombatshot in the backdecapitationgood versus evilfoot chasebased on comic bookambushambulancebridgedinerexploding carno opening creditsanti heroone man armychild in perilhit by a carritualtransformationon the runbinocularsperson on fireattackfugitiverace against timeknocked outskeletonscarinjectionsplit screenexploding bodyneck breakingthreatened with a knifemercenarysilencersubtitled scenehenchmanuziburned alivewhat happened to epiloguehead butthypodermic needlesecurity cameraskullrocket launchermonkback from the deadbikergypsystealing a caranimated sequence3 dimensionalgash in the faceresurrectionescape attemptmarvel comicsdark heroeye gougingdisfigurementknife throwinglonerlens flaredemonic possessiontragic herochainburned to deathwilhelm screamturkey the countryflat tiregrenade launcherfast motion scenetelepathybazookanarrated by characterdrifterpickpocketbag over headmonasteryhuman sacrificearms dealergurneysole black character dies clicheeastern europefrenchmanbulldozerchainsdeal with the deviltruck stopdecomposing bodyarsenaldocksturned to stonecranemarvel entertainmentamphitheater3d sequel to 2d filmreturning from the dead (See All) |
In modern day Japan, Wolverine is out of his depth in an unknown world as he faces his ultimate nemesis in a life-or-death battle that will leave him forever changed. Vulnerable for the first time and pushed to his physical and emotional limits, he confronts not only lethal samurai steel but also hi …s inner struggle against his own near-immortality, emerging more powerful than we have ever seen him before. (Read More)
| Subgenre: | martial artssuspenseconspiracysuperherofish out of water |
| Themes: | supernatural powermurderdeathrevengesuicidekidnappingbetrayalghostdrunkennessescapefuneralgangstermafiaguiltgreed …self sacrificesamurainear death experience (See All) |
| Mood: | rainnightmare |
| Locations: | bartrainswimming poolforesthotelhelicoptersnowmotorcycleairplaneairportelevatorwoodsjapancanadacave …laboratorytunnellove hotel (See All) |
| Characters: | father son relationshipfather daughter relationshipfriendtattoojapanese womanprostitutesoldierhostagesister sister relationshiptough guylove trianglewarrioraction herohitmaninterracial relationship …japanesecanadianself mutilationgrandfather granddaughter relationshipex soldieryounger version of characterbabe scientistsamurai swordjapanese soldierformer friendself healingmurder of friendcanadian abroad (See All) |
| Period: | world war two2010syear 1945seeing the future |
| Story: | world war two veteranrailway stationtempleak 47sequelcharacter name in titlebloodviolenceflashbacktwo word titlebare chested malekissfighttitle spoken by characterexplosion …knifechasesurprise endingpistoldreamshot to deathfistfightmachine gunshot in the chestshotgunrescuecatswordbrawlfalling from heightbased on comicshowdownriflehand to hand combatsecond partrobothallucinationscientistshot in the backgood versus evilfoot chaseorphanassassinsword fightbased on comic bookambushstrangulationaxemountaindrug dealerimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestsubwayno opening creditsanti heroone man armyfemme fatalenews reportshot in the legon the runlimousineorganized crimecharacter repeating someone else's dialoguestabbed in the backelectrocutionfugitivepoisonninjatough girlopening action scenescene during end creditsshot in the shoulderscarbodyguardhairy chestneck breakingpremarital sexthreatened with a knifeshot in the armbearpubsubtitled scenestylized violencestrong female charactercrime bossuzishavingbow and arrowburned alivekilling an animalhead buttassassination attempthypodermic needlelooking at oneself in a mirrorcatfightmutantspin offstabbed in the stomachhunterloss of loved onemediavillainessasian womanculture clashfaked deathhonormonkaction heroinefemale killergoatcrushed to deathbar fightbroken legapplefemale warriorthuginterracial romancecameohaunted by the pasttokyo japanveteranthunderarranged marriagecrossbowkatana swordstabbed in the throat3 dimensionalgash in the facestabbed in the neckbusinesswomansuper villainfalling to deathimmortalitystabbed in the legmarvel comicsdark herothrown through a windowinfectionheartprisoner of warseasidewisecrack humorhealingrainstormyakuzaarmorfemale doctorlonerdark pastcorporationlens flarechainarrowburned to deathmedia coveragedrugged drinkfemale assassinfianceestabbed in the handkendodrifterveterinarianspit in the facefemale fighterlast will and testamentsubtitlesex boyfriendbugmecharestroomshot with an arrowvillaatomic bombstabbed in the armx raybillionaireno title at beginningburnt faceinterracial kissreluctant heromercy killingblizzardkidnapperheiresskimonoparasiteclawcorrupt officialprivate jetmain character shotnuclear explosionceofighter planebreaking a bottle over someone's headbilingualismolder man younger womanred hairx rayed skeletonman slaps a womanregenerationchopping woodhit with a chairsurprise during end creditsx menhand through chesthanged womanphone conversationwashroomclangrizzly bearfalling into a swimming poolprisoner of war campkettlevenomhealing powerjumping off a roofbabechildhood loveroninpoison dartfountain penninja armyseppukutoxinnagasaki japanresearch facilitychopstickrobot suitatom bombthrown from a trainengaged couplefalse friendtree cuttingclaw fightpower armoregomaniacthrown off a balconycheating fianceoncologistfight on train roofkiss of deathstabbed in chestwolverine the characteradopted sisterfight on a train roof1945bullet trainatomic explosionbody scannersnake womanb 29poisoned arrowspin off sequelasian with coloured hairfemale mutantscannumber 13shaving beardatomic bomb victimatomic bombingdefense secretary (See All) |
A few decades after the destruction of the Inca empire, a Spanish expedition leaves the mountains of Peru and goes down the Amazon river in search of gold and wealth. Soon, they come across great difficulties and Don Aguirres, a ruthless man who cares only about riches, becomes their leader. But wil …l his quest lead them to "the golden city", or to certain destruction? (Read More)
| Subgenre: | cult filmconspiracytragedyepic |
| Themes: | murderdeathsurrealismchristmasobsessionpovertyinsanityillnessexecutionmadnessdeath of daughterstarvation |
| Mood: | rainsavage |
| Locations: | villagecityjunglespain |
| Characters: | husband wife relationshipfather daughter relationshipchristianreference to godnative americanvillainbiblecatholic |
| Period: | 16th century1500s |
| Story: | el doradoamazon rainforestlost cityperufemale nuditycharacter name in titleviolencetitle spoken by characterexplosionbased on true storyfirefoodhorseshootingrifle …dead bodyhallucinationreference to jesus christprayerriverdecapitationmountainarmysevered headtrialsearchjourneylegendskeletonhangingthird worldpigtrapmonkeypowergolddestructionbow and arrowmedicinespearmachetecagequestfamehelmetslaverymousevisitmonkslavecannonvisionspanishcannibalhungerlostswampbutterflybananaarmorchainarrowmudexplorationbeheadingillusionexpeditioncanoefluteblack manhikingtreasonstreet marketcorporal punishmentmegalomaniacamazonraftconventemperorheld captivepipemale protagonistfeverexplorersouth americaempirerevoltmassfloggingmountain climbingblasphemydeath by hangingdeserterblond manmutinyunhappy endingtalking headculture shockinkmarchingcolonizationconquestnew german cinematravellinggold rushamazon riverandes mountainsrodentbasquemegalomaniallamadynastyheadhunterwhirlpoolenslavementtropical settingconquistadorfloatsedan chairsentenceperuvianmachu picchufever dreamconquerorwrath of godwilderness survivalcannon firedeserted villagepoisoned arrowlast survivorspanish armychristianizationclemencyyaqui indian1560sartistic creationdeath of emperorinvisible enemy (See All) |
Tony Stark creates the Ultron Program to protect the world, but when the peacekeeping program becomes hostile, The Avengers go into action to try and defeat a virtually impossible enemy together. Earth's mightiest heroes must come together once again to protect the world from global extinction.
| Subgenre: | martial artssuperhero |
| Themes: | supernatural powermurderdeathrevengefeardrunkennessdeceptionmagicterrorismapocalypseself sacrificetechnologyartificial intelligence |
| Locations: | new york citybarbeachchurchforestsnowmotorcycleairplanebuslondon englandelevatorwoodspolice stationcityafrica …shipcastlelaboratoryspace stationmotorcycle chasespace shiptrain accidentsinging on airplane (See All) |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshiptattoobrother sister relationshipsoldierhostagetough guywarrioraction heroprofessorpregnant womanengineer …ex soldierpregnant wifealien superhero (See All) |
| Story: | world war two veteransecret passageak 47sequelcharacter name in titleviolenceflashbackbare chested maleexplosionpartysurprise endingpistolcorpseshot to deathfistfight …machine gunshot in the chestrescueslow motion scenebattlebrawlfalling from heightbased on comicheld at gunpointhand to hand combatsecond partrobothallucinationrevolvercombatscientistshot in the backdecapitationgood versus evilspyorphanbased on comic bookambushterroristaxemontagebridgearmymixed martial artsinternetexploding carsevered headno opening creditschild in perilunderwater scenetransformationtrainingcharacter repeating someone else's dialogueelectrocutionfantasy sequencemissionrace against timetough girllightningtankopening action scenescene during end creditsdeath of brotheramerican flagcountrysideexploding bodydie hard scenariomercenarysevered armshot in the armsecret agentdismembermentbattlefieldstylized violencestrong female charactermissilefalling down stairsdestructionbow and arrowflyingjeepcagesociopathbarnjail cellexploding buildingblockbusterswat teamgiantstrong female leadmind controllaserorphanageend of the worldaction heroinecolonelinterracial friendshipcrushed to deathback from the deadandroidfemale warriorrampageshieldcameohaunted by the pastvisiontarget practiceinventor3 dimensionalresurrectionevacuationheadphonesensemble castmarvel comicsjumping through a windowassault riflewisecrack humorsuperheroinehologrambody landing on a carfemale doctoreye patchgadgetterrorist plottelekinesisgatling gunshot multiple timeslaser gunbullet timerockettorso cut in halftracking devicefemale assassinsatelliteheroismfinal showdownreturning character killed offtimebombtractorwar heroarmored carsuper strengthshipwreckarms dealerworld dominationdronemegalomaniacarcherybunkerbillionairefemale spyneo nazihit by a truckfighter jetexploding truckdance clubgenetic engineeringinfertilityballerinasuperhero teamfinal battlecapejetteamworkhigh techarcheropen endedtragic pastaircraftaircraft carriercut into pieceseastern europehit with a hammerheart ripped outhuman experimentaerial combatceoforce fieldglowing eyesscience runs amokarmoryballroomexpectant motherchrysler building manhattan new york cityfictional cityregenerationvillain turns goodepic battlechopping woodslow motion action scenekiller robotgadgetrysexual innuendoexpectant fatherbrandinggadget carhuman aliensuper speedbuilding collapseinvulnerabilityflying carmayhemhidden doorsafe housetelling a jokesuper computercocktail partymotorcycle ridingfriendly fireflying manmarvel entertainmentelectromagnetic pulsesupervillainoslo norwaymarvel cinematic universebridge collapsesouth africanman versus machinelarge format cameradarwinismrobot as menacetalking computerexploding tankrobot as pathoscostumed herohumanity in periltalking robotrobot armyred capeevil robotgauntlethumanoid robotradical transformationrobot suittrain derailmentcaped superherocommuter trainfuturistic aircraftgemstonescepterflying superheromale aliennorse godsentient robotrunaway traindeath of twinmuscle growthextraterrestrial humantwin brother and sisterextraterrestrial manman wearing an eyepatchfloating citytechneparty gamejumping on a moving vehiclepunched in the face multiple timesthrowing dartsflying fortressstan lee cameosuperhero versus superherocharacter turns greengerman scientistseoul south koreathe incredible hulkblack widow the characterself driving carsemi truck and trailerverticle take off and landing aircraftfront wheeliewoman riding a motorcycleflying supervillainspitting out a toothwar hammerfalcon the characterhawkeye the characterhelicarrierreference to odintanker truck explosion (See All) |
In the Maya civilization, a peaceful tribe is brutally attacked by warriors seeking slaves and human beings for sacrifice for their gods. Jaguar Paw hides his pregnant wife and his son in a deep hole nearby their tribe and is captured while fighting with his people. An eclipse spares his life from t …he sacrifice and later he has to fight to survive and save his beloved family. (Read More)
| Subgenre: | epic |
| Themes: | murderdeathmarriagerapepregnancytorturehunting |
| Mood: | gorerainnightmare |
| Locations: | beachforestvillageshipjungle |
| Characters: | mother son relationshipfather son relationshipmother daughter relationshipchildrentattoopregnant womanpregnant wife |
| Period: | 16th century |
| Story: | quicksandanimal attacktemplefemale nuditybloodviolencemale rear nudityknifechasesurprise endingcorpseblood splattertesticlesshot in the chest …shot in the headbare buttfalling from heightvomitinghand to hand combatrivercombatshot in the backdecapitationsurvivalaxestabbingdeath of friendthroat slittingimpalementstabbed in the chestsnakesevered headno opening creditsdream sequencepublic nuditygravetreebeaten to deathpoisonringprankchildbirthloss of fatherunderwaterwaterfallflowerqueenmonkeykilling an animalspearwoundslaveryhunterloss of wifejumping from heightclubfrogcrossbowloss of sonstabbed in the throatmanhuntgash in the faceinsectprophecyrainstormclifftribepublic humiliationarrowbonfiredeath of loved onedaggershaved headmudpractical jokeepidemichuman sacrificemigrationarcherystabbed in the armno title at beginningcornfieldpyramidwrist slittingexplorerbleeding to deathshot through the mouthjumping into waterblack catheart ripped outmass gravesnake biteheart in handpitdroughtsailing shiploinclothbitten in the throatboarcentral americasolar eclipsepantherjaguarstar gazingbeehiveanimal trapmetaphysicalseparation from familymayariver rapidsancient civilizationblowgunmaulingsavagerymayanpushed from heighthead on a stakeblow pipetapirtribal warfarevillage set on firewater birthhunted turns huntermayan indianpoisonous frog (See All) |
John Rambo is removed from prison by his former superior, Colonel Samuel Troutman, for a top-secret operation to bring back POW's still held in Vietnam. Rambo's assignment is to only take pictures of where the POWs are being held, but Rambo wants to get the POWs out of Vietnam. Teamed up with female … Vietnamese freedom fighter Co Bao, Rambo embarks on a mission to rescue the POWs, who are being held by sadistic Vietnamese Captain Vinh and his Russian comrade, Lieutenant Colonel Padovsky. Rambo starts killing every enemy in sight while still focusing on his intentions to rescue the POWs. There are also corrupt American officials involved in the mission, including Marshall Murdock, one of Rambo's superiors. (Read More)
| Subgenre: | martial artscult film |
| Themes: | murderdeathrevengekidnappingbetrayalprisontortureescapeherodeceptionbrutality |
| Locations: | helicopterjungleprison campboat chasehelicopter chase |
| Characters: | soldierhostagetough guywarrioraction herorussiandeath of girlfriend |
| Period: | 1980s |
| Story: | hand grenadecold warak 47interrogationsequelcharacter name in titlebloodmale nudityviolencemale rear nuditybare chested malegunkissexplosionknife …chasepistolshootoutblood splatterfistfightmachine gunshot in the headshotgunrescuebattlegunfightbrawlshowdownrifleheld at gunpointhand to hand combatsecond partcombatshot in the backfoot chaseambushmassacremixed martial artsweaponexploding caranti herodisarming someoneone man armydouble crossone against manyperson on fireelectrocutionmissionexploding bodyneck breakingthreatened with a knifewaterfallsilencerciabattlefieldmachismouzibow and arrowheavy rainpropagandawalkie talkievietnamblockbusterfaked deathrocket launcherpump action shotgunmanhuntpsychotronicspecial forcesprisoner of warwisecrack humorknife throwingrelease from prisonrescue missionsequel to cult favoriterpgexploding helicoptergatling guncia agentvietnam veterankillmusclemanstrongmanwar herostandoffarcherysweathelicopter crashelectric shockgun violencemale protagonisttop secretdogfightchosen oneloinclothshot with a bow and arrowexploding boatvietnamesebombardmentcovert operationenduranceex special forcesguerilla warfarebandannajungle warfareprisoner of war camppythongreen beretm 60 machine gunrice fieldhunting kniferambospetsnazcompound bowworst picture razzie winnergunshiprussophobiacaptured by the enemyammunition beltammo beltcartridge belt (See All) |
Two low-level government employees, Emmitt Fitz-Hume (played by Chevy Chase) and Austin Milbarge (Dan Aykroyd), are chosen for a top-secret CIA mission. They are unsuitable as CIA agents but are deliberately chosen for this reason, as their mission is a decoy one and they are expendable. After being … fast-tracked through training they are parachuted into Pakistan where all manner of adventures await them. (Read More)
| Subgenre: | slapstickbuddy comedyspy spoof |
| Themes: | betrayaltorturedrunkennessescapedeceptionmilitary |
| Mood: | spoofparodyjames bond spoof |
| Locations: | forestsnowdesertelevatorwoods |
| Characters: | doctorsoldierrussianamerican abroad |
| Period: | 1980s |
| Story: | hand grenadecold warak 47interrogationtitle spoken by characterexplosionknifechasethree word titlesurprise endingpistolshootoutmachine gunhorserescue …arrestgunfightrifleheld at gunpointhandcuffsspyambushmountainambulanceweapondouble crosstrainingbinocularspay phonemissionundercoverproduct placementninjarace against timetentsoviet unionpremarital sexthreatened with a knifegeneralsecret agentespionageciawashington d.c.surgerymissileuzifarcejeepsecurity cameraexploding buildingblockbusterwristwatchpress conferencelaserrocket launchercolonelcameou.s. armydual wieldafghanistanparachutewisecrack humorspyingundercover agentslackerdeertribeeye patchflamethrowerrocketcamelsatellitefemale soldiercia agentsecret serviceintelligencepakistanpopcornfemale spyhanging upside downone linerkgbtop secretnuclear warspy herosubterraneanfreedom fighterarmy basepentagonnuclear weaponsnuclear threatboom boxdecoycovert operationnuclear missileworld war threeweaponryintelligence agentelectromagnetic pulsejumping from an airplanedrive in theaterreference to pepsironald reagantranquilizer gunelectronics experttrivial pursuit (See All) |
Dominic and his crew thought they'd left the criminal mercenary life behind. They'd defeated international terrorist Owen Shaw and went their separate ways. But now, Shaw's brother, Deckard Shaw, is out killing the crew one by one for revenge. Worse, a Somalian terrorist called Jakarde and a shady g …overnment official called "Mr. Nobody" are both competing to steal a computer terrorism program called "God's Eye," that can turn any technological device into a weapon. Torretto must reconvene with his team to stop Shaw and retrieve the God's Eye program while caught in a power struggle between the terrorist and the United States government. (Read More)
| Subgenre: | martial artsheist |
| Themes: | murderdeathfriendshiprevengekidnappingweddingfuneralterrorismsurveillanceamnesiamurder of a police officernear death experience |
| Mood: | car chase |
| Locations: | hospitalbeachforesthelicoptercemeteryairplanelos angeles californiabusdesertlondon englandtunnelabandoned factoryhumvee |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshiphostagetough guyaction heroamerican abroadsniper riflepregnant womanpolice chasego go dancer |
| Period: | 2010s |
| Story: | car falling off a cliffmilitary basehand grenadeak 47sequelnumber in titleviolenceflashbackbare chested maleexplosionpartypistolcell phoneshootoutbeating …shot to deathfistfightmachine gunshot in the chestshotgunslow motion scenepunched in the facearrestbrawlfalling from heightshowdownheld at gunpointbeerhand to hand combatsunglassesbombcar crashhandcuffsrevolvershot in the backfoot chaseambushterroristmountainambulancemansiondeath of friendbridgemixed martial artsexploding caranti herohit by a carpolice officer killednews reportnecklaceduelattempted murdercharacter repeating someone else's dialoguemissionproduct placementrace against timetough girlbodyguardexploding bodylaptopcharacter says i love youmercenarysilencerespionagesubtitled scenemissileuzifalling down stairsgrenadehead buttslow motionscene during opening creditscatfightcomared dresswalkie talkieexploding buildingblockbusterparking garagerocket launcherbald manmasked manreverse footagecameotokyo japanstealing a cardual wieldmanhuntkicked in the crotchspecial forcesstabbed in the legpunched in the chestjumping through a windowthrown through a windowassault rifleaerial shotparachutecommandobulletproof vestbody landing on a carrescue missiongadgetlasersightterrorist plotexploding helicoptergovernment agentstick fightgatling gungrenade launcherfast motion scenesouthern accenttracking deviceclose up of eyesenglishman abroadfemale soldierterrorist groupex copbag over headcar racearmored carparkourdronecomic reliefrace cartombstonebillionairecommando unithelicopter crashcomputer hackerexploding trucksawed off shotgunone linermacguffinhigh techexploding housewoman in a bikinihappy birthday to yousledgehammersolitary confinementrace trackbromancebullet proof vestcamera focus on female buttskydivinghelicopter pilotseventh parttoy carwrenchfalling through the floorwoman punching a mancomputer virusbuilding collapsemicrochipcoming out of retirementconvoypenthouseflying carcollapsing buildingjumping from a carazerbaijandominican republicflash drivereference to osama bin ladenblack opsstar died before releasesledge hammermini vantroubled productionhigh risechop shopcar stuntarm castmaximum security prisonwoman wearing a red dressrappellingends with narrationfirefightcrucifix pendantfuturistic aircraftmotorcycle jumpshackledcar crashing through a windowwoman wearing a micro mini skirtwoman wearing a one piece swimsuitdrag racefalling down an elevator shaftlocked in a celldriving off a cliffhead on collisionthumb drivehelicopter gunshipair dropsuper carmascara runningtalking to a gravec 17 globemastercorona beerfight between two womenair to surface missilejack knifed truck (See All) |
A washed up monster chaser convinces the U.S. Government to fund a trip to an unexplored island in the South Pacific. Under the guise of geological research, the team travels to "Skull Island". Upon arrival, the group discover that their mission may be complicated by the wildlife which inhabits the …island. The beautiful vistas and deadly creatures create a visually stunning experience that is sure to keep your attention. (Read More)
| Subgenre: | martial artsblack comedyfish out of watercreature featuremonster moviedisaster filmdisaster movielive action and animation |
| Themes: | murderdeathrevengebetrayalfearescapemonsterdeceptionmilitaryangerobsessionparanoiapanicself sacrificenear death experience …u.s. military (See All) |
| Mood: | ambiguous endingpoetic justice |
| Locations: | barbeachhelicopterboattaxishipcavestrip clubjunglecampfirestorm at seahelicopter explosion |
| Characters: | african americansoldierphotographertough guywarriorjapanesesnipersecretaryamerican abroadsniper riflemilitary officeru.s. soldieramerican soldierfemale scientistbiologist …human versus monster (See All) |
| Period: | world war two1970s1940syear 1944year 1973 |
| Story: | world war two veteranmental breakdownhand grenadecold warak 47character name in titlebloodviolencefightcigarette smokingphotographexplosionknifechasesurprise ending …pistolfirecorpseblood splatterfistfightmachine gunshotgunrescueslow motion scenepunched in the facecamerabattleswordbrawlfalling from heightshowdownrifleheld at gunpointhand to hand combatsunglassesbombislandrivercombatstrippertelephonescientistf wordsurvivalfoot chaseambushmassacreimpalementweaponmapsevered headradiodouble crossunderwater scenecreaturegraveyardnews reportpilotbinocularsdangerprologueprotestperson on firemissionproduct placementrace against timeknocked outlightningopening action sceneskeletonscene during end creditsshot in the shoulderlong takeamerican flagexploding bodysuspicionthreatened with a knifemercenarysevered armtypewritersacrificesubtitled scenewashington d.c.captaincard gamegrenadedestructionburned alivespearheavy rainmachetescene during opening creditsragewalkie talkiebeardvietnamblockbustervietnam warwristwatchgiantasian womanphone boothskullcgiburialmexican standoffwhite housecolonelcrushed to deathbar fighteaten alivefull moongas maskface paintexplosiveu.s. armycynicismkatana swordfight to the deathhatredchaospool tableensemble castcigarette lighterspecial forcesswamparchival footagesenatorscene after end creditspunched in the chestassault riflebilliardsbooby trapaerial shotparachutewisecrack humorcommandorainstormdeertribegasolinelieutenantrescue missionsevered legflamethrowerphoneburned to deathexploding helicopterdaggermoral dilemmagatling gunprequelgrenade launchersurprise after end creditssouthern accenttorso cut in halftracking deviceclose up of eyesenglishman abroadsatellitetaking a photographkatanavietnam veterancartoon on tvexpeditionfinal showdowndockscene before opening creditsgiant monsterfireballstrandedshipwreckgorillaplane crashyoung version of charactermarinewallcommando unitbearded manhurricanehelicopter crashcommando missioncrash landingpalm treealtered version of studio logocamcordercamouflageapeaircraft carrierguidemass gravepsychotronic filmflare gunreference to richard nixonexploding airplanestupid victimgiant animalu.s. senatorcompassgas explosionvietnam war veteranrainforestfootprintgovernment conspiracypower struggleshoulder holstervinylgiant spiderhelicopter pilotimperialismbangkok thailanddetonatorsurprise during end creditsdog tagbritish actor playing american characterdockskaijusquidex special forcestrackergiant creaturepool cuepacifistgeologistgas grenadepoison gaslugeruh 1 huey helicoptersuicide missionbamboowater bottlepacifismtailplatoonnapalmchinese womanbomb explosionnative tribebotanistsmoke grenadesouth pacificair basepterodactyl70scave paintingking kongsimian fictiongiant squidmonster versus monsterstranded on an islandvietnam vetreflection in eyesecret government organizationslideshowreference to godzillacave drawingdog tagspeace treatysoldier killedwar photographersecret government organisationsequel baitinglost world50 calibre machine gunphoto labgiant apeman versus naturegiant octopusprehistoric creaturegiant lizardstabbed through the mouthcabmassive explosiontaxi cabbackstoryman versus monsterthe white housethroat ripped out50. caliber machine guncamera flashcrash survivormauser c96 pistolsaigon vietnamhostile environmentmauser pistolreference to the bermuda triangleseismologistmilitary unitslam dunkalarm signalshared universeuncharted island (See All) |
Can you make a movie out of a video game? That's the question that is answered by this film. Mario Mario and Luigi Mario, two hard working plumbers find themselves in an alternate universe where evolved dinosaurs live in medium hi-tech squalor. They find themselves the only hope to save the Earth fr …om invasion. (Read More)
| Subgenre: | independent filmcult filmb movieabsurdismdystopiaslapstick comedycyberpunkcampy |
| Themes: | surrealismkidnappingprisontorturemonstergangstermagicmafiaevolutionunlikely hero |
| Mood: | car chase |
| Locations: | new york cityrestaurantnightclubdesertelevatorpolice station |
| Characters: | husband wife relationshippoliceboyfriend girlfriend relationshipbrother brother relationshipaction heropolice chase |
| Period: | 1990s |
| Story: | archaeologistalternate dimensioninterrogationsequelcharacter name in titletitle spoken by characterexplosionthree word titlesurprise endingblonderemakerescuearrestbombgood versus evil …orphanexploding carbrunettenunkingcreaturenews reportprincesstransformationorganized crimerace against timequeenhenchmanpizzachainsawlifting someone into the airmutantroyaltybrooklyn new york cityaction heroinedinosaurstupiditydamsel in distressdiamondanimated sequenceitalian americanbased on video gamesuper villainscene after end creditssexy womanalternate realitymutationlasersightblack magicflamethrowerdictatorteleportationsurprise after end creditsnews reportergothyellingworld dominationbrooklyn bridgemegalomaniacbaseball capstatue of liberty new york citymarioplumberfight the systemopen endedmugshotsubterraneanimprovised weaponx rayed skeletonlifting female in airparallel worldabandoned babymultiple cameostroubled productionclichealternate worldcape the garmentdimensionmultiple monstersyoshisuper marioparallel dimensionfungusscally caplizard monsterhidden civilizationoldies music (See All) |
John Rambo's former Vietnam superior, Colonel Samuel Trautman, has been assigned to lead a mission to help the Mujahedeen rebels who are fighting the Soviet invasion of Afghanistan, but the Buddhist Rambo turns down Trautman's request that Rambo help out. When the mission goes belly up and Trautman …is kidnapped and tortured by Russian Colonel Zaysen, Rambo launches a rescue effort and allies himself with the Mujahedeen rebels and gets their help in trying to rescue Trautman from Zaysen. (Read More)
| Subgenre: | independent filmmartial artscult filmfish out of water |
| Themes: | murderdeathrevengekidnappingprisontortureescapeheroangerbrutality |
| Locations: | helicopterdesertcavesewer |
| Characters: | hostagetough guywarrioraction herokillersniperamerican abroadsniper rifleself surgery |
| Period: | 1980s |
| Story: | hand grenadecold warak 47interrogationsequelcharacter name in titleviolencebare chested maleexplosionknifesurprise endingpistolshootoutbeatingfistfight …machine gunhorseshotgunrescuepunched in the facebattlegunfightbrawlshowdownriflehand to hand combatbombcombatambushmassacremountainmixed martial artsexploding caranti herodisarming someoneone man armythird partshot in the legnecklaceduelone against manymissiontentkicked in the facetankhangingshot in the shoulderexploding bodyhorse ridingneck breakingbattlefieldchessmachismobow and arrowhead buttjeepjail cellroman numeral in titleblockbusterrebelrebellionrocket launchercolonelcannonbombingexplosiveconstruction sitefanresistanceafghanistanfather figurebooby trapknife fightprisoner of warknife throwingsiegelonerrescue missionflamethrowerrpgexploding helicopterbloodbathstick fightroundhouse kickgrenade launcherblood on camera lensvietnam veteranfighterfinal showdownmolotov cocktailmonasterytimebombmusclemanstrongmanwar heroarms dealerstandoffpakistanarcherybunkerflaresweathelicopter crashembassyexploding truckteethfinal battlebowcavalryfreedom fighterresistance fightersovietarmy basecavernrock climbingdouble agentforthide and seekvietnam war veteranguard dogshot with a bow and arrowstrong mancutcanteenchild soldiercovert operationrescue attemptheadbandfire fightdefectorpoison gasmortarheavy breathingnapalmblow torchabbeyanti aircraft gunplay fightexploding tankhunting knifetrip wirecavalry chargerambosurroundedlucky charmmachine gun nestspetsnazwar atrocityyoung soldiermusclescompound bow50 calibre machine gunkey ringvladimir leninstrafinggunshiprussophobiasoviet afghanistan warcauterizationfragmentation grenademujahideenguard towerstinger missilemountaintop monasterymi 24 hind helicopterammunition beltbuzkashicaptured by enemypeshawar pakistanrebel baseammo beltcartridge beltcauteryclimb ropehalftrackprison barsrappel from helicopter (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
| Subgenre: | martial artsconspiracydystopiafish out of watercyberpunkdark fantasy |
| Themes: | supernatural powermurderdeathrevengekidnappingescapemonsterinvestigationsurveillancehome invasionpolice brutality |
| Mood: | goredarknesspoetic justice |
| Locations: | helicopterelevatorpolice stationrooftopsewer |
| Characters: | father son relationshippolicemother daughter relationshipdoctorfemale protagonistdetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughterself mutilation |
| Period: | future2010s |
| Story: | animal attackfourth parthand grenadesequelbloodviolencetwo word titlebare chested malephotographexplosionknifechasesurprise endingpistolfire …shootoutbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescuepunched in the facebattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashhandcuffsrevolvercombatkung fuscientistshot in the backsubjective cameradecapitationgood versus evilsurvivalflashlightstrangulationaxemassacrethroat slittingimpalementstabbed to deathcolon in titlemixed martial artsstabbed in the chestsevered headno opening creditsanti herochild in perilhit by a carfictional warunderwater scenecreaturesearchnews reportshot in the legtransformationshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderinjectionexploding bodyneck breakingmercenarysevered armshot in the armhenchmanexperimentwerewolfkilling an animalhypodermic needlegothicsecurity camerakicked in the stomachgiantjumping from heightparking garageaction heroinegun fucrushed to deathsocial commentaryback from the deadfemale warriorstealing a carexplosivestabbed in the throatwhippartner3 dimensionalresurrectionshot in the facestabbed in the headstabbed in the leg3dpunched in the chestjumping through a windowthrown through a windowbody landing on a carknife throwingstabbed in the eyemutationflamethrowertelepathytorso cut in halfdesert eaglesuper strengthstabbed in the armshot in the eyescalpelgenetic engineeringdamman kills a womanscene of the crimebitten in the neckepiloguestabbed in the shouldershot in the throatopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
| Subgenre: | martial artssword and sorceryalternate historysword and fantasy |
| Themes: | supernatural powermurderdeathrevengesuicidekidnappingjealousypregnancytortureescapeheromagicdeath of fatherbrutalitydeath of mother …crueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
| Mood: | gore |
| Locations: | snowboatwoodscastlecampfirewalled city |
| Characters: | father son relationshiphusband wife relationshipfather daughter relationshipboysoldierthieftough guywarrioraction herowitchsingle fatheryounger version of characterdancing girl |
| Story: | adventureranimal attackinterrogationfemale nuditycharacter name in titlebloodmale nudityviolenceflashbackbare chested malesex scenefightexplosionknifechase …three word titlefireshot to deathblood splatterfistfighthorseshot in the chestremakeshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdownhand to hand combatdemonfightingcombatshot in the backdecapitationgood versus evilfoot chaseassassinbound and gaggedsword fightbased on comic bookambushname in titleaxemassacremountaindisguisethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headnunno opening creditsanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreatureshot in the legprincessdrowningone against manybeaten to deathstabbed in the backkeyperson on fireattackevil mankicked in the facetough girlscarchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallsevered armbattlefieldfreeze framesingle parenthenchmanpiratebow and arrowburned alivekilling an animalhead buttspearassassination attempteggcatfightslaverymutilationkicked in the stomachjumping from heightmonkgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationfemale warriordamsel in distressdual wield3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdark herodungeoncapturedisfigurementeye patchpassionate kissdemonic possessionsword duelblack magicburned to deathdaggerstick fightpipe smokingpalaceswordsmandriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacadventure herosorcerertaverntentacletestcrushed headsword fightingsword and sandalslingshothammockchainedbarbarianprehistoric timesarcherfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipshot with a bow and arrowstarts with narrationhorse chasewagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
James Bond is back again and his new mission is to find out how a Royal Navy Polaris submarine holding sixteen nuclear warheads simply disappears whilst on patrol. Bond joins Major Anya Amasova and takes on a a web-handed mastermind, known as Karl Stromberg, as well as his henchman Jaws, who has a m …outhful of metal teeth. Bond must track down the location of the missing submarine before the warheads are fired. (Read More)
| Subgenre: | martial artscult filmspy film |
| Themes: | herosurveillance |
| Mood: | car chase |
| Locations: | trainmotorcyclenightclubdesertseaenglandoceansubmarineu boatnuclear submarine |
| Characters: | action herohitmanvillaingirl in a bikini |
| Period: | 1970s |
| Story: | amphibious vehiclehand grenadecold warsequelbased on novelviolencefightexplosionchaseshootoutbattlebikinibritishspymountain …underwater scenevanfemme fatalefive word titlekaratesoviet unionautomobileunderwaterespionagehenchmanvillainessblockbustersharkdead womandamsel in distressreverse footagescotlandimpostoregyptthrown through a windowparachutespyingundercover agentskiingcliffgadgetflamethrowersports carexploding helicoptersunbathingcamelruinssecret serviceintelligencemegalomaniacfemale spypyramidmotorboatbritainteethjudohigh techspeedboatwoman shotspy heroharemsecret missionnuclear weaponsmotorcycle with a sidecarhelicopter pilotjet skigadgetrymushroom cloudcult figuregadget carsecret service agentfemale pilotnuclear missiletenth partfalse teethatlantisworld war threehero kills a womanintelligence agentbritish secret servicebritish intelligenceintelligence agencysphinxwoman with a gununderwater fightbase jumpingbritish navytitle mentioned in songsecret basebond girlrussian spyjawssardiniatankermarine biologistoil tankerarch villaininvincible henchmansubmersibleegyptian pyramidsoviet spylotus the carsubmarine crewvillainyofficial james bond seriessubmarine captainofficial bond filmwoman spyforeign agenthero killing womanski chasewoman agentwoman killed by sharkmetal platebig teethmaglevrussian enemysilent henchman (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | supernatural powermurderdeathfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneralmonster …deceptionmagicrobberyangerdeath of fatherbrutalitydeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | alternate dimensionanimal attackinterrogationcharacter name in titlebloodviolenceflashbackdogbare chested malefighttitle spoken by characterexplosionknifechasesurprise ending …firebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualunderwater scenekingcreaturefemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighterscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and … the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
| Subgenre: | suspensetragedypost apocalypsedystopiaepicchrist allegory |
| Themes: | murderdeathfriendshiprevengesuicidekidnappingbetrayalfeartortureescapedeceptionmilitarytravelangerbrutality …obsessiondeath of motherparanoiaredemptionhopedeath of wifepanicdyingself sacrificenear death experiencemurder of familyprison escapestarvationfuture war (See All) |
| Mood: | raindarkness |
| Locations: | beachforesthelicoptersnowdesertwatervillagewoodscavejunglecampfiretunnelmilitary truck |
| Characters: | mother son relationshipfather son relationshipfamily relationshipshusband wife relationshiptattoobrother brother relationshipsoldierbabyhostagelittle girlsnipersniper rifledeath of a friend |
| Period: | near future |
| Story: | animal attackhand grenadeak 47interrogationsequelbloodviolenceflashbackbare chested malefightphotographexplosionknifechasesurprise ending …pistolfireshootoutbeatingdreamcorpseshot to deathfistfightfoodmachine gunhorseshot in the chestshot in the headshotgunrescueslow motion scenebattlegunfightbrawlfalling from heightshootingshowdownrifleheld at gunpointsunglasseshallucinationalcoholcombatshot in the backsubjective camerasurvivalorphanflashlightambushstrangulationaxemassacremountaindeath of friendmontagebridgearmyimpalementprisonerweaponmapno opening creditspart of serieschild in perilfictional wardouble crossjourneythird partattempted murdertreebinocularsbeaten to deathdangerattackcharacter's point of view camera shotmissionrace against timedollknocked outtankopening action scenedeath of brotheramerican flagtragic eventexploding bodydeath of sonwaterfallflowerloss of motherhandgunwhippingsubtitled scenemonkeybattlefieldmissileropetraitorshavingsabotagegrenadedestructionbow and arrowspearwarehouseheavy rainmachetetalking animalcagequesthelmetviruscaptivewalkie talkiecrucifixstealingloss of loved onebeardhammerexploding buildingloss of wifeblockbusterdesperationlaserrocket launchertorchburialcolonelsocial commentaryprison guardfloodinvasionu.s. armycrossbowloss of sonwhiphatredmercilessnessmutespecial forcesdeath of protagonistassault rifleinfectionaerial shotprisoner of warshadowcommandocapturebulletproof vestcliffbordertribesnowingrescue missionlasersightarrowbonfiredeath of loved onerpgexploding helicopterloss of brothersign languagesmokemoral dilemmashaved headgatling gungrenade launchermain character diesimprisonmentfemale soldierabandoned buildingflagfinal showdownreturning character killed offarmored caralarmabandoned houseshot with an arrowgorillawallshoutinghugclimbingkidhelicopter crashfilm starts with textfallingbehind enemy linesmercy killingblizzardrazorleaderbody bagaltered version of studio logofinal battleskychainedchimpanzeepart computer animationcommando raidmurder attemptaperighteous ragedeath of familybowtragic endingholepsychological tortureavalancheheroic bloodshedloss of familyhermitanimal killingarmy baseassisted suicidevalleyknocked out with a gun buttberetfleeingloggas explosiontrilogyphotoepic battlehorse chasemercypunchingkeysleadershipbarricadeguerilla warfaremilitantleft for deadorangutanshot in the sidewhite horsenational anthemsaddlestar spangled bannersurprise attackexoduspickaxeoutrunning explosionmissile launcherplatoonslave laborspear throwingforced laborprisoner of war campsecret tunneldarwinismtexthead shavingmute childunderground tunnelescape planprovocationoasissimian fictionfeedingmilitary campexploding bridgelast wordsprequel and sequellockupcoveranimal fightman versus naturemilitary jeeptalkingcaesarfernplanet of the apes50. caliber machine gunsequel to a rebootthrowingturncoattalking animalsfall downapesrolling (See All) |
Civil Unrest in the European country of Moldova has US forces engaging the insurgents however there is a new threat who has decided both are their enemy. This new threat resides in an alternative spectrum that makes them invisible to the naked eye and instant death to anyone confronting them. Locals … believe they are Spirits of War but others believe they are superior arms technology fabricated by the Moldova government.. (Read More)
| Subgenre: | independent filmsuspensesupernaturalsurvival horror |
| Themes: | supernatural powermurderdeathghostfearescapemilitarycorruptionparanoiaexploitationpanicself sacrificetechnologynear death experience |
| Locations: | helicopterairplanebathtubbusapartmentrooftoplaboratoryabandoned factory |
| Characters: | doctorsoldiertough guywarriorlittle girllittle boysnipersniper rifleengineer |
| Period: | near future |
| Story: | military basehand grenadeak 47bloodviolenceone word titletitle spoken by characterexplosionchasesurprise endingpistolcorpseblood splattermachine guncar accident …shotgunrescueslow motion scenecamerabattlefalling from heightshowdownheld at gunpointbombrobotsciencecombatscientistsubjective cameragood versus evilspysurvivalflashlightambushmassacremontagebridgeimpalementchild in perilfictional warbinocularsdangerprologuefactorycharacter's point of view camera shotmissionrace against timedeath of childtough girltankdeath of brotherexploding bodymercenarydirectorial debutgeneralsilencerciabattlefieldchild murdercaptaingrenadedestructionheavy rainscene during opening creditshelmetsurvivorwalkie talkiesergeantlaserrocket launchermexican standoffsocial commentaryfemale warriortarget practiceexplosiveu.s. armydual wieldinventorpower outageevacuationspecial forcessuperstitionassault rifleairplane crashaerial shotcommandosoulbulletproof vestbody landing on a carrescue missionlasersightpolitical corruptiongatling gungrenade launcherlaser gunbullet timetranslatorabandoned buildingbazookacia agentinvisibilityanti warfinal showdownapparitionjunkyardscene before opening creditsarmored carsuper strengthmajorbunkerfemale spycommando unithanging upside downcornfieldfilm starts with textcommando missionbehind enemy linesmercy killingreference to albert einsteinvirginiafinal battletop secretexperiment gone wrongfilmed killingvideo footagehigh techcommando raidcamouflageoverturning carconsciousnessairfieldeastern europehuman experimentpsychotronic filmnight vision gogglesclimbing out a windowbilingualismx rayed skeletonresearcherlandminelast standslow motion action scenegovernment corruptionnuclear power plantbritish actor playing american characterbarricadeironland minesuper soldierassembly linemoldovaelectromagnetic pulsesecret laboratoryfreeze to deathminefieldair baserappellingexposed brainnight vision binocularsinsurgentuh 60 blackhawk helicopterabandoned apartmentabandoned hotelabandoned cityprojectorcivil unrestdelta forceinsurgencybath tubc 130 herculesice blockexperimental technologyhelmet camerahomemade explosiveabandoned busbuilding a bombpull the plugshoulder launched missilev 22 osprey (See All) |
Mortal Kombat is an ancient tournament where the Earth Realm warriors battle against the forces of Outworld. Liu Kang and a few chosen fighters fought and defeated the powerful sorcerer Shang Tsung, their victory would preserve the peace on Earth for one more generation. Taking place now where the f …irst movie left off, the Earth realm warriors live a short period of peace when evil forces from another dimension come to invade and wreak havoc on Earth. They are guided by the forces of Outworld leader, Shao Kahn and his generals such as: Motaro, Rain, Ermac, Sheeva and Sindel. Now Liu Kang, Raiden, Jax, Sonya and Kitana must defeat Shao Kahn in six days before the Earth realm merges with the Outworld. (Read More)
| Subgenre: | independent filmmartial artscult filmb movieabsurdismcampy |
| Themes: | supernatural powermurderdeathrevengesurrealismkidnappingbetrayalescapemonsterherodeceptionseductionbrutalityredemptionguilt …apocalypseself sacrifice (See All) |
| Mood: | nightmare |
| Locations: | desertcavelaboratory |
| Characters: | father son relationshipmother daughter relationshipbrother brother relationshiphostagetough guywarrioraction heronative americanvillainwitch |
| Period: | 1990s |
| Story: | alternate dimensiontemplesequelbloodviolencebare chested malefightexplosionfirebeatingdreamfistfightrescuepunched in the facebattle …brawlshowdownhand to hand combatbombsecond partrobotfightingcombatkung fugood versus evilsurvivalassassinambusharmymixed martial artsone man armyfictional wardouble crosscreaturefemme fataletransformationtrainingone against manybeaten to deathkarateattackninjadragonrace against timeevil mankicked in the facetough girllightningmartial artistexploding bodyneck breakinggeneralqueenstylized violencehenchmanwerewolficedestructionelectronic music scoreheroinecatfightloss of friendkicked in the stomachmind controlcgiend of the worldaction heroinecrushed to deathback from the deadmasked manfemale warriordamsel in distressinvasionfight to the deathbased on video gamechaosresurrectionimmortalitypunched in the chestalternate realitykarate chopstick fightteleportationroundhouse kickkarate kickfemale assassinfighterfinal showdownreturning character killed offruinskung fu masterfemale fightereiffel tower parissuper strengthfireballportalworld dominationmegalomaniacemperortwin brothersorcererninjitsushamanfinal battleshape shifterwoman fights a manimmortalsubterraneanwarlordgodsorceressone woman armyglowing eyesjujitsureturning character with different actorbanishmentparallel worldjeet kune doman fights a womanmysticevil twinfemale ninjabrother versus brotherunderground fightingcounciloutrunning explosionevil sorcererevil queencentaurweather manipulationshape shiftingelderfrozen aliveprosthetic armskull maskmortal kombathydraself destruct mechanismevil brotherrobotic arm (See All) |
After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.
| Subgenre: | fish out of water |
| Themes: | friendshipsurrealismmagictime travelcouragefirst lovemissing child |
| Mood: | breaking the fourth wall |
| Locations: | beachforestmotorcyclecemeterysmall townjungleabandoned factorybicycle chase |
| Characters: | mother son relationshipfather son relationshipfamily relationshipsmother daughter relationshipbrother sister relationshippolice officerbullypsychiatrist |
| Period: | 1990s1960s19th century20th centurychristmas party1860syear 1969 |
| Story: | quicksandanimal attackone word titletitle spoken by charactersurprise endingcar accidentshotgunarrestrifleheld at gunpointhandcuffsrevolverriverorphanaxe …mansionbridgeapologyno opening creditschild in perilhit by a carunderwater sceneconfessionlibraryprologuefactoryactor playing multiple rolesconvertiblesubtitled scenemonkeyfireplaceheavy rainlifting someone into the airelephanthunteroverallsblockbustercgiearthquakepresumed deadrampagefloodstealing a carconstruction sitechaostime lapse photographylionatticrefrigeratormutationbullet timebatimpersonating a police officerhiding in a closetcrocodiletween girlshoefriends who live togetherboard gamefather son reunionmotorcycle coprecluseimprovised weaponbased on children's bookanimal killingloss of parentsrainforestlootinggiant spiderhuman becoming an animalrhinocerossanta claus suitauto theftmosquitogiant insectchestzebraexterminatorvortexnew hampshirestampedegun storetailconveyor beltaltering historypelicaninvestment bankertrailer narrated by hal douglasmonsoonsporting goods storepoison ivybig game hunterinsect attackcarnivorous plantyear 1869dybbuk boxcar through wallanimal driving a cartrailer narrated by nick tate (See All) |
Based on the internationally best-selling novel by Jonas Jonasson, the unlikely story of a 100-year-old man who decides it's not too late to start over. For most people it would be the adventure of a lifetime, but Allan Karlsson's unexpected journey is not his first. For a century he's made the worl …d uncertain, and now he is on the loose again. (Read More)
| Subgenre: | coming of ageblack comedy |
| Themes: | moneydrunkennessescapeinvestigation |
| Locations: | airplanebusrussiaspainsubmarine |
| Characters: | police |
| Story: | railway stationhand grenadecold warflashbackbare chested malegundancingexplosionpistolcell phonecorpsecar accidentshot in the headcatbirthday …alcoholspyold mannonlinear timelinesevered headradiojourneysuitcaseu.s. presidenthairy chestsoviet unionsplit screenciabirthday cakeelephantaccidental deathbirthhomemale underwearstealing a carmobile phoneold agemustachebriefspolice inspectormemory lossgiving birthmultiple storylinebodyfoxlighterrailwayretirement homeman in underwearbody in a trunkreference to albert einsteinnursing homespanish civil warnuclear bombberlin wallnon linearnuclear explosionreference to josef stalinphysicistfrozen bodyjosef stalinfrozenstalingulagdead body in car trunkdead body in a car trunkelderly protagonistblasterescape out a windowreference to mikhail gorbachevreference to francocentenarianreference to harry s trumanfrancokilled in an explosionescaping out a windowharry s trumanbody in a car trunkfrozen corpsefall of berlin wallmikhail gorbachev100th birthdaykilled in explosion100 year oldelephant ridingriding an elephantcold storage room (See All) |
This is the story of a nine-year-old boy named Hogarth Hughes who makes friends with an innocent alien giant robot that came from outer space. Meanwhile, a paranoid U.S. Government agent named Kent Mansley arrives in town, determined to destroy the giant at all costs. It's up to Hogarth to protect h …im by keeping him at Dean McCoppin's place in the junkyard. (Read More)
| Subgenre: | cult film2d animationfish out of water |
| Themes: | deathlovefriendshipfearescapemilitaryparanoiahopeprejudiceself sacrifice |
| Locations: | trainschoolforestcarsmall townbicyclewaterwoodslakesubmarine |
| Characters: | mother son relationshipfriendboysoldieralienreference to godsingle motherwaitress |
| Period: | 1950s |
| Story: | cold warinterrogationcharacter name in titlebased on novelbloodgunexplosionchasethree word titlesurprise endingbased on bookwatching tvcamerafalling from heightrifle …bedbathroomrobotclassroomprayernewspaperarmydinertoiletdinnerno opening creditschildcoffeetreebinocularsdirectorial debutgeneralcowsingle parentrockmissileflyingcomic bookhelmetice creamragehuntersevered handrampagechild's point of viewresurrectiondaydreamfalldeertragic herogovernment agentchloroformchocolategiant robotjunkyardsculptorpopcornsquirrelunconsciousnessschoolteacheralien contactmetaltoy gunmainereference to supermanwindowtoilet paperraccoonphotosaying gracehit by a trainbased on poemmeteoritenuclear missilenaillessonbouldercollisiondummytriumphtidal waveaudio flashbacktrain wreckunconsciousdead deerdeer huntinggun controllaxativebad temperbeatnikyear 1957robot as pathosrailbb gunmale soldieralien robotlife lessonflying robotkilling a deermilitary jeepwarner broswatching horror movie on tvanti violenceknocked unconciousmechanical lifeformextraterrestrial robotscrapstaring contesteating non foodwooden dummyunzipping pants flycartoon squirrel (See All) |
History is turned on its comic head when, in 10th century England, King Arthur travels the countryside to find knights who will join him at the Round Table in Camelot. Gathering up the men is a tale in itself but after a bit of a party at Camelot, many decide to leave only to be stopped by God who s …ends them on a quest: to find the Holy Grail. After a series of individual adventures, the knights are reunited but must face a wizard named Tim, killer rabbits and lessons in the use of holy hand grenades. Their quest comes to an end however when the police intervene - just what you would expect in a Monty Python movie. (Read More)
| Subgenre: | independent filmcult filmblack comedyabsurdismsword and sorceryepicslapstick comedybritish comedybased on sketch comedy |
| Themes: | murdersurrealismmonsterseductioncannibalismcommunism |
| Mood: | goresatirespoofbreaking the fourth wall |
| Locations: | forestvillageenglandcastlecave |
| Characters: | father son relationshippolicefrench |
| Story: | riddleanimal attackhand grenadebloodviolencesingingsurprise endingvoice over narrationrescuelow budget filmbritishdecapitationsword fightthroat slittingimpalement …legendwritten and directed by cast memberactor playing multiple rolesrabbitskeletondirectorial debutsevered armcowdismembermentheart attackquesteccentricflatulenceknightpart animationmonkcrushed to deatheaten alivepresumed deadabsurd humorreverse footagearranged marriagehit in the crotchwizardensemble castmedieval timesdungeonsiegeducksevered legwedding receptionirreverenceflagnarratorspiral staircaseplaguecomedy troupegorillaarcherymacguffinfriends who live togetherchapter headingshermitanachronismanarchismabsurdno endingtauntingcowardiceexcrementcoconutfired from a jobswallowcatapultmidnight moviecult movie castking arthurrope bridgeholy grailwhite rabbitdepiction of godballadeercamelotarthurian legendabyssllamadark agesmovie reality crossovermonty pythonanthraxscriptureminstrelflagellation10th centuryintermissionmusical sequence in non musical worktrojan horsefrench stereotypeno ending creditslancelotexploding animalstorybook in opening shotcorporeal mortificationrotisserietauntsuspected witchattempted filicideblack knightkiller rabbit (See All) |
Nick Fury is the director of S.H.I.E.L.D., an international peace-keeping agency. The agency is a who's who of Marvel Super Heroes, with Iron Man, The Incredible Hulk, Thor, Captain America, Hawkeye and Black Widow. When global security is threatened by Loki and his cohorts, Nick Fury and his team w …ill need all their powers to save the world from disaster. (Read More)
| Subgenre: | martial artssuperherofish out of water |
| Themes: | supernatural powerrevengebetrayalescapemonsterdeceptionredemptionrivalrytechnologyartificial intelligencespace travel |
| Locations: | new york cityforesthelicopterairplaneelevatorouter spacelaboratory |
| Characters: | brother brother relationshipsoldierpolice officeralienhostagetough guywarrioraction heroreference to godrussiangermanamerican abroadex soldieralien superhero |
| Period: | 2010s |
| Story: | world war two veteranhand grenadeinterrogationsequelflashbacktwo word titlebare chested malefighttitle spoken by characterexplosionknifechasepistolcell phoneshootout …beatingfistfightmachine guncar accidentshot in the chestshot in the headrescuepunched in the facebattlearrestgunfightbrawlfalling from heightmaskbased on comicheld at gunpointhand to hand combatbombcar crashrobotmanhattan new york citycombatscientistshot in the backgood versus evilspyassassinbased on comic bookdisguisedeath of friendarmyimpalementstabbed to deathmixed martial artsprisonertied to a chairexploding carno opening creditsanti herohit by a carfictional warspaceshipnews reporttransformationcharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumeelectrocutionattackcharacter's point of view camera shotmissiontough girllightningbankscene during end creditsstreet shootoutlong takemanipulationgymbodyguardexploding bodyfirst partmercenarysevered armsecret agentsubtitled scenebattlefieldstrong female charactermissilecaptainsabotagebow and arrowhead buttspearhelmetsecurity camerawalkie talkiehammerspacecraftexploding buildingblockbustergiantmind controllaserrocket launcheraction heroineorchestramasked manfemale warrioralien invasionshieldcameoveteranthunderdual wieldinventor3 dimensionalshot in the faceensemble castscene after end creditsmarvel comicsjumping through a windowthrown through a windowassault rifleknife fightparachutesuperheroinehologrameye gougingbody landing on a cartuxedotied feeteye patchlens flarerescue missionlasersightgovernment agentgatling gunteleportationgeniuslaser gunrocketfemale assassinimaxinvisibilityreturning character killed offwar herosuper strengthportalworld dominationbrooklyn bridgeplane crasharcherybillionairehelicopter crashsorcererfighter jetexploding truckfighter pilotcrashing through a windowman punching a womanmacguffinsuperhero teamhandcuffedpunching bagfinal battleshot in the throathigh techarchertied up while barefootaircraftimmortalmasked heroexploding shipshapeshiftingaircraft carrierhit with a hammeraerial combatnuclear explosionbanquetforce fieldvillain arrestedchrysler building manhattan new york cityalien racereturning character with different actorgroup name in titleshot with a bow and arrowcamera focus on female buttbattleshipnuclear threatkneelinghit with a chairsurprise during end creditswormholehuman alienhuman versus aliensuper speedcrushed by a carnuclear missileone eyed mansuper computerexploding planesuper soldiercubehitting a womannational guardflying manmothershipmarvel entertainmentelectromagnetic pulsesupervillainbell 206 jet ranger helicopterexploding busmarvel cinematic universegrand central station manhattan new york cityevil sorcererhumanoid alienlittle black dresscnn reporterpower suitthrown through a walljumping from an airplanefighting in the airalien attackcostumed heroreference to stephen hawkingshape shifting alienhumanity in perilfictional government agencywarrior racered capetitle appears in textsecret government organizationradical transformationrobot suitphilanthropistcaped superherofuturistic aircraftscepterflying superheroadopted brotherejector seatfighting brothersjet aircraftinvisibility cloakmale alienhydratunnel chase scenedisaster in new yorkmuscle growthextraterrestrial humanextraterrestrial manman wearing an eyepatchmarvel comicstuttgart germanyaerial battles.h.i.e.l.d.retina scan fakedflying fortresskolkata indiasuperhero versus superheroalien supervillaincharacter turns greenblack widow the characterhuman alien teambeam of energyalien allyeye scanninghammer as weapontesseracthawkeye the characterhelicarrier (See All) |
With many people fearing the actions of super heroes, the government decides to push for the Hero Registration Act, a law that limits a hero's actions. This results in a division in The Avengers. Iron Man stands with this Act, claiming that their actions must be kept in check otherwise cities will c …ontinue to be destroyed, but Captain America feels that saving the world is daring enough and that they cannot rely on the government to protect the world. This escalates into an all-out war between Team Iron Man (Iron Man, Black Panther, Vision, Black Widow, War Machine, and Spider-Man) and Team Captain America (Captain America, Bucky Barnes, Falcon, Scarlet Witch, Hawkeye, and Ant Man) while a new villain emerges. (Read More)
| Subgenre: | martial artscoming of agesuspensesuperhero |
| Themes: | supernatural powermurderdeathfriendshiprevengesuicidekidnappingbetrayalpoliticsprisonfeartortureescapefuneraldeception …magicrobberyangerdeath of fatherbrutalityterrorismdeath of motherparanoiaredemptionguiltsurveillancehome invasionnear death experienceregretartificial intelligencemurder of family (See All) |
| Mood: | car chase |
| Locations: | new york citybarrestaurantchurchforesthotelhelicoptersnowmotorcycleairplanebathtubbuslondon englandairportkitchen …apartmentpolice carafricarooftoprussiajunglegermanylaboratorysubmarinecar bombfire trucku boatcar motorcycle chaseabandoned factoryprison fightstorm at seawater torturehelicopter accident (See All) |
| Characters: | father son relationshipteenagerteenage boysoldierhostagetough guywarrioraction herosecurity guardmaidwitchsecretaryrussianamerican abroadpolice chase …aunt nephew relationshipengineerex soldier (See All) |
| Period: | 1990s2010syear 1991 |
| Story: | world war two veteranhand grenadeak 47interrogationsequelcharacter name in titlebloodviolenceflashbackbare chested malekissfightphotographexplosionknife …chasesurprise endingpistolfirecell phoneshootoutbeatingcorpseshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewatching tvbattlearrestgunfightbrawlfalling from heightletterbased on comicshowdownheld at gunpointhand to hand combatsunglassesbombcar crashrobotpianohandcuffsfightingcombatscientistsubjective cameraspyfoot chaseorphanflashlightassassincookingbased on comic bookambushterroriststrangulationmountaindisguiseambulancewidowmixed martial artssuicide attemptprisonerstabbed in the chestexploding carno opening creditsdisarming someoneone man armyassassinationhit by a cardouble crossunderwater scenekingvanthird partnews reportdrowningtransformationshot in the foreheadon the runtrainingflash forwardbinocularsbeaten to deathprologuewidowerelectrocutionfugitivecharacter's point of view camera shotmissionundercovermistaken identityrace against timestatueknocked outkicked in the facetough girltankopening action scenescene during end creditsmanipulationbodyguardexploding bodyneck breakingloss of fatherthreatened with a knifemercenarywaterfallex convictsevered armloss of motherespionageciadismembermentsubtitled scenebattlefieldprincestylized violencehenchmanpizzachessberlin germanyafricanmissileuzifalling down stairscaptainsabotagebow and arrowrevelationflyinghead buttmachetefriendship between mensecurity camerajail cellexploding buildingkicked in the stomachnosebleedblockbusterswat teamwristwatchgiantjumping from heightpsychologistirishmind controllaserparking garagehonorrocket launcheraction heroinemexican standoffcolonelinterracial friendshipsocial commentaryandroidmasked manfemale warriorgas maskrampageshieldcameohaunted by the paststealing a carbombingexplosivefight to the deathintrigueinventorhatredhit in the crotchimpostorpower outageevacuationescape attempthypnosisensemble castframe upspecial forcesscene after end creditsmarvel comicspunched in the chestdark herojumping through a windowbooby trapaccidental killingblack eyewisecrack humorsuperheroinehologramtitle at the endvoice over letterdisfigurementbody landing on a carpolice raiddark pastlens flarelieutenantgadgetlasersightterrorist plotkilling spreedeath of loved oneexploding helicoptertelekinesismoral dilemmaframed for murdergatling gungrenade launchersurprise after end creditsmedia coveragemoscow russiarockettracking devicetext messagingabandoned buildingcia agentinvisibilityface masklevitationfinal showdownreturning character killed offbrainwashingnotebookunited nationsromaniafemale fighterpistol whipassumed identitywar herospiral staircasearmored carsuper strengthfireballdronearcherysuper powersbillionairefemale spyno title at beginningcommando unithanging upside downhit by a truckcrash landingvienna austriaexploding truckblizzardsuicide bombercrashing through a windowsuperhero teamleaderwoman kills a manreference to youtubeu.s. navysiberiasuper powercrossoverfinal battleteamworkprison breakterrorist attackarchercommando raidopen endedsuperhuman strengthrighteous ragecrime fightertragic pastdeath of familywoman fights a mangarbage truckreference to star warsmasked herosubterraneaneastern europearm cut offdeath of parentsdiplomatgrudgeshot through a doorcar rollovercleveland ohiofemale gunfighterexploding airplaneelevator shaftforce fieldkicking in a doorsolitary confinementvillain arrestedarmorybilingualismteenage herosurveillance footagerainforesthostile takeoversinisterthrown from a carwingsepic battlecryogenicstragic villainminiaturizationfalling through the floorprison riotfictional countryqueens new york citygadgetryleadershipsurprise during end creditswoman punches a manbiological weaponcrushed by a carorigin of herobombardmentbritish actor playing american characterfrozen bodycoming out of retirementman fights a womanprosthetic limbcondominiumhangarman punches a womanblack opsgas grenadeleg bracesuper soldierteenage superheroberlinnaval officeranti villainshipping containerenglish subtitles in originalflying manhouse arrestmarvel entertainmentelectromagnetic pulsebiohazardmarvel cinematic universesecret laboratorymaximum security prisonfighting in the airtwo against onebucharestmaster of disguisesubterfugeterrorist bombingdeath of auntpost cold warcostumed herodeath squadrecruitmentgeopoliticsrobot suitformer spyblack pantherdisagreementfriend turned foeinfightingmassachusetts institute of technologyviennatunnel chase scenebucharest romaniaunintended consequencesabandoned prisonaid workerleipzig germanysleeper agentaccountabilitylack of truststan lee cameosuperhero versus superherobionic armlagos nigeriablack widow the charactermetal armfalcon the characterhawkeye the characterhigh tech suit (See All) |
After Nick is murdered by his own partner, he joins the Rest in Peace Department to protect the world from the undeads. While working with his new partner, many undeads are seen gathering in Boston. Soon he realizes that someone close to him is behind all a plot to bring on the apocalypse.
| Subgenre: | martial artssupernaturalstop motionbuddy comedy |
| Themes: | supernatural powermurderdeathsurrealismkidnappingbetrayaltortureescapefuneralmonsterdeceptiondeath of wifepolice brutalitypolice corruption |
| Mood: | car chase |
| Locations: | restaurantcemeteryapartmentpolice stationrooftop |
| Characters: | husband wife relationshippolicedetectivehostagewarrioraction heropolice detectivepolice shootoutpolice chasepolice funeral |
| Story: | ak 47interrogationviolencefighttitle spoken by characterexplosionchasepistolshootoutshot to deathfistfightmachine guncar accidentshot in the chestshotgun …rescuearrestgunfightbrawlfalling from heightbased on comicheld at gunpointhand to hand combatcar crashdemonhandcuffsrevolvergood versus evilfoot chasebased on comic bookdisguisedrug dealernonlinear timelineexploding carno opening creditsanti heroacronym in titlehit by a carcreaturepolice officer killednews reporttraininglocker roomrace against timeexploding bodydeath of husbandsevered armobscene finger gestureundeadcorrupt copstylized violencegoldspiritjoggingjail cellvideotapeswat teamgiantjumping from heightparking garageend of the worldgun fuback from the deadcamera shot of feetdamsel in distressdual wieldobesityboston massachusettshit in the crotchpartner3 dimensionaljumping through a windowoutlawwisecrack humorbody landing on a carstadiumsecret identitygatling gunlaser gunclose up of eyesimpersonating a police officergiant monsterportaltwo man armyworld dominationmegalomaniacinformanthot doggunslingerbuddy cophelicopter crashpolice captainartifactfall from heightbaseball gamecrashing through a windowpart computer animationnewscastentire title is capitalized acronymgarbage truckin medias resarmenianabandoned warehousedreadlocksrelicbaseball stadiumjoggerlassobuilding collapsecollapsing buildinggiant creaturevortexhit by a bustime freezedark horse comicsmeth labrun overbuilding firetailing a suspecttruck crashgold nuggetstetsondead but doesn't know itfemale captainburied goldman wearing a g stringplaying a concertina (See All) |
The G.I. Joe team is framed for crimes against the country by Zartan, disguised as the President, and Cobra Commander has all the world leaders under his influence, with their advanced warheads headed towards innocent populaces around the world. Outnumbered and outgunned, the surviving team members …form a plan with their original leader, General Joseph Colton, to rescue the President and face off Cobra Commander, his accomplices and the world leaders. (Read More)
| Subgenre: | martial artsconspiracy |
| Themes: | murderdeathfriendshiprevengekidnappingbetrayalprisontorturedeceptionmilitaryterrorismredemptionsurveillanceblindnessprison escape |
| Locations: | helicoptersnowmotorcycleairplaneboatdesertlondon englandgermanyboat chasehumveestranded in the desert |
| Characters: | soldierhostagetough guywarrioraction herosecurity guardsniperamerican abroadsniper rifleself mutilationex soldierself destruction |
| Period: | zip line |
| Story: | templehand grenadeak 47interrogationsequelcharacter name in titlebloodviolenceflashbackbare chested malefightdancingexplosionpartyknife …chasesurprise endingpistolvoice over narrationpunctuation in titlecell phoneshootoutbeatingcorpseshot to deathunderwearfistfightmachine gunshot in the chestshot in the headrescueslow motion scenepunched in the facebattleswordbrawlfalling from heightbased on comicshowdownheld at gunpointhand to hand combatbombsecond parthandcuffsbritishshot in the backgood versus evilsurvivalfoot chasebraassassincandlesword fightbased on comic bookambushterroristmassacremountaindisguisedeath of friendbridgearmyimpalementstabbed to deathmixed martial artsprisonerpoliticianstabbed in the chesttied to a chairexploding carno opening creditshit by a cardouble crossunderwater scenenews reporton the runtraininglimousinebinocularscharacter repeating someone else's dialoguebased on tv seriesattackfactorycharacter's point of view camera shotundercoverninjarace against timecover upknocked outkicked in the facetough girltanku.s. presidentopening action scenegymamerican flagbodyguardinjectionpresidentexploding bodymercenaryshot in the armgeneralsilencerobscene finger gesturebattlefieldwashington d.c.stylized violenceperiod in titlemissiletraitoruzifalling down stairsgrenadeburned aliveassassination attempthelmetred dresssecurity camerawalkie talkieexploding buildingkicked in the stomachpress conferencejumping from heightrocket launchermonkaction heroinemexican standoffwhite housegun fumasked manfemale warriortokyo japanprison guardtarget practiceexplosivedual wieldimpostorpower outage3 dimensionalmutefalling to deathstabbed in the headblack braframe upspecial forcespunched in the chestamerican presidentassault rifleknife fightparachutecommandohealingbulletproof vestclifflens flarebriefcaserescue missionterrorist plotdictatorframed for murdergatling gungrenade launcherbased on toymedia coveragesouthern accentlaptop computertracking devicesatellitefemale soldierterrorist groupface maskreturning character killed offsecret servicemonasteryarmored carparkourcomputer crackerworld dominationkoreandronepakistanmegalomaniacyoung version of characterbunkerwellcommando unitbased on cartooncommando missionxbox 360playing a video gamednapunching bagvirginiahigh techcommando raidboxing ringsubterraneannorth koreaavalanchecoup d'etatfundraiserbo staffnuclear explosionflare gunprison wardenapprenticepentagonnight vision goggleshummerreturning character with different actorgroup name in titlecryogenicsexploding boatnuclear threathidden gundeoxyribonucleic aciddog tagpretending to be deadsecret service agentbombardmentbig ben londoncovert operationthrowing starnuclear missilecoming out of retirementthick accentdefectorduplicityexploding motorcyclefemale ninjananotechnologymass destructiontarget shootingfireflyhimalayaswashington monumentmasked womanweapon of mass destructionhdtvcnn reportermaximum security prisonwoman wearing a red dressmaster of disguisechain link fenceexploding tanklondon eyemaster apprentice relationshipevil politiciansummitmale soldiernuclear warheadreference to johnny cashc 130 hercules50 calibre machine gunah 64 apache helicopterreference to george s. pattonvillain escapesdestruction of cityreference to miley cyruswoman changing clothesairboatreference to bonohiding underwatergi joereference to ryan seacrestkorean soldiermissile launchkinectdna analysishouse of parliament londonfuturistic tankkinect for xbox 360u. s. marines dress uniform (See All) |
When the White House (Secret Service Code: "Olympus") is captured by a terrorist mastermind and the President is kidnapped, disgraced former Presidential Secret Service Agent Mike Banning finds himself trapped within the building. As our national security team scrambles to respond, they are forced t …o rely on Banning's inside knowledge to help retake the White House, save the President and avert an even bigger disaster. (Read More)
| Subgenre: | martial artspolitical thriller |
| Themes: | murderdeathkidnappingchristmasbetrayalpoliticstortureescapedeceptionmilitaryterrorismdeath of motherguiltsadismsurveillance …executiondeath of wifemurder of a police officerunlikely heromurder of an innocent person (See All) |
| Mood: | gore |
| Locations: | hospitalhelicoptersnowrooftophumveeairplane shot down |
| Characters: | father son relationshiphusband wife relationshipsoldiernursehostagetough guywarrioraction herosecurity guardsnipersniper rifleshooting a police officerself destruct |
| Story: | secret passagehand grenadeak 47interrogationbloodviolenceflashbackbare chested malefightcigarette smokingtitle spoken by characterexplosionknifechasepistol …shootoutbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombcar crashhandcuffscombatkung fushot in the backf wordsubjective camerafoot chaseassassinbound and gaggedterroriststrangulationmassacredisguiseambulancethroat slittingbridgestabbed to deathmixed martial artspoliticianstabbed in the chestboxingexploding caranti heroone man armychild in perilfictional warpolice officer killednews reportshot in the legshot in the foreheadone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backfbicharacter's point of view camera shotrace against timeevil manchristmas treeu.s. presidentstreet shootoutshot in the shoulderamerican flagbodyguardpresidentexploding bodyneck breakingdie hard scenariofirst partthreatened with a knifemercenarysevered armshot in the armgeneralsilencersubtitled scenebattlefieldwashington d.c.stylized violencestrong female charactermachismomissiletraitoruziclaim in titlefalling down stairskilling an animalheavy rainshot in the stomachsecurity cameraexploding buildingswat teampress conferencefaked deathrocket launcherwhite housecrushed to deathmasked mangas masku.s. armychaosgash in the facestabbed in the neckpunched in the stomachm 16stabbed in the headspecial forcesstabbed in the legamerican presidentassault rifleknife fightwisecrack humorcommandoone daybulletproof vesttuxedobody countterrorist plotrpgexploding helicoptergovernment agentgatling gunpatriotismshot multiple timesmedia coveragefemale assassinprime ministershot through a windowbazookaterrorist groupchristmas presentfinal showdownsecret servicebag over headpolice officer shot in the chestarmored cartreasondronenight visionplane crashbunkercommando unitwhisperinghelicopter crashhead bashed incommando missionsuicide bomberman punching a womanaction violenceshot point blankemergency roomfilmed killingshot in the footterrorist attacknewscastcommando raidboxing ringrogue agentgarbage truckaircraft carriernorth koreaoval officedogfightvice presidentu.s. air forceanimal killingexploding airplanepentagonhostage situationhostile takeoverguard dogautomatic weaponnuclear threatsecret service agentnuclear missileshot through a wallsecret passagewayex special forceskicked in the chestexploding planegas grenadesurprise attacknational guardsparringwashington monumentstabbed in the foreheadu.s. vice presidentknife attackmass deathmotorcadeexploding bushomeland securitysecret tunnelanti aircraft gunstabbed through the chinuh 60 blackhawk helicopterunderground bunkerpolice escortinfiltratorpledge of allegiancesecretary of defenseair attackc 130 herculesu.s. secret servicecamp davidsecret panelcar falling off a bridgeignoring advicelaunch codedriving in snownuclear terrorismsurface to air misslepresidential cabinetspeaker of the housecable tielockheed martin boeing f 22 raptorpolitical assasination (See All) |
The story is about two swindlers who get their hands on a map to the fabled city of gold, El Dorado while pulling off some sort of scam. Their plan goes bad and the rogues end up lost at sea after a number of misfortunes. Oddly enough, they end up on the shores of El Dorado and are worshiped by the …natives for their foreign appearance. (Read More)
| Subgenre: | cult filmswashbuckler |
| Themes: | monster |
| Characters: | native american |
| Period: | 16th century |
| Story: | el doradoadventurerkissdancingchasehorseswordfoot chasesword fightsnakebrunettedisarming someoneritualon the runduel …fugitivemassagesensualitywaterfallgoldmachetecrossbowpartnercon artistfallarmorpassionate kisssword duelsidekickhuman sacrificetwo man armylatin americamuskethomosexual subtextimplied sexflintlock riflesteel helmetstudio logo segues into filmlong black hairstocksarmadilloshoulder massagehigh priest21 gun salute1510s (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
| Subgenre: | martial artsblack comedysupernaturalparanormal phenomenadark fantasymonster movie |
| Themes: | supernatural powermurderdeathfriendshiprevengesurrealismkidnappingbetrayalghostfearescapemonsterdeceptionmagicmilitary …seductionangerparanoiaredemptionsurveillanceevilpaniccourageself sacrificenear death experiencemurder of familyunlikely heroegyptian mythology (See All) |
| Mood: | darknesshorror movie remake |
| Locations: | trainchurchforesthelicoptercemeteryairplanebusdesertlondon englandwoodspolice carrooftopmuseumlaboratorytunnel |
| Characters: | policedoctortattoozombiesoldierpolice officerpriesthostagethieftough guywarrioraction herosecurity guardprofessoramerican abroad …self mutilationbabe scientistamerican in the uk (See All) |
| Period: | 2010s |
| Story: | archaeologisthand grenadeak 47bloodviolenceflashbackdogbare chested malefemale rear nudityfightexplosionknifechasesurprise endingpistol …fireshootoutbeatingdreamcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestface slapremakeshotgunrescueslow motion scenepunched in the facebattlegunfightbrawlbare buttshowdownheld at gunpointbeerhand to hand combatsunglassescar crashhallucinationcombatscientistshot in the backsubjective cameragood versus evilfoot chaseflashlightambushstrangulationaxemassacreambulancedeath of friendthroat slittingarmystabbed to deathmixed martial artsstabbed in the chestsubwayman with glassesno opening creditsanti herodisarming someoneone man armycoffinassassinationdouble crossritualunderwater scenekingpolice officer killedfemme fatalenews reportshot in the legprincessdrowningtransformationflash forwardattempted murderpilotcursebinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologuescreamingelectrocutionattackfantasy sequencecharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outlightningopening action sceneskeletonmanipulationscarinjectionlaptopratthreatened with a knifemercenarypubsubtitled sceneundeadbattlefieldpowerpickup truckmissiledestinygrenadedestructionassassination attempthypodermic needlegothictape recordersecurity camerawalkie talkiemad scientisttreasuremorguesergeantkicked in the stomachspidervillainesspoolskullknightmind controltorchfateburialcolonelback from the deadiraqgun battleguardrampagecrime scenereverse footagemiddle eastvisiontarget practicebraveryu.s. armyconstruction sitefight to the deathpartnermercilessnesspower outageegyptstabbed in the neckresurrectionevacuationimmortalityescape attemptspecial forcesstabbed in the legpunched in the chestairplane crashaerial shotparachutewisecrack humorcapturebulletproof vestdemonic possessionblack magictelekinesisdaggerstick fightmoral dilemmamedia coveragetelepathycrowclose up of eyestombsidekickliving deadalleyfinal showdownburied alivetasermummyconstruction workerpistol whiphuman monsterarmored carhuman sacrificeworld dominationdronecomic reliefsecret societymegalomaniacold flamesplit personalityfilm starts with textartifactpatricideman kills a womanoffscreen killingbitten in the neckmacguffinwoman kills a manaltered version of studio logoheirchainedarcheologistopen endedalter egowoman fights a manimmortalmatricidesubterraneangodwoman slaps a manjewelcockney accentmind readingimprovised weaponcar rolloverancient egyptarmy basechosen onestupid victimrelicbilingualismdeal with the devilthronemad doctorsecret roomfratricidecryptinfanticideregenerationtragic villainwomen's bathroomdecomposing bodyenglishwoman abroadsecret organizationbig ben londonzero gravityman fights a womanair strikecorporalcollapsing buildingserumpharaohharpoonsandstormrebootfragments of glassmultiple personality disordertreasure hunterexcavationpharoahhit with a car doorburied treasuresecret laboratoryexplosive decompressionarcheological digevil godjekyll and hydelondon undergroundjackhammerrubyinsurgentflipping caryin and yanglondon eyeairplane pilotcargo planecatacombcrusaderlovecraftianreanimated corpsereboot of seriessoldier of fortunebookshelfgemstonesarcophagusmercurycontemporary settingrogue soldierfaustianhieroglyphicsegyptian godsecret lairlondon busheir to thronemilitary operationliterary charactersecret chamber1190sburial sitefemale archeologistdark universemonster hunter (See All) |
Perseus is the favored son of the god Zeus, but he has unwittingly ticked off the sea goddess Thetis. Just to make things worse, Perseus falls in love with the lovely Princess Andromeda, who used to be engaged to Thetis's son. Soon Perseus is off on one quest after another, with Zeus helping, Thetis … hindering, and lots of innocent bystanders getting stabbed, drowned, and squished. (Read More)
| Subgenre: | cult filmsword and sorcerystop motion animationsword and fantasy |
| Themes: | revengesurrealismadulteryweddingmonstercannibalismblindnessmythologyunlikely herogreek mythology |
| Mood: | mythbased on greek myth |
| Locations: | beachsea monster |
| Characters: | father son relationshipsoldierwarrioraction herowitchhuman versus monster |
| Story: | riddletemplefemale nuditybloodfirehorserescuebattleswordislandcombatdecapitationstabbingsnake …severed headcultfictional warunderwater scenecreatureprincesscurseprologuemissionstatuegiftunderwaterpoetcagequesthelmetgiantsevered handreverse footageshieldfloodwhipgreecelove at first sightswampthunderstormowlinvisibilityburied alivegiant monsterhuman sacrificearcheryplaywrighthurricanescorpiongoddesssword and sandalillegitimate childvanityorchestral music scoregladiatordeformityfamous linegiant animalvulturesuitorbroken engagementancient greecepaganferry boatsquidgiant creatureturned to stonegodspaganismremadeburned at the stakedeityantiquityout of body experiencefigurinegreek godpart stop motionmedusazeusdivine interventionconstellationdemi godpegasusamphitheatertwo headed creaturekrakenposeidondivine retributionmount olympushorse breakingheathententacled monsterexiled prince (See All) |
Intrepid British archaeologist Lara Croft has made perhaps the most important archaeological discovery in history: an orb that leads to the mythical Pandora's Box. Unfortunately, the orb falls into the hands of Jonathan Reiss, an evil scientist who deals in killer viruses and hopes to sell the secre …ts of the box as the ultimate weapon. Recruited by British Intelligence to get the orb back from Reiss, Lara recruits Terry Sheridan, a British marine turned mercenary (and her former love interest) to help. The two embark on an adventure that spans continents in an attempt to regain the orb... (Read More)
| Themes: | terrorism |
| Locations: | motorcycle chasehelicopter chase |
| Characters: | ex boyfriend ex girlfriend relationship |
| Story: | archaeologistak 47f ratedmachine gunhand to hand combatsword fightone against manysemiautomatic pistolstylized violencemartial arts masterhong kongmad scientistgun fuearthquaketarget practice …stick fighthorseback ridingepidemicarcheologyscuba divingarcheologisttreasure mapwire fudesert eagle .50shanghai chinagreat wall of chinaafrican tribeautomatic pistolmi6tomb raiderharpoon gunduologyman eaten by monsterdeadly virus (See All) |
Superman does a lot in his newest adventure. Archvillain Lex Luthor, determined to make the world safe for nuclear arms merchants, creates a new being to challenge the Man of Steel: the radiation-charged Nuclear Man. The two super-powered foes clash in an explosive screen extranvaganza that sees Sup …erman save the Statue of Liberty, repulse a volcanic eruption of Mount Etna, rebuild the demolished Great Wall of China and perform many more spetactular feats. (Read More)
| Subgenre: | superherochrist allegory |
| Themes: | supernatural powerdeceptionmilitarywrestlingspace travelprison escapeescape from prison |
| Locations: | trainschoolhotelsnowtaxielevatorvillagefarmpolice carcityitalybaseballofficerooftopouter space …russiamuseumsan francisco californialaboratorysubmarineschool busfire truckcatholic school (See All) |
| Characters: | father daughter relationshipteenagerboyteachersoldierpolice officerphotographerpriesthostagetough guyaction herolittle boyvillainrussianuncle nephew relationship …police shootoutcatholic priest (See All) |
| Period: | 1980s |
| Story: | fourth partcold warsequelcharacter name in titleviolencekissfightexplosionsingingsurprise endingpistolfireshootoutmachine gunhorse …shotgunwatching tvlettershowdownhand to hand combatnumbered sequelclassroomreportergood versus evilnewspaperjournalistbased on comic bookmountaindisguisecolon in titleprisonersubwayexploding carman with glassesnunspaceshipcreaturecigar smokingduelproduct placementkicked in the facebaseball batu.s. presidentopening action scenestreet shootoutconvertiblegymspeechamerican flagsix word titlegenerallove interestnewspaper headlinesubtitled scenemoonsingle parentmissilefireplaceflyinglifting someone into the airbarnroman numeral in titleexploding buildingplanetphone boothpress conferencejumping from heightjournalismprison guardexplosiveu.s. armysuper villaintaking a picturesunastronautvolcanotuxedojuvenile delinquentsecret identitydc comicsworld trade center manhattan new york cityclonetelekinesisgeniusfirefighterflagworkoutelectricitylevitationhairunited nationstelling someone to shut uparms dealercomic reliefdiggingsuper powersschoolboylavacrystalgenetic engineeringstatue of liberty new york cityaction violencecreationaerobicscapealter egoroman numbered sequelfrenchmangolden gate bridgenuclear explosionu.s. air forcetreadmilltycoonvillain arrestednuclear weaponswalkmannewspaper reporterchrysler building manhattan new york cityrevolving doorfictional cityearth viewed from spacenew york city new yorknuclear threatdeoxyribonucleic acidnewspaper editormedia manipulationhuman aliencriminal mastermindnuclear missilehot dog standu.s. marshaltv broadcastsolar eclipsevolcanic eruptionsunlighthawaiian shirtburning moneypickaxereform schoolflying manscratchvintage carbaseball glovegreat wall of chinaair force basefighting in the airspacewalkletter read aloudnewsroomdouble daterussian armyreference to wolfgang amadeus mozartsolar powercharacter appears on front page of a newspaperchain gangairforce onehot dog vendorcaped superheropile of moneyworld peacedrum kitflying superheroremote control carx ray visionthe moonarms racekryptoniteextraterrestrial humanfitness centerbarbellextraterrestrial mansecret lairnuclear disarmamentaerobics classcar goes over a clifflong fingernailsnewspaper photographerdisarmamentmoon surfacekneed in the facemetropolis the cityguest speakersmallvilleadidas clothingstrand of hairadapted scorefortress of solitudenewspaper staffflag on the moon (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, …Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
| Subgenre: | sword and sorceryepicdark fantasysword and fantasy |
| Themes: | supernatural powermurderdeathfriendshiprevengesurrealismbetrayalghostpregnancyfeardrunkennessescapefuneralmonsterinvestigation …deceptionmagicangercorruptionbrutalitysadismexploitationhopeself sacrificeregret (See All) |
| Locations: | churchforestsnowvillagewoodscastle |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshiptattoobrother sister relationshipsoldierbabyhostagetough guywarrioraction herosingle fatherpregnantengineer |
| Story: | translationanimal attackinterrogationbased on novelbloodviolenceone word titlebare chested malefightexplosionknifechasesurprise endingfirevoice over narration …beatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescueslow motion scenepunched in the facebattleswordarrestbrawlfalling from heightbookshowdowndemonrivercombatsubjective cameradecapitationgood versus evilsurvivalsword fightambushstrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementstabbed to deathprisonerstabbed in the chestmapsevered headno opening creditsanti herobirdchild in perilfictional wardouble crossritualunderwater scenekingcreaturetransformationduelone against manytreelibrarycursecharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facetough girllightningskeletonmanipulationscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifesevered armqueensubtitled scenebattlefieldprincestylized violencesingle parenthenchmaneavesdroppingtraitorwolfloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetblockbustergiantpoolrebelsevered handcovered in bloodsheepskullknightmind controlhonortorchburialaction heroinecrushed to deathslavefemale warriorfull moonguardbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationsword duelblack magicwilhelm screamtelekinesisdaggerexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreathorse chasemacehorse drawn carriagebarracksscrollleadershipdecomposing bodycollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All) |
In this sequel to 2001: A Space Odyssey, a joint American- Soviet expedition is sent to Jupiter to discover what went wrong with the U.S.S. Discovery against a backdrop of growing global tensions. Among the mysteries the expedition must explain are the appearance of a huge black monolith in Jupiter' …s orbit and the fate of H.A.L., the Discovery's sentient computer. Based on a novel written by Arthur C. Clarke. (Read More)
| Subgenre: | cult filmblack comedyfuturistic |
| Themes: | surrealismmarriagepoliticsfearescapedeceptionsurveillancehopepanicself sacrificenear death experienceartificial intelligencespace travel |
| Locations: | hospitalbeachparis francelondon englandouter spacespaceearthspace stationnew mexicoghost ship |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshipdoctornurselittle boyprofessorsecretaryrussianamericanengineerself destruction |
| Period: | 2010snear futureyear 2010 |
| Story: | ancient astronautcold warsequelbased on novelnumber in titleone word titlephotographsurprise endingdigit in titlerescuewatching tvcomputerwritten by directorsunglassessecond part …sciencescientistflashlightdeath of friendwidowcolon in titlefictional warspaceshipnews reportcharacter repeating someone else's dialoguedangermissionrace against timecover upsoviet unionlaptopsuspicionsix word titlewashington d.c.moonyear in titleicedestructionrevelationelectronic music scorescene during opening creditshelmetsurvivorcomajoggingbeardspacecraftplanetpoolwhite housepresumed deadwhiskeycynicismteampower outageegyptswampsunastronautdeceitfemale doctorsequel to cult favoritemedia coveragenasasunsetreturning character killed offeiffel tower paristelevision newsdolphinfilm starts with textspace shuttlebunk bedfriends who live togethertop secretdirector also cinematographerfamous scorestarsreference to abraham lincolnexploding shippsychotronic filmsecret missionearth viewed from spacespace explorationcryogenicszero gravitytrapped in spacehuman in outer spaceplanet earthsuper computercomputer programmerdisobeying ordersaudio recordingcorrespondenceauthor cameocosmonautoutrunning explosionelectromagnetic pulseabandoned shipsatellite dishspacewalkexploding planetwaking up from a comaspace probetower bridge londonjupiter the planetcryonicssaturn the planettime magazinecalculatorfloating in spacecreator creation relationshiphyperventilationlincoln memorialspaceship settingspace missionstasisalien intelligencemonolithegyptian pyramidthe white housejupiterradio telescopelincoln memorial washington d.c.recap segmentmessage from outer spacespace expedition (See All) |
Two powerful German guns control the seas past the Greek island of Navarone making the evacuation of endangered British troops on a neighboring island impossible. Air attack is useless so a team of six Allied and Greek soldiers is put ashore to meet up with partisans to try and dynamite the guns. Th …e mission is perilous enough anyway but are the Germans on the island getting further help too?. (Read More)
| Subgenre: | martial artscult filmsuspense |
| Themes: | betrayaltortureweddingherodeceptionmilitary |
| Locations: | hospitalhotelmotorcycleboatvillageseacavegermanynazi germanyairplane accidentfishing boatstorm at seasea battle |
| Characters: | brother sister relationshipsoldiertough guyaction heroprofessorsnipersniper rifle |
| Period: | world war two1940syear 1943 |
| Story: | car falling off a cliffhand grenadeinterrogationbased on novelviolencegunkissfightexplosionsingingknifepistolvoice over narrationshootoutfistfight …machine gunface slapbattlegunfightbrawlshowdownriflehand to hand combatbombplace name in titleislandcombatswimmingambushmountaindisguiseambulancestabbingmontagemixed martial artssuicide attemptexploding cardisarming someoneprologuekaratewidowertough girltankmercenarysemiautomatic pistolsilencerbattlefieldeavesdroppingtraitorshavingsabotageblockbusterbroken legcannonexplosiveresistancegreeceplanespecial forcesdynamitecommandocapturekarate chopwedding receptionwar crimeswastikaruinsgreekmonasteryfemale fighterwar herofirearmwar violencemajorsailboatcommando unitfortresscommando missionexploding truckbehind enemy linesamputationbayonetbritish armymilitary uniformmotorboatsubmachine gunjudofamous scorecommando raidtitle same as bookairfieldair raidaircraftdemolitionssadmiralvictorytommy gunresistance fighterfighter planemountain climbingcavernshoulder holsterexploding boatbattleshipnazi uniformseaplanejudo throwsharpshooterair strikeartilleryship wreckmortarsearchlightmountaineerbritish navyship sinkingalliesfalling over a cliffmp 40 machine gunsailtruth serumisland name in titlegangrenedestroyerexplosives expertclothes torn offss officerelectronics expertaegean seaclimbing a cliffamphibious landingfictional island (See All) |
VALERIAN AND THE CITY OF A THOUSAND PLANETS is the new adventure film from Luc Besson, the director of The Professional, The Fifth Element and Lucy, based on the comic book series which inspired a generation of artists, writers and filmmakers. In the 28th century, Valerian (Dane DeHaan) and Laurelin …e (Cara Delevingne) are a team of special operatives charged with maintaining order throughout the human territories. Under assignment from the Minister of Defense, the two embark on a mission to the astonishing city of Alpha-an ever-expanding metropolis where species from all over the universe have converged over centuries to share knowledge, intelligence and cultures with each other. There is a mystery at the center of Alpha, a dark force which threatens the peaceful existence of the City of a Thousand Planets, and Valerian and Laureline must race to identify the marauding menace and safeguard not just Alpha, but the future of the universe. (Read More)
| Subgenre: | independent filmmartial artsconspiracyfuturisticspace operascience fantasy |
| Themes: | supernatural powermurderdeathrevengesurrealismkidnappingbetrayalpoliticstortureescapemonsterinvestigationdeceptionmilitarymemory …robberycorruptionbrutalityredemptionsurveillanceunrequited loveapocalypseself sacrificedeath of daughterartificial intelligencespace traveldestruction of planet (See All) |
| Locations: | beachbusdesertwaterseaouter spacecaveoceanstrip clubsubmarinespace stationu boatspace battlesea monsterairplane chase |
| Characters: | father daughter relationshiptattooprostitutesoldieraliendancerhostagetough guywarrioraction herosecurity guardchinesepimpalien monster |
| Period: | 1970syear 19752020s |
| Story: | alternate dimensionanimal attackinterrogationcharacter name in titlenumber in titlebloodviolenceflashbackbare chested malegunkissfightdancingtitle spoken by characterexplosion …chasesurprise endingpistolfireshootoutbeatingdreamcorpseblood splatterfistfightmachine gunshot in the chestface slaprescueslow motion scenepunched in the facewritten by directorbattleswordarrestgunfightbrawlfalling from heightbased on comicshowdownrifleheld at gunpointhand to hand combatbombrunningrobothandcuffscombatstrippershot in the backspyfoot chasesword fightbased on comic bookambushmassacredisguisemontagearmyimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairmapanti herodisarming someonefictional wardouble crossspaceshipritualunderwater scenekingcreatureprincessmarriage proposaltransformationflash forwardone against manybinocularscharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologueelectrocutionmissionundercoverrace against timecover upknocked outtough girlshot in the shoulderscarbodyguardpresidentpursuitexploding bodyglassessuspicionmercenarygeneralsecret agentlove interestsubtitled scenebattlefieldstylized violencestrong female charactermissilepiratecaptainsabotagedestructionburned aliverevelationspearscene during opening creditshelmetsurvivorloss of loved onespacecraftsergeantplaneteccentricvirtual realitymind controllaserwomanizergenocidehonoraction heroinemexican standoffcrushed to deathsocial commentaryfemale warriorguardexplosiveministerdual wieldobesitymercilessnessevacuationspecial forcespunched in the chestjumping through a windowassault rifleastronautaerial shotwisecrack humorhologramsoulundercover agenttribekingdomtourgadgetdeath of loved onegovernment agentwar crimemoral dilemmagatling gunlaser gunpalacetelepathytracking devicefemale soldierbriberyinvisibilityextraterrestrialfinal showdowntimebombexotic dancerloss of daughterportalstreet marketdronemajorcomic reliefblack marketfemale spycommandergreenhousecrash landingbased on graphic novelspace shuttlemetamorphosiscrashing through a windowmacguffinbody bagtour guidefight the systemfinal battlepart computer animationshape shifteralien planetexploding shipdogfightpole dancertrapdoormind readingforce fieldthronealien creaturespacesuitwar criminalalien racespace explorationparadisefalling through the floordeoxyribonucleic acidjellyfishgadgetryparallel worldendangered specieswoman punches a manwormholehuman alienred light districtalien technologyfemale pilotzero gravitysquidpearlhumanoidhangarhidden truthsuper computerpacifistdisobeying orderscouncilwoman hits a manpulp fictioninsubordinationalternate worldgreen bloodseashellhumanoid alienbazaarspace pirateinside the mindsea creatureexploding planetalien speciesshape shiftingshape shifting aliensummitrobot armywarp speeddargaudhyperspacemagnetismterraformingmachine pistolshockwavevideoconferencingchain of commandinvisibility cloakparallel dimensionrogue soldierfemale humanoid aliengeofictionalien creature as petannihilationdereliction of dutywoman hitting manaugmented realitynarrow escapespaceship pilotfacial woundrobot soldieryear 2020bomb timer counting downbreaking through wallspace pilotparadise lostromance subplot28th century (See All) |
This film charts the rise and fall of Yuri Orlov, from his early days in the early 1980s in Little Odessa, selling guns to mobsters in his local neighbourhood, through to his ascension through the decade of excess and indulgence into the early 90s, where he forms a business partnership with an Afric …an warlord and his psychotic son. The film also charts his relationship through the years with his younger brother, his marriage to a famous model, his relentless pursuit by a determined federal agent and his inner demons that sway between his drive for success and the immorality of what he does. (Read More)
| Subgenre: | black comedy |
| Themes: | murderbetrayaldeceptionexecutionaidsdrug addiction |
| Mood: | satirearchive footagebreaking the fourth wall |
| Locations: | new york cityrestauranthotelcarhelicopterdesertafricatrucksex in showercar explosioncar bomb |
| Characters: | husband wife relationshipbrother brother relationshipprostitutejewishjewuncle nephew relationshiprussian mafiadream girl |
| Period: | 1980s1990s2000syear 2001year 1991year 1984year 1982year 1983 |
| Story: | hand grenadecold warak 47interrogationfemale nuditytitle spoken by charactershowerbased on true storyvoice over narrationwoman on topshot to deathblood splattermachine gunshot in the chestshot in the head …slow motion scenebikiniliesex standing upprostitutionhallucinationshot in the backsoccerassassincocaineimmigrantweaponexploding caranti heropaintersearchcigar smokingshot in the legtalking to the camerashot in the foreheadlimousineorganized crimeperson on firechampagnechristmas treeshot in the shoulderbusinessconvertibleamerican flagtragic eventautomobiledeath of sonmercenarynewspaper headlinechild murdercivil waruzigrenadebulletassassination attemptmachetecagecookagentloss of wifebrooklyn new york cityhonorrocket launcherpassportdiamondnicknametelescopeloss of sonjunkiem 16deceittuxedorpgdictatorgovernment agentloss of brotherwedding receptiondrug lordshot multiple timesbullet timevodkajudaismsnorting cocainearms dealerdouble lifebrooklyn bridgebunkerexploding truckchandelierrehabilitationsubmachine gunmercedes benzcrowbarfiring squadfirst person narrationwarlordprivate jetmarital infidelitynew york skylinerehabkicking in a doorfinger gundrug tripchild killedtrophy wiferolls royceboliviasupermodelinterpolchild soldierhundred dollar billbeauty queenconvoysnorricamreference to osama bin ladenanti villainassembly lineshipping containerstar of davidbeirut lebanoncocaine useukrainiancity in ruinspack of moneyfalse passportshot in the bellybeach resortcynichyenasierra leonestretch limousinem 60 machine gunimmoralityfall of communismdrug rehabcolumbiawoman killedliberiagunrunnerjfk international airport queens new york cityunited nations missioncounter intelligencecode wordcadillac convertibleatf agentgun nutcalla lilylear jetrandom violenceodessa ukrainestorage lockerknife held to someone's throattent citymi 24 hind helicoptermissing limbalternate identityammunition beltkilled by macheteloss of unclemp 5 machine gunpan amplastic gunarmored personnel carrierinterpol agentshredded paperstatue of leninconversion to judaism (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | martial artsconspiracypost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsepost apocalypticcorporate conspiracy |
| Themes: | murderdeathrevengekidnappingbetrayalfearescapemonsterdeceptionangerbrutalityparanoiaredemptioninsanityillness …surveillancehopepanicself sacrificeartificial intelligence (See All) |
| Mood: | gore |
| Locations: | motorcyclewheelchairrooftoplaboratorytunnelsewerhumveecable car |
| Characters: | father daughter relationshipboyfriend girlfriend relationshipdoctorfemale protagonistzombiesoldierhostagesecurity guardbibleprofessorengineer |
| Period: | zip lineseeing the future |
| Story: | animal attackhand grenadeak 47interrogationsequelbloodviolenceflashbackdogfightexplosionknifechasesurprise endingpistol …firevoice over narrationshootoutbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatsunglassesbombrunningcar crashcombatkung fuscientistshot in the backsubjective cameradecapitationgood versus evilsurvivalflashlightambushstrangulationmassacrethroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestexploding carsevered headno opening creditsdisarming someonefictional wardouble crossunderwater scenecreaturevoice overshot in the legnecklaceshot in the foreheadone against manybinocularsbeaten to deathdangerstabbed in the backprologuelocker roomfired from the jobperson on fireelectrocutioncharacter's point of view camera shotmissionactor playing multiple rolesrace against timecover upevil manknocked outkicked in the facetough girltankopening action sceneshot in the shoulderscarexploding bodythreatened with a knifemercenarywaterfallsevered armshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanmissileropetraitoruzisabotagefireplacedestructionburned aliverevelationhead buttelectronic music scoreheroinehypodermic needlemachetesociopathdiseasevirussecurity camerawalkie talkiecrucifixmad scientistkicked in the stomachwristwatchdesperationjumping from heightsevered handstrong female leadlasergenociderocket launchertorchend of the worldaction heroinemexican standoffwhite housegun fusocial commentaryeaten alivefemale warriorcyborgmechanicstealing a carsevered fingerfight to the deathresistancedual wieldstabbed in the throathatredbased on video gamehit in the crotchmercilessnesspower outagechaosshot in the facebroken glassevacuationcigarette lighterstabbed in the legpunched in the chestairplane crashinfectionbooby trapaerial shothologrambody landing on a carknife throwingraised middle fingergasolinestabbed in the eyesevered legburned to deathsirenclonegatling gunfast motion scenebullet timerockettorso cut in halfenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownreturning character killed offfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantstabbed in the armcommanderflarehanging upside downhelicopter crashsawed off shotgungenetic engineeringfemale herobitten in the neckwoman kills a manfight the systemfinal battleshot through the mouthsole black character dies clicheshot in the footcountdownopen endedcurejumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killingsevered footanti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gundeoxyribonucleic acidmegacorporationantidotecorporate crimedetonatornail gunstabbed in the footchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All) |
In the twenty-third century, the universe is threatened by evil. The only hope for mankind is the Fifth Element, who comes to Earth every five thousand years to protect the humans with four stones of the four elements: fire, water, Earth and air. A Mondoshawan spacecraft is bringing The Fifth Elemen …t back to Earth but it is destroyed by the evil Mangalores. However, a team of scientists use the DNA of the remains of the Fifth Element to rebuild the perfect being called Leeloo. She escapes from the laboratory and stumbles upon the taxi driver and former elite commando Major Korben Dallas that helps her to escape from the police. Leeloo tells him that she must meet Father Vito Cornelius to accomplish her mission. Meanwhile, the Evil uses the greedy and cruel Jean-Baptiste Emanuel Zorg and a team of mercenary Mangalores to retrieve the stones and avoid the protection of Leeloo. But the skilled Korben Dallas has fallen in love with Leeloo and decides to help her to retrieve the stones. (Read More)
| Subgenre: | martial artscult filmdystopiaepiccyberpunkspace opera |
| Themes: | murderlovekidnappingescapemilitaryterrorismevilapocalypsespace travelend of mankind |
| Mood: | satirecar chase |
| Locations: | new york citybartrainhotelairplanedesertwatertaxiapartmentouter spacespacetaxi driver |
| Characters: | mother son relationshipsoldieralienpriesthostagetough guypolice chasecatholic priestex soldier |
| Period: | 1990sfuture1910s |
| Story: | ancient astronautsecret passagetemplefemale nuditynumber in titlebloodsex scenetitle spoken by characterexplosionthree word titlepistolshowerfireshootoutshot to death …machine gunrescuecatfalling from heightheld at gunpointrobottelevisionkung fugood versus evilnew yorkterroristweaponanti herodouble crossspaceshipshot in the foreheadprologuekeyfired from the jobpoisonmissionproduct placementrace against timepresidentpursuitpremarital sexdie hard scenariogeneralstrong female characterdestinyelectronic music scorespacecraftassaultplanetblockbusterimpersonationbrooklyn new york citystrong female leadrocket launcherend of the worldcolonelchokingcyborgalien invasionwindinvasionegyptspecial forcesrefrigeratorpolice raidgay stereotypeflamethrowerwilhelm screamclonegatling gunrocketsatelliteextraterrestrialtimebombcockroachstonearms dealerprizelanguage barrierpyramidspace shuttlegenetic engineeringmuggingopera singershot in the footarcheologistdivaexploding shipshapeshiftingcloningmcdonald's restaurantstreet vendorandrogynytalk show hostmessiahhuman alienhuman versus alienhuman in outer spaceflying carstowawayconcert hallescape podledgeoutrunning explosionhumanoid alienmilitary veteranblack presidentgene manipulationexploding planetmetrosexualinvented languagehumanity in perilegyptologyblue skinfuturistic cityresort hotelmale alienfemale humanoid alienfrench science fictionfuturistic trainexploding starshipspaceportmanic pixie dream girlalien starshipartificially created womanblack u.s. presidentblue skinned alienfuturistic police car (See All) |
A telling of the 1st Battalion, 7 Cavalry Regiment, 1st Calvary Division's battle against overwhelming odds in the La Drang valley of Vietnam in 1965. Seen through the eyes of the battalion's commander, Lt. Col. Hal Moore (played by Mel Gibson), we see him take command of the battalion and its prepa …rations to go into Vietnam. We also see how the French had, years earlier, been defeated in the same area. The battle was to be the first major engagement between US and NVA forces in Vietnam and showed the use of helicopters as mobility providers and assault support aircraft. (Read More)
| Themes: | deathpregnancyheromilitarygriefphotography |
| Mood: | gore |
| Locations: | churchhelicoptertaxijungletaxi driverusahelicopter rescue |
| Characters: | soldierphotographeramerican soldier |
| Period: | 1960s2000s |
| Story: | world war two veteranmilitary basehand grenadebased on noveltitle spoken by characterexplosionpistolbased on bookshootoutshot to deathmachine gunbattlegunfightlettercombat …shot in the backreporterjournalistambusharmymapexploding carshot in the legshot in the foreheadtrainingpilotstabbed in the backperson on fireuniformexploding bodysadnessgeneralsubtitled scenebattlefieldmissileclaim in titleundergroundcaptainsergeantvietnamvietnam warjournalismbraveryu.s. armychaosassault riflesevered leggatling gunsouthern accentblood on camera lensshot in the neckmajorburnt facehelicopter crashbayonetburnt bodyshockshot in the throatstabbed in the faceair raidsubterraneanwarlordinfantryarmy baseautomatic weaponhelicopter pilotvietnamesesteel helmetarmy lifeprivatecorporalfrench armydead soldierchopperfriendly firetearnapalmvietconghiddenfirst aidkorean war veteranwar correspondentlieutenant colonelmale soldierwar memorialarmy menirish musicskillheroicu.s. cavalrymail deliverydismaysecond lieutenantfirst lieutenantheroic militarynear misschinookcombat photographyresponsebroken arrowsergeant majorair cavalrymilitary wife (See All) |
Benjamin Franklin Gates descends from a family of treasure-seekers who've all hunted for the same thing: a war chest hidden by the Founding Fathers after the Revolutionary War. Ben's close to discovering its whereabouts, as is his competition, but the FBI is also hip to the hunt.
| Subgenre: | heist |
| Themes: | friendshipkidnappingbetrayalamerican revolution |
| Mood: | car chase |
| Locations: | new york citychurchhelicoptercemeteryshipmuseumtunnelpennsylvania |
| Characters: | father son relationshipfamily relationshipsfriendhostage |
| Period: | 1970s2000s19th century20th century18th century21st century1830s |
| Story: | secret passageriddleflashbackchasepistolshootoutcorpsearrestfalling from heightletterriversubjective cameragraveyardlibraryprologue …fbiskeletonfirst partunderwaterwashington d.c.eyeglassestreasureblockbusterknightnew jerseygrandfatherboston massachusettsatticphiladelphia pennsylvanialanterntombvideo surveillanceexpeditionburied alivetasershipwreckarcticsecret societyjerusalemflaretreasure huntchandelierswimming underwaterpipecluecodemetal detectorforgeryfather son estrangementexploding shipaircraft carrierarchivesnowmobilecryptbricktreasure mapchanging roomreceptionilluminatigunpowdertreasure hunterfreemasonbell towerice pickcrusadesreference to thomas edisonhudson riverabyss1770sbulletproof glassdeclaration of independencecurator11th centurygift shopnational archiveslincoln memorial washington d.c.invisible inklibrary of congresshistorical documentliberty bell (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | martial artssuspensesurvival horror |
| Themes: | murderdeathrevengesuicidekidnappingbetrayalfearescapemonsterdeceptionpsychopathbrutalityparanoiaredemptioninsanity …panicself sacrificehuntingalien abduction (See All) |
| Mood: | gore |
| Locations: | forestwoodsouter spacejunglespace ship |
| Characters: | doctortattoosoldierserial killeralienhostagetough guywarrioraction herohitmankillerjapanesesniperrussiansniper rifle …ex soldierevil doctoralien monster (See All) |
| Story: | animal attackhand grenadeak 47sequelbloodviolenceone word titlebare chested malephotographtitle spoken by characterexplosionknifechasesurprise endingpistol …fireshootoutcorpseshot to deathblood splattermachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facebattleswordgunfightfalling from heightvomitingheld at gunpointcriminalcombatshot in the backf wordsubjective cameradecapitationsurvivalfoot chaseassassinsword fightambushimpalementstabbed to deathsevered headman with glassesno opening creditsanti heroone man armydouble crossspaceshipcreaturethird partcharacter repeating someone else's dialoguedangerelectrocutionpoisoncharacter's point of view camera shotevil mankicked in the facetough girlskeletonshot in the shoulderexploding bodytrapthreatened with a knifemercenarywaterfallsevered armsubtitled scenetrustbattlefieldstrong female characterafricanuzikilling an animalhead buttmachetecagesurvivorlifting someone into the airhunterspacecraftnosebleedplanetskulllaseraction heroinefemale warriorswitchbladesevered fingerfight to the deathdual wieldstabbed in the throatmercilessnesspunched in the stomachshot in the facefalling to deathensemble castspecial forcesdark herobooby trapparachuteconvictyakuzaminedark pastfieldtragic herosevered legcharacters killed one by onelasersightmoral dilemmagatling gunprequeltorso cut in halffemale assassinfemale soldierinvisibilityextraterrestrialkatanaparalysiswhistlefalling into waterimaginary friendflarehanging upside downhuntscalpelcrash landingpredatorstabbed in the shoulderteamworkopen endedtragic pastalien planetmasked villainexploding shipone woman armyflare gundragging a bodydreadlocksanti heroinealien creaturehead ripped offmad doctoralien racetalking to oneselfbear trapwoman punching a manfalling off a cliffhuman versus alienmost dangerous gamereference to ernest hemingwaybody armorhand through chestblack opsbaitgame of deathskinned aliveenforcerjungle warfaregreen bloodhuman preycontemplating suicideinfra redstabbed through the chestfalling down a hillminigunstabbed through the chinfilm with ambiguous titlecovered in mudelectro magnetic pulsefree fallhole in chestwarrior racemonster versus monstertoxinvoice imitationgrabbed by the throatleg blown offalien hunterinfrared visioninvisibility cloakshivfemale sniperdeath row inmateinvisible monsterstabbed through backhunting peopletied to a stakealien predatoralien weaponalien versus alienpoisonous plantprequel to sequelspine rippingfalling into a pithuman hunted down for sporthunted peoplesnare trapaircraft explosion (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
| Subgenre: | martial artsconspiracysupernaturaldark fantasy |
| Themes: | supernatural powermurderdeathlovebetrayalfeartortureescapedeceptionseductionangerdeath of fatherbrutalityparanoiaredemption …surveillanceunrequited lovepanicself sacrificenear death experience (See All) |
| Mood: | goredarknesspoetic justice |
| Locations: | trainsnowmotorcyclewatercastlelaboratorytunneltrain stationcar motorcycle chasemotorcycle chase |
| Characters: | father son relationshipfemale protagonistsoldierhostagetough guyvampirewarrioraction herosecurity guardsniperself healing |
| Story: | ak 47interrogationsequelf ratedbloodviolenceflashbackbare chested malefightexplosionpartyknifechasesurprise endingpistol …voice over narrationshootouttitle directed by femalebeatingcorpseshot to deathblood splatterfistfightmachine gunhorseshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facebattleswordgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombfightingcombatshot in the backdecapitationspysurvivalflashlightassassinsword fightambushstrangulationmassacremountainthroat slittingbridgearmyimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestsubwayfalse accusationsevered headno opening creditsdisarming someonefictional wardouble crossfemme fataleshot in the legtransformationshot in the foreheadon the runtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backfugitivepoisonevil manknocked outkicked in the facetough girllightningopening action sceneringshot in the shouldermanipulationbodyguardinjectionneck breakingloss of fatherthreatened with a knifedirectorial debutsevered armshot in the armhandgunbattlefieldpowerstylized violencehenchmanwerewolficetraitoruzifalling down stairsbulletburned aliverevelationspearassassination attempthypodermic needlegothicheavy rainsecurity camerakicked in the stomachvillainesspooljumping from heightcovered in bloodstrong female leadaction heroinemexican standofffemale killergun fuback from the deadambitionfemale warriorguardreverse footageshieldhaunted by the paststealing a cartarget practiceexplosivecrossbowfight to the deathconfrontationdual wieldstabbed in the throatmercilessnessstabbed in the neckresurrectionshot in the facestabbed in the headframe upstabbed in the legpunched in the chestjumping through a windowassault rifleaerial shothologramrainstormknife throwingraidsnowingstabbed in the eyedark pastfemale directorfifth partburned to deathframed for murderbullet timetorso cut in halftracking devicefemale assassindesert eaglefemale soldierbreak infinal showdownreturning character killed offstabbed in the handfemale fighterpistol whipsubway stationsuper strengthstabbed in the armfemale spyfemale vampirebroken mirrorfortresshanging upside downunderworldreluctant heroblizzardman kills a womanmacguffinwoman kills a manstabbed in the shoulderbullet woundfinal battleheirburnt bodyevil womanshot in the throatshot in the footopen endedfur coatrighteous ragestabbed in the facecorrupt officialtragic pastwoman fights a mandistrustshooting rangemind readingone woman armyanti heroineglowing eyesknocked out with a gun buttarmoryhummersurveillance footageregenerationfemale antagonistslow motion action scenesecret doorwoman punches a mansuper speeddrinking bloodman fights a womandark heroinecage fightingsecret passagewayharpoonman punches a womansunlightcouncilwoman hits a manalbinohybridsilverhenchwomancrisis of consciencespear throwingsecret laboratorycovenfeature film directorial debutcage fightrailyardmachine pistolbloodlettingcomplotlatex catsuiturban gothicburning bodytragic heroinewoman breaks man's neck50. caliber machine gunstrapped to a tablerecap segmentstabbed through the backclemencytwin handguns (See All) |
A long time ago, far away on the planet of Cybertron, a war is being waged between the noble Autobots (led by the wise Optimus Prime) and the devious Decepticons (commanded by the dreaded Megatron) for control over the Allspark, a mystical talisman that would grant unlimited power to whoever possess …es it. The Autobots managed to smuggle the Allspark off the planet, but Megatron blasts off in search of it. He eventually tracks it to the planet of Earth (circa 1850), but his reckless desire for power sends him right into the Arctic Ocean, and the sheer cold forces him into a paralyzed state. His body is later found by Captain Archibald Witwicky, but before going into a comatose state Megatron uses the last of his energy to engrave into the Captain's glasses a map showing the location of the Allspark, and to send a transmission to Cybertron. Megatron is then carried away aboard the Captain's ship. A century later, Captain Witwicky's grandson Sam Witwicky (nicknamed Spike by his friends) buys his first car. To his shock, he discovers it to be Bumblebee, an Autobot in disguise who is to protect Spike, who possesses the Captain's glasses and the map engraved on them. But Bumblebee is not the only Transformer to have arrived on Earth - in the desert of Qatar, the Decepticons Blackout and Scorponok attack a U.S. military base, causing the Pentagon to send their special Sector Seven agents to capture all "specimens of this alien race." Spike and his girlfriend Mikaela find themselves … (Read More)
| Subgenre: | teen comedychrist allegory |
| Themes: | lovetorturedeceptionmilitarydysfunctional familyhopeartificial intelligencespace travelunlikely hero |
| Mood: | high schoolcar chase |
| Locations: | swimming poolhelicoptermotorcyclelos angeles californiabathtubdesertbicycletaxipolice stationpolice carlakeshiptruckrooftopouter space …tunnelcar theftspace battlebicycle accidenthelicopter accidentcar bicycle chase (See All) |
| Characters: | mother son relationshipfather son relationshiphusband wife relationshippoliceteenagerteenage girlteenage boysoldieralienwarriorsecretaryaustralianpolice chasemilitary officerbabe scientist …ship captainhuman versus robot (See All) |
| Period: | 2000s19th century1890s21st century |
| Story: | ancient astronautmilitary baseinterrogationone word titleflashbackdogfightchasepistolfirevoice over narrationcell phoneshootoutunderwearmachine gun …urinationremakeshotgunrescuecomputerbattleundressingfalling from heightheld at gunpointrobothandcuffsscientistreporterdecapitationgood versus evilbedroomaxebasketballbridgeimpalementexploding carfalse accusationno opening creditspart of seriesfictional warnews reportbased on tv seriesdangerprologuelocker roomfbiproduct placementbaseball battanku.s. presidentscene during end creditshigh school studentcheerleadergovernmentautomobileglassesfirst partgeneralsecret agentobscene finger gestureufowashington d.c.machismoicemissileundergroundcaptainplanetblockbusterswat teamlaserpart animationhonorend of the worldmexican standoffwhite houseback from the deadcannonalien invasionbarefootbraveryu.s. armyboxer shortschaosresurrectionsuper villainhologrambulletproof vestlens flarestadiumjuvenile delinquentlasersightflamethrowerwilhelm screamexploding helicoptergovernment agentgatling gungrenade launcherbased on toyheroismgiant robotpetteenage lovespiral staircasestairwaycomputer crackertelevision newsworld dominationarcticwebcamcomic reliefmegalomaniacidealismmasturbation referencebased on cartoonflarecrewhearing voicescomputer hackerfighter jetexploding truckxbox 360macguffinplaying a video gamevehiclesurfboardspace warasteroidexplorershot through the mouthsole black character dies clichetow truckbadgepart computer animationalien contactaircraft carrierscatological humoradmiralu.s. air forceexploding airplanenegotiationpentagondonutradarhummerteenage heroalien racefederal agentguard dogcryogenicsboom boxcomputer virusfootball gamepower failuredouble entendrehuman versus alienorigin of heroalien technologyair strikevisachihuahuaexploding planebutchfrozenham radiocubeledgewashington monumenttransforming robotelectromagnetic pulseprotectorexploding bushdtvcnn reporterfast carreference to michael jordansemi truckebayspectaclesunderground bunkerbattle tankrobot versus robotyoung romancetalking robotwarrior raceairforce onecode breakingcamarosecret government organizationsecretary of defensealien robothack sawamateur radiocomputer chiphuman versus machineteenage heroinereference to ebayactor voicing multiple charactersfemale mechanicchevrolet camaro18 wheelerbelly buttonfamily petsentient robotapple macintosh computerenglish subtitlesautobotburger kingfederal governmentoptimus prime the characterpanasonicjuvenile crimeqatarremake of tv showdecepticonhoover damtransformer robotu.s. department of defensebased on cult filmbasketball ballbumblebee the charactermegatron the characterprominent product placementused car dealeranimate carfrozen in icehooverhummer h2nokiaroadstermechanical lifeformmountain dewreference to wolverineanimal urinationautobot versus decepticonextraterrestrial robotschool matecabinet officerherbert hooverhotwirehuman alien teamstarscream the charactervehicle driving by itselfyear 1897basketball hoopratchet the charactertop secret documentironhide the characterbody torn in halfcybertron the planetemergency vehiclehuman autobot teamhuman versus transformerlos angeles river channelsemi truck driving itselfshyguysikorsky helicopter (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com