Please wait - finding best movies...
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b β¦egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | rape and murdermurder of a police officerwritingphotographyevilsadisminsanitypsychopaththefttorturerapekidnappingdeathmurder |
Mood: | slasherneo noirgore |
Locations: | sex in a carroad movietexasgas stationmotelroad tripdeserthelicopterbar |
Characters: | slasher killerserial murderershooting a police officerchinese foodterrorvillainkillerwaitresshostagewriterboyfriend girlfriend relationshippolice |
Story: | psycho terrorrape victimpsycho filmserial rapistpolicewoman killingmass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathserial rapepistol whippolice officer shot in the legpolice officer shot through the heart β¦murder of a policewomanpolice officer shot in the backgory violencepolicewoman shottwisted mindmale with earringhair styleheavy pettingsports bradead policewomanbrutalhickgruesomefemale photographercrime spreeparole officeryo yoexposed breastbloody violencedisturbingbreaking a bottle over someone's headpittsburgh pennsylvaniagraphic violencecreepsouthernintentionally misspelled titleabusive boyfriendbutcherycross countrylunatichit with a shovelpolice officer shot in the chestsexual violencewhite trashtrailer parkcactusknocked unconsciousyuppiehillbillyserial murderhuman monsterkillbad guymadmanpervertblack bra and pantiesphysical abusepsychoticsexual assaultbody countrainstormperversionbilliardsblack bragash in the facestabbed in the throatdark humorbutchertensionmale underwearredneckrampagerapistvictimpsychostabbed in the stomachmutilationragetape recordermaniacarsonkillingmurdererautomobileon the roadstabbed in the backblack pantiesjourneynarrationstabbed to deathcaliforniajournalistgay slursex standing updead bodybeerbare buttshot in the headshotgunurinationshot in the chestcar accidentblood splattershot to deathpistoltitle spoken by characterphotographcigarette smokingmale rear nudityfemale nuditymale nuditybare chested maleone word titlebloodfightgunviolencesexnudity (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilinsanitypsychopathtorturerapemurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgruesomecrime spreecreepbutcherysexual violenceserial murderhuman monsterkillbad guy β¦madmanpervertbody countperversiondark humorbutcherrampagerapistpsychostabbed in the stomachmutilationragemaniackillingstabbed to deathshot in the chestblood splattershot to deathfemale nuditynudityviolencegunblood (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β¦are after the backpackers find a way to escape. (Read More)
Subgenre: | cult filmindependent film |
Themes: | evilsadisminsanitypsychopathtorturerapekidnappingmurderdeath |
Mood: | slashergore |
Locations: | road moviegas stationroad tripdeserthelicopterbar |
Characters: | slasher killerserial murdererterrorvillainkillerhostage |
Story: | psycho terrorserial rapistmass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathserial rapegory violencebrutalbloody violencegraphic violencecreepsouthern β¦butcherysexual violenceserial murderhuman monsterbad guymadmanpervertsexual assaultbody countrainstormperversionbutcherredneckrampagerapistvictimpsychomutilationmaniackillingmurdererautomobileon the roadstabbed in the backstabbed to deathgay slurdead bodyshot in the headshotgunurinationshot in the chestcar accidentblood splattershot to deathtitle spoken by characterphotographcigarette smokingbloodgunviolence (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | psycho thrilleramerican horrorcult film |
Themes: | evilsadisminsanitypsychopathtorturemurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencegruesomecrime spreedisturbingbloody violencegraphic violencebutcherylunatichillbilly β¦serial murderhuman monsterkillbad guymadmanbody countbutcherredneckrampagepsychomutilationragemaniackillingmurdererstabbed in the backstabbed to deathblood splattermale rear nudityfemale nuditymale nuditysexviolenceblood (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent film |
Themes: | evilsadisminsanitypsychopathtorturerapekidnappingdeathmurder |
Mood: | slashergore |
Locations: | gas stationroad trip |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | rape victimserial rapisthomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathserial rapegory violencecrime spreebloody violencegraphic violencecreepbutcheryserial murder β¦human monsterkillbad guymadmanpervertsexual assaultbody countperversiongash in the facebutchertensionrampageredneckrapistpsychostabbed in the stomachmutilationmaniackillingmurdererdead bodyshot in the headshotgunurinationcar accidentblood splatterphotographcigarette smokingfemale nudityviolencebloodgun (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | psycho thrilleramerican horrorcult film |
Themes: | murder of a police officerevilinsanitypsychopathmurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrorpsycho filmhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebrutalbloody violencebutcheryserial murderkillbad guymadman β¦body countbutcherrampagevictimpsychomutilationmaniackillingmurdererstabbed to deathblood splattersexviolence (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in β¦ the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
Subgenre: | psycho thrilleramerican horror |
Themes: | murder of a police officerwritingevilsadisminsanitypsychopathtorturekidnappingdeathmurder |
Mood: | neo noir |
Locations: | helicopter |
Characters: | slasher killerserial murderershooting a police officerterrorvillainkillerhostagewriter |
Story: | homicidal maniacpsychopathic killersadistic psychopathpolice officer shot in the backbrutalgruesomebloody violencecreepbutcheryserial murderhuman monsterphysical abusepsychoticbutchertension β¦rampagevictimpsychomutilationragemaniackillingmurderershotgunshot in the chestcar accidentshot to deathtitle spoken by characterone word titlegunviolencebloodfight (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathmurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencecrime spreebloody violencegraphic violencebutcherylunatichillbillyserial murderhuman monster β¦bad guymadmanpsychoticbody countbutcherredneckrampagevictimpsychostabbed in the stomachmutilationmaniackillingmurdererdead bodyblood splatterfemale nuditysexviolenceblood (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | psycho thrilleramerican horrorcult film |
Themes: | evilinsanitypsychopathdeathmurder |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationship |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathbrutalgruesomecrime spreedisturbingbloody violencecreepbutcherylunaticsexual violence β¦hillbillyserial murderhuman monsterbad guymadmanpsychoticbody countbutcherredneckrampagevictimpsychomutilationragemaniackillingmurdererdead bodyblood splatterfemale nuditysexfightviolenceblood (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | psycho thrillercult filmindependent film |
Themes: | murder of a police officerevilsadisminsanitypsychopathtorturerapekidnappingdeathmurder |
Mood: | gore |
Locations: | texasgas stationmotelroad tripdesertbar |
Characters: | terrorvillainhostageboyfriend girlfriend relationshippolice |
Story: | serial rapistmass murdererhomicidal maniackilling spreepsychopathic killerevil manpistol whipcrime spreegraphic violencebutcherycross countrysexual violencetrailer parkserial murderhuman monster β¦killbad guymadmanpervertsexual assaultbody countstabbed in the throatbutcherrampageredneckrapiststabbed in the stomachragemaniacmurdererstabbed in the backstabbed to deathgay slurdead bodybeerbare buttshot in the headshotgunshot in the chestblood splattershot to deathpistoltitle spoken by characterphotographcigarette smokingmale rear nuditybare chested maleviolenceblood (See All) |
Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilinsanitypsychopathtorturerapedeathmurder |
Mood: | slasherneo noirgore |
Locations: | helicopterbar |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationshippolice |
Story: | serial rapistmass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebrutalgruesomecrime spreebloody violencebutcherylunaticyuppie β¦serial murderhuman monsterbad guymadmanpervertbody countdark humorbutchertensionmale underwearrampagerapistvictimpsychoragetape recordermaniackillingmurdererblack pantiesstabbed to deathgay slurdead bodybare buttshot in the headurinationshot in the chestcar accidentblood splattershot to deathpistolphotographcigarette smokingmale rear nudityfemale nuditymale nuditybare chested malebloodgunviolence (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathtorturemurderdeath |
Mood: | slashergore |
Locations: | road trip |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencegruesomedisturbingbloody violencecreepbutcherylunaticserial murderhuman monster β¦killbad guymadmanpsychoticbody countbutcherrampagerapistvictimpsychomutilationragemaniackillingmurdererblood splattertitle spoken by characterbare chested maleviolenceblood (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath β¦ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
Subgenre: | psycho thrilleramerican horrorcult film |
Themes: | evilinsanitypsychopathtorturerapedeathmurder |
Mood: | slasherneo noirgore |
Locations: | deserthelicopterbar |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrormass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathcrime spreedisturbingintentionally misspelled titleserial murderhuman monsterkillbad guymadman β¦body countrapistvictimpsychomutilationtape recordermaniackillingmurderergay slurshot in the headshotguncar accidentblood splattershot to deathpistoltitle spoken by characterphotographbare chested maleone word titleviolenceblood (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathmurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrorpsycho filmhomicidal maniackilling spreepsychopathic killersadistic psychopathgruesomecrime spreedisturbingbloody violencegraphic violencebutcheryserial murderhuman monsterkill β¦physical abusepsychoticbody countperversionstabbed in the throatbutcherrampagevictimpsychostabbed in the stomachmaniackillingmurdererstabbed to deathdead bodybeerblood splattermale rear nudityfemale nuditymale nuditybare chested malesexviolence (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilinsanitypsychopathtorturekidnappingmurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationship |
Story: | psycho terrorpsycho filmmass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebrutalgruesomebloody violencegraphic violencebutcherysexual violence β¦serial murderkillbad guymadmanbody countbutcherrampagevictimpsychomutilationragemaniackillingmurdererblood splatterpistolphotographviolenceblood (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | american horrorcult film |
Themes: | psychopathdeathmurder |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationship |
Story: | mass murdererhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebrutalgruesomecrime spreeyo yodisturbingsexual violencehillbillyserial murder β¦human monsterbad guymadmanstabbed in the throatrampagepsychoragemaniacmurderernuditybloodsex (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | murder of a police officerevilpsychopathmurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrormass murdererhomicidal maniacpsychopathic killerevil mansadistic psychopathbutcherylunaticserial murderbad guymadmanbody countblack brabutchermale underwear β¦rampagepsychomutilationmaniacblack pantiesstabbed to deathblood splatterfemale nuditybare chested malebloodviolence (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A β¦t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
Subgenre: | psycho thrilleramerican horror |
Themes: | evilpsychopathmurderdeath |
Mood: | slashergore |
Locations: | helicopterbar |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorpsycho filmhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebrutalgruesomecrime spreebloody violencedisturbinggraphic violencebutchery β¦serial murderhuman monsterbad guymadmanbody countstabbed in the throatbutchervictimpsychostabbed in the stomachmutilationmaniackillingmurderershot in the headcar accidentblood splattershot to deathpistolviolenceblood (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | psycho thriller |
Themes: | rape and murderevilinsanitypsychopathtorturerapekidnappingmurderdeath |
Mood: | slasherneo noirgore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrorrape victimpsycho filmserial rapisthomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathserial rapedisturbingbloody violencegraphic violenceserial murderkill β¦bad guymadmanrainstormrapistpsychomaniackillingmurderershotguncar accidentblood splatterpistolphotographfemale nuditybare chested malegunfightviolencebloodsex (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | evilinsanitypsychopathtorturerapedeathmurder |
Mood: | slashergore |
Locations: | desert |
Characters: | slasher killerterrorvillain |
Story: | homicidal maniackilling spreepsychopathic killerevil mansadistic psychopathbloody violencegraphic violencesexual violenceserial murderhuman monsterbad guymadmanbody countgash in the facerampage β¦psychoragemaniacstabbed in the backstabbed to deathgay slurshot in the headshot in the chestblood splattershot to deathpistolfemale nudityfightnudity (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathkidnappingdeathmurder |
Mood: | slashergore |
Characters: | terrorvillainpolice |
Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathserial murderhuman monsterbad guymadmanpervertbody countperversionstabbed in the throatrampagepsycho β¦stabbed in the stomachmutilationragemaniacshotgunshot in the chestblood splattershot to deathpistoltitle spoken by charactercigarette smokingbloodviolence (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilpsychopathmurderdeath |
Mood: | slasher |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorpsycho filmhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathserial murderhuman monsterkillbad guymadmanbody countpsychostabbed in the stomach β¦mutilationmaniackillingmurdererstabbed to deathshot in the chestblood splattershot to deathtitle spoken by charactercigarette smokingfemale nudityone word titlegunnudityviolence (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to β¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | insanitypsychopaththeftmurderdeath |
Mood: | slasher |
Locations: | moteldesert |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | psycho terrorpsycho filmhomicidal maniacpsychopathic killersadistic psychopathcrime spreedisturbingbloody violencebutcheryserial murderhuman monsterbad guymadmanpsychoticbody count β¦rainstormblack bragash in the facebutchervictimpsychomutilationmaniackillingmurdererstabbed to deathcaliforniaphotographbare chested maleone word titlebloodviolence (See All) |
Mickey Knox and Mallory Wilson aren't your typical lovers - after killing her abusive father, they go on a road trip where, every time they stop somewhere, they kill pretty well everyone around them. They do however leave one person alive at every shootout to tell the story and they soon become a me β¦dia sensation thanks to sensationalized reporting. Told in a highly visual style. (Read More)
Subgenre: | psycho thrillercult filmindependent film |
Themes: | evilsadisminsanitypsychopathrapekidnappingmurderdeath |
Mood: | slasherneo noirgore |
Locations: | road moviegas stationmotelroad tripdesert |
Characters: | waitresshostageboyfriend girlfriend relationshippolice |
Story: | rape victimmass murdererhomicidal maniackilling spreepsychopathic killerevil mancrime spreewhite trashhuman monsterkillpsychoticstabbed in the throatredneckrampagetape recorder β¦maniackillingmurdereron the roadstabbed to deathjournalistgay slurbeershot in the headshotgunurinationshot in the chestblood splattershot to deathpistolphotographcigarette smokingbare chested malesexviolencebloodfight (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psycho thrilleramerican horror |
Themes: | insanitypsychopathrapekidnappingdeathmurder |
Mood: | slasherneo noirgore |
Characters: | slasher killerserial murdererterrorvillainkillerhostage |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathbloody violencedisturbingcreepserial murderhuman monsterbad guybody countrampagerapist β¦victimpsychoragemaniackillingmurderershotgunshot in the chestshot to deathtitle spoken by characterbare chested maleone word titleviolenceblood (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | evilsadismpsychopathtorturerapekidnappingdeathmurder |
Mood: | slashergore |
Locations: | gas station |
Characters: | serial murderervillainkillerwriter |
Story: | rape victimkilling spreepsychopathic killerevil mansadistic psychopathgory violencegruesomedisturbinggraphic violencesexual violencewhite trashserial murderhuman monsterkillpervert β¦psychoticbody countperversionredneckrapistvictimmutilationragekillingmurderercigarette smokingfemale nuditymale nuditybare chested malegunbloodviolence (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | rape and murderevilsadisminsanitypsychopathtorturerapekidnappingdeathmurder |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | rape victimserial rapisthomicidal maniacpsychopathic killerevil mansadistic psychopathbloody violencedisturbinggraphic violencesexual violenceserial murderhuman monsterbad guymadmanpervert β¦sexual assaultperversionrapistvictimmutilationmaniackillingmurdererstabbed in the backstabbed to deathbeerurinationblood splattershot to deathfemale nudityviolencegunbloodfight (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilinsanitypsychopathdeathmurder |
Mood: | slasher |
Characters: | slasher killerterrorvillainboyfriend girlfriend relationshippolice |
Story: | psycho terrorhomicidal maniacpsychopathic killerevil mansadistic psychopathbloody violencegraphic violenceserial murderkillbad guymadmanbody countrampagevictimpsycho β¦ragemaniacstabbed in the backstabbed to deathcaliforniadead bodycar accidentpistolviolenceblood (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | psycho thrilleramerican horror |
Themes: | evilpsychopathdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerpolice |
Story: | psycho terrorpsycho filmhomicidal maniacpsychopathic killerevil mansadistic psychopathgruesomebloody violencebutcheryyuppiebad guymadmanbody countbutcherpsycho β¦maniacmurdererstabbed to deathcar accidentcigarette smokingblood (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathrapemurderdeath |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerwaitressboyfriend girlfriend relationship |
Story: | psycho terrorpsycho filmhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathbrutalgruesomebloody violenceserial murderkillbad guymadmanpsychotic β¦body counttensionrampagevictimmutilationmaniackillingmurdererautomobilebare buttcar accidentblood splatterpistolphotographfemale nuditybare chested maleviolencebloodsexnuditygun (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo β¦vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadismpsychopathtorturemurderdeath |
Mood: | slasherneo noir |
Characters: | slasher killerserial murderervillainkiller |
Story: | psycho filmhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathdisturbingserial murderbad guymadmanpsychoticbody countmale underwearrampagevictim β¦psychomutilationtape recordermaniackillingmurdererstabbed to deathurinationcar accidenttitle spoken by characterfemale nuditybare chested malegunnudity (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | american horrorindependent film |
Themes: | murder of a police officerevilsadisminsanitypsychopathtorturedeathmurder |
Mood: | slashergore |
Characters: | terrorvillainkillerhostage |
Story: | homicidal maniacpsychopathic killerevil mansadistic psychopathpistol whipcrime spreebutcheryserial murderhuman monsterbad guypsychoticbody countperversiongash in the facebutcher β¦rampagevictimpsychomutilationtape recordermaniacstabbed to deathgay slurdead bodyshotgunblood splatterpistolcigarette smokingfemale nudityviolencefightblood (See All) |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
Subgenre: | american horror |
Themes: | murder of a police officersadismpsychopathtorturerapekidnappingmurderdeath |
Mood: | slashergore |
Locations: | motel |
Characters: | serial murdererterrorkillerhostage |
Story: | rape victimserial rapisthomicidal maniacpsychopathic killerbreaking a bottle over someone's headsexual violencehuman monsterkillmadmansexual assaultrainstormperversionrapiststabbed in the stomachrage β¦maniacmurdererstabbed in the backstabbed to deathshot in the headshot in the chestcar accidentblood splatterpistolfemale nuditybare chested malebloodviolence (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | murder of a police officerevilpsychopathmurderdeath |
Mood: | slashergore |
Characters: | slasher killervillainkiller |
Story: | homicidal maniackilling spreepsychopathic killerevil mansadistic psychopathcrime spreeserial murderhuman monsterbad guybody countrainstormblack brastabbed in the throatrampagemaniac β¦killingmurdererstabbed in the backstabbed to deathblood splatterfemale nudityviolencebloodfight (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | american horrorcult film |
Themes: | evilsadismpsychopathkidnappingmurderdeath |
Mood: | slashergore |
Locations: | desertbar |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationship |
Story: | psycho terrorhomicidal maniackilling spreepsychopathic killerevil mansadistic psychopathgory violencebutcheryserial murderbad guymadmanbody countrainstormgash in the facebutcher β¦male underwearrampagepsychostabbed in the stomachmutilationmaniacmurdererstabbed in the backstabbed to deathdead bodybare buttshotgunblood splattercigarette smokingmale rear nuditymale nuditybare chested malenudityfightbloodviolence (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | evilsadisminsanitypsychopathmurderdeath |
Mood: | slashergore |
Locations: | bar |
Characters: | slasher killerserial murdererterrorvillainkiller |
Story: | homicidal maniackilling spreepsychopathic killerevil mansadistic psychopathbloody violencedisturbingbutcheryhit with a shovelserial murderbad guymadmanbody countbutcherrampage β¦victimragemaniackillingmurdererstabbed in the backstabbed to deathblood splattercigarette smokingfemale nuditybare chested maleviolence (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β¦osely. (Read More)
Subgenre: | cult film |
Themes: | sadisminsanitypsychopathrapemurderdeath |
Mood: | slashergore |
Locations: | bar |
Characters: | slasher killerserial murdererterrorvillainkillerboyfriend girlfriend relationshippolice |
Story: | homicidal maniackilling spreepsychopathic killersadistic psychopathbrutalgruesomeexposed breastdisturbinggraphic violencebutcheryserial murderhuman monsterkillpsychoticbody count β¦butcherrampagevictimstabbed in the stomachtape recordermaniacarsonkillingmurdererstabbed in the backstabbed to deathjournalistgay slurdead bodyblood splatterphotographcigarette smokingviolencegunblood (See All) |
A camera crew follows a serial killer/thief around as he exercises his craft. He expounds on art, music, nature, society, and life as he offs mailmen, pensioners, and random people. Slowly he begins involving the camera crew in his activities, and they begin wondering if what they're doing is such a β¦ good idea, particularly when the killer kills a rival and the rival's brother sends a threatening letter. (Read More)
Subgenre: | cult film |
Themes: | rape and murderevilsadisminsanitypsychopathrapekidnappingmurderdeath |
Mood: | slashergore |
Locations: | bar |
Characters: | terrorvillainkillerboyfriend girlfriend relationship |
Story: | rape victimserial rapisthomicidal maniackilling spreesadistic psychopathcrime spreesexual violenceserial murderhuman monsterperversiondark humormutilationmaniacmurdererstabbed in the back β¦gay slurdead bodybeershot in the headurinationshot in the chestblood splattershot to deathcigarette smokingmale rear nudityfemale nuditymale nudityviolencegunbloodnudity (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | american horrorcult filmindependent film |
Themes: | evilpsychopathmurder |
Mood: | slashergore |
Characters: | slasher killerserial murdererterrorvillainkillerwaitress |
Story: | homicidal maniackilling spreepsychopathic killerevil mansadistic psychopathdisturbingbutcheryserial murderbad guybutcherrampagestabbed in the stomachmutilationmaniackilling β¦murdererstabbed to deathurinationblood splatterphotographcigarette smokingbare chested maleblood (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
Subgenre: | cult filmindependent film |
Themes: | murder of a police officersadisminsanitypsychopathkidnappingdeathmurder |
Mood: | neo noirgore |
Locations: | road movietexasgas stationmotelbar |
Characters: | shooting a police officerwaitresshostagepolice |
Story: | mass murdererhicksouthernpolice officer shot in the chesthuman monsterstabbed in the throatredneckarsonon the roadstabbed to deathbeershot in the headshotgunshot in the chestcar accident β¦blood splattershot to deathpistolcigarette smokingbare chested malefightgunbloodviolence (See All) |
Lula's psychopathic mother goes crazy at the thought of Lula being with Sailor, who just got free from jail. Ignoring Sailor's probation, they set out for California. However their mother hires a killer to hunt down Sailor. Unaware of this, the two enjoy their journey and themselves being together.. β¦. until they witness a young woman dying after a car accident - a bad omen. (Read More)
Subgenre: | cult filmindependent film |
Themes: | sadismpsychopathrapemurderdeath |
Mood: | gore |
Locations: | road movietexasgas stationmotelroad tripdesertbar |
Characters: | killerpolice |
Story: | rape victimgraphic violencewhite trashtrailer parkperversiondark humorarsonon the roadjourneygay slurshotgunurinationshot in the chestcar accidentblood splatter β¦shot to deathtitle spoken by charactercigarette smokingfemale nuditymale nudityviolenceblood (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
Subgenre: | american horror |
Themes: | evilsadismpsychopathmurderdeath |
Mood: | gore |
Characters: | villainpolice |
Story: | homicidal maniackilling spreepsychopathic killersadistic psychopathbloody violencedisturbinggraphic violencecreepkillbad guypervertstabbed in the throatbutcherpsychomutilation β¦maniackillingmurderergay slurblood splattertitle spoken by characterone word titleviolenceblood (See All) |
In San Francisco, the criminal psychologist Helen Hudson is specialized in serial-killers. During a trial, the accused Daryll Lee Cullum kills a police officer and tries to kill her and she becomes agoraphobic. Now Helen lives a reclusive life with her gay friend Andy that helps her. Sometime later, β¦ there is a wave of crimes and Detectives M.J. Monahan and Reuben Goetz are investigating the murder cases. Helen identifies that the murderer is copycatting notorious serial-killers and she anonymously contacts the Police Department. After fourteen phone calls, she is identified by the police. Detectives M.J. and Reuben visit her and Helen teams up with them and prepares the profile of the killer that wants to be famous. But soon the copycat killer Peter Foley contacts and stalks Helen and M.J. and Reuben give protection to her. Will they be capable to stop Foley before the next murder? (Read More)
Subgenre: | american horrorindependent film |
Themes: | murder of a police officerpsychopathkidnappingmurderdeath |
Mood: | slasherneo noirgore |
Characters: | serial murdererterrorkillerpolice |
Story: | homicidal maniacevil manpolice officer shot through the heartpolice officer shot in the backpolicewoman shottwisted mindpolice officer shot in the chestserial murderhuman monsterkillmaniacmurderershot in the headblood splattertitle spoken by character β¦one word titleviolenceblood (See All) |
A young man transporting a car to another state is stalked along the road by a cunning and relentless serial killer who eventually frames the driver for a string of murders. Chased by police and shadowed by the killer, the driver's only help comes from a truck stop waitress.
Subgenre: | cult film |
Themes: | murder of a police officersadismpsychopathkidnappingdeathmurder |
Mood: | gore |
Locations: | road movietexasgas stationhelicopter |
Characters: | killerwaitresspolice |
Story: | mass murdererhuman monstermadmanrampagemaniacautomobileon the roadshot in the headshotgunshot in the chestblood splattershot to deathpistolgunblood β¦violence (See All) |
Now that zombies have taken over the world, the living have built a walled-in city to keep the dead out. But all's not well where it's most safe, as a revolution plans to overthrow the city leadership, and the zombies are turning into more advanced creatures.
Subgenre: | american horrorcult film |
Themes: | sadismmurderdeath |
Mood: | gore |
Locations: | gas station |
Characters: | villain |
Story: | gory violencebrutalgruesomebloody violencedisturbingpittsburgh pennsylvaniagraphic violencebutcherykillbad guygash in the facebutcherarsondead bodyshot in the head β¦shot in the chestcar accidentblood splattershot to deathpistolfemale nudityviolenceblood (See All) |
In New York, college student Justine joins a group of activists led by Alejandro and travels to Peru to protest against a timber industry that is destroying the Amazon rain forest. When the group is returning to civilization, the plane blows-up and crashes into the forest. Soon the survivors discove β¦r that they are not alone and they are abducted by a tribe of cannibals. (Read More)
Subgenre: | american horror |
Themes: | torturemurder |
Mood: | slashergore |
Characters: | slasher killerterrorvillain |
Story: | sadistic psychopathgory violencebrutalbloody violencegraphic violencehuman monsterkillbad guybody countvictimmutilationkillingurinationshot in the chestblood splatter β¦shot to deathpistolmale rear nudityfemale nuditybare chested maleviolence (See All) |
After a bank heist in Abilene with several casualties, the bank robber Seth Gecko and his psychopath and rapist brother Richard Gecko continue their crime spree in a convenience store in the middle of the desert while heading to Mexico with a hostage. They decide to stop for a while in a low-budget β¦motel. Meanwhile the former minister Jacob Fuller is traveling on vacation with his son Scott and his daughter Kate in a RV. Jacob lost his faith after the death of his beloved wife in a car accident and quit his position of pastor of his community and stops for the night in the same motel Seth and Richard are lodged. When Seth sees the recreational vehicle, he abducts Jacob and his family to help his brother and him to cross the Mexico border, promising to release them on the next morning. They head to the truck drivers and bikers bar Titty Twister where Seth will meet with his partner Carlos in the dawn. When they are watching the dancer Santanico Pandemonium, Seth and Richard fight with three bodyguards. But soon they discover that the bar is a coven of vampires and they need to fight until dawn to leave the place alive. (Read More)
Subgenre: | cult filmindependent film |
Themes: | psychopathrapedeathmurder |
Mood: | gore |
Locations: | texasmoteldesertbar |
Characters: | killerhostage |
Story: | rape victimserial rapistmass murdererhomicidal maniacpsychopathic killercrime spreehuman monsterpervertrapistmaniacgay slurshot in the headshotguncar accidentblood splatter β¦shot to deathtitle spoken by characterfemale nudityviolencebloodgunfight (See All) |
Will Graham is a former FBI agent who recently retired to Florida with his wife Molly and their young son. Graham was a 'profiler'; one who profiles criminal's behavior and tries to put his mind into the minds of criminals to examine their thoughts while visiting crime scenes. Will is called out of β¦his self-imposed retirement at the request of his former boss Jack Crawford to help the FBI catch an elusive serial killer, known to the press as the 'Tooth Fairy', who randomly kills whole families in their houses during nights of the full moon and leaves bite marks on his victims. To try to search for clues to get into the mind of the killer, Will has occasional meetings with Dr. Hannibal Lecktor, a charismatic but very dangerous imprisoned serial killer that Will captured years earlier which nearly drove him insane from the horrific encounter that nearly cost Will's life. With some help and hindrance, Will races against the clock before the next full moon when the 'Tooth Fairy' will strike again. Elsewhere, a local photographer named Francis Dollarhyde, the killer that Will is looking for, struggles to stay undetected while seeing a hope of redemption when be begins a relationship with a blind woman who is not aware of his double life. (Read More)
Subgenre: | cult filmindependent film |
Themes: | murder of a police officersadisminsanitypsychopathtorturekidnappingdeathmurder |
Mood: | slasherneo noirgore |
Characters: | villainkillerhostageboyfriend girlfriend relationshippolice |
Story: | killing spreepsychopathic killerevil mansadistic psychopathpolice officer shot in the chestserial murderhuman monstergash in the facepsychotape recorderjournalistgay slurshotgunshot in the chestcar accident β¦blood splattershot to deathphotographcigarette smokingbare chested maleone word titlegunviolenceblood (See All) |
Nazi-Fascist Northern Italy, 1943-44. Four senior members of government, aided by henchmen and Nazi soldiers, kidnap a group of young men and women. They hold them for 120 days, subjecting them to all manner of torture, perversion and degradation.
Subgenre: | cult film |
Themes: | evilsadisminsanitypsychopathtorturerapekidnappingmurderdeath |
Mood: | gore |
Characters: | villain |
Story: | evil mangraphic violencesexual violencehuman monsterpervertperversionrapistvictimmutilationgay slurdead bodybare buttshot in the headurinationblood splatter β¦shot to deathmale rear nudityfemale nuditymale nuditybare chested malesexviolencebloodgun (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
Themes: | psychopathrapemurderdeath |
Mood: | slasherneo noir |
Characters: | serial murderervillainboyfriend girlfriend relationship |
Story: | homicidal maniacpsychopathic killerserial murderbad guysexual assaultbody countrainstormrampagemutilationmaniacmurderershot in the chestcar accidentblood splattershot to death β¦pistoltitle spoken by characterphotographfemale nudityblood (See All) |