Please wait - finding best movies...
A group of college students visit a secluded vacation home to celebrate their upcoming graduation. The fun doesn't last long when a sadistic psychopath forces them to participate in his deadly contest. The rules are simple -- in order to survive they must kill each other. As tension builds, and rela β¦tionships begin to crumble, they realize that only one can make it out alive. Could you trust your boyfriend? Your girlfriend? Your best friend? Only one can go home. So who will be the last man or woman standing? (Read More)
Subgenre: | independent film |
Themes: | panicbetrayalsuiciderevengedeathmurderfriendship |
Mood: | gore |
Locations: | lakemotorcyclecarforest |
Characters: | love trianglefriend |
Story: | thrown through windowsunken boatthought deadsplit uptest of lovecutting a ropeforced to killgraduation partyescape planafter dark horrorfestclosurestrangled to deathleft for deadtheorydeadline β¦stepsisterbear trapmountain climbingsadistic psychopathinsane asylumbandagestabbed in the headshovelcelebrationpsychogroup of friendsshot in the stomachsabotageexperimentcabinbasementvanaxestrangulationshot in the headfiresurprise endingfemale nuditybare breastsbloodgun (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | independent filmcult filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | panicfriendshiprevengedeathmurderdrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited love β¦home invasionexploitationpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | lakeforesthospitalbathtubbicyclewaterwoodsfarmtruckcavegas stationcampfirebackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | left for deadstabbed in the headgroup of friendsshot in the stomachcabinaxeshot in the headfiresurprise endingfemale nuditybloodviolencefemale frontal nudityflashbackmasturbation β¦dogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiespistolshowercell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationblondeshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushmassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned alivediseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storelemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
Subgenre: | cult filmcreature featuresurvival horrorbritish horror |
Themes: | panicbetrayalfriendshipdeathmurderrevengeinfidelityghostdrinkingfearescapemonsterbrutalityguiltgrief β¦cannibalismblindnessmurder of familyclaustrophobia (See All) |
Mood: | gorenightmare |
Locations: | carforesthospitalwoodscavecave in |
Characters: | friendhusband wife relationshipfemale protagonistbest friendlittle girl |
Story: | stabbed in the headgroup of friendscabinsurprise endingbloodf ratedviolencetwo word titlephotographknifecryingbeatingcorpseblood splattercar accident β¦blondefalling from heightbookvomitingliehallucinationsurvivalflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenecreaturenecklacesmokingbeaten to deathdolldarkisolationneck breakingfirst partunderwaterwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandkilling spreeblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror |
Themes: | murderdeathrapeghostdancesupernatural powersadismevilsupernatural rapebook of evil |
Mood: | goreslasherone night |
Locations: | carforestwoodssinging in a car |
Characters: | friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism |
Period: | 1980s |
Story: | group of friendscabinbasementaxeshot in the headfiresurprise endingfemale nuditybloodviolencekissthree word titleblood splatterremakeshotgun β¦written by directorshootingbooklow budget filmcollegedemonriversubjective cameradecapitationstabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationhauntingfirst partdirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusemutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | psycho thrillerslasher flick |
Themes: | deathrevengemurdertorturedrunkennesspsychopathbrutalitydeath of motherevilmurder of a police officer |
Mood: | goreslasherdarknesshorror movie remake |
Locations: | lakemotorcycleforestboatbathtubbicyclewaterwoodspolice carcampfiretunnelschool busbackwoodssex in a tent |
Characters: | african americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
Period: | 1980s |
Story: | bear trapsadistic psychopathstabbed in the headpsychocabinaxestrangulationshot in the headfiresurprise endingfemale nuditybare breastsbloodnuditynumber in title β¦violencefemale frontal nuditymasturbationdogbare chested malesex scenefemale rear nuditynippleschasepistoltelephone calltopless female nuditywoman on topcorpsedigit in titleblood splatterurinationblonderemakebare buttmaskdead bodymarijuanahallucinationalcoholswimmingdecapitationflashlightbracandletoplessmassacrevideo camerastabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing persontentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscampcovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyebody countaxe murdersevered legcharacters killed one by onearrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpssleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, β¦ but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
Subgenre: | black comedysupernaturalslasher flickteen horrorsupernatural horrorreality spoof |
Themes: | suicidemurdersurrealismghostdrunkennessmonstergamblingsurveillanceapocalypse |
Mood: | goresatireslasher |
Locations: | lakegas stationtunnelcave in |
Characters: | teenagerboyfriend girlfriend relationshipzombiesecurity guardwitchbabe scientistself referential |
Period: | 2000s20th century1900s21st centuryyear 2009 |
Story: | bear trapstabbed in the headcelebrationgroup of friendscabinshot in the headsurprise endingfemale nuditybloodflashbackbare chested malepistoltelephone callshot to deathblood splatter β¦machine gunshot in the chestcar crashcollegerobotf worddecapitationmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassescreaturegravecharacter repeating someone else's dialoguevirginstabbed in the backclownperson on firediarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationswat teamsevered handcovered in bloodend of the worldeaten aliveredneckcameostabbed in the throatdark humorfalling to deaththrown through a windowtitle at the endstabbed in the eyeaxe murdercharacters killed one by oneethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbonghuman sacrificestonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagescarecrowjocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternno survivorsgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartdead teenagerfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakehorror icongrappling hookblonde stereotypeno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
Subgenre: | independent filmcult filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | panicmurderfriendshiprevengedeathkidnappingfeartortureescapepsychopathbrutalityparanoiainsanityhome invasioncannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | bear trapgroup of friendsaxeshot in the headfiresurprise endingbloodsexviolencecigarette smokingexplosionknifechase β¦pistolcryingcell phonebeatingcorpseshot to deathblood splattercar accidentshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushmountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutanttied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to β¦ survive the night in Los Angeles. (Read More)
Subgenre: | suspensedystopiasurvival horror |
Themes: | revengemurderdeathkidnappingdeceptionpsychopathdeath of fatherbrutalitysurveillancehome invasionhomelessnessself sacrificehuntingnear death experience |
Mood: | goreslasherone night |
Locations: | motorcyclecarhospitallos angeles californiabusapartment |
Characters: | father daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guywaitresssniperex husband ex wife relationshipsniper riflehomeless man |
Period: | 2020s |
Story: | shot in the stomachsabotageaxeshot in the headfiresurprise endingbloodviolencesequelbare chested malephotographexplosionknifepistolcell phone β¦shootoutcorpseshot to deathblood splattermachine gunshot in the chestshotgunrescueslow motion scenewritten by directorheld at gunpointsecond partcar crashrevolvershot in the backf wordsurvivalfoot chasegangambushambulancemansionstabbed to deathstabbed in the chesttied to a chairsubwayexploding carno opening creditsanti herohit by a carnews reportshot in the legshot in the foreheadon the runlimousinecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotrace against timeshot in the shoulderdeath of sonlaptopneck breakingtrapdie hard scenariomercenaryshot in the armclass differencesak 47chainsawhand grenadeburned alivemass murdermacheteparking garagemasked manapartment buildinggas maskstealing a carresistanceshot in the faceassault rifleghettobooby trapone daybulletproof vestlens flareflamethrowersirengatling gunmedia coverageauctiontracking devicehit with a baseball batmolotov cocktailbag over headhiding in a closetarmored cararms dealerfilm starts with textteenage daughterman punching a womanhanged mandeath of boyfriendcar set on fireshot in the throatresistance fighternight vision gogglesman with no namerunning out of gaspainted facemilitantgas grenademass deathlatin americansemi truckdune buggysororicidepirate broadcastingemergency broadcast systembody in a dumpsteryear 2023 (See All) |
A medical student and his girlfriend become involved in a bizarre experiment into reanimating the dead conducted by the student's incorrigible housemate in this campy sendup of an H.P. Lovecraft story. The emphasis is on humour but once the dead walk, there is gore aplenty.
Subgenre: | independent filmcult filmblack comedy |
Themes: | panicdeathfearinsanitymadness |
Mood: | goredarkness |
Locations: | hospitalelevatorlaboratory |
Characters: | doctorzombienursestudent |
Story: | experimentbasementaxestrangulationfemale nuditybloodsexmale nudityviolencefemale frontal nuditymale frontal nuditymale rear nudityfemale rear nudityfemale full frontal nuditynipples β¦pantiespunctuation in titlecorpseblood splatterface slapcatdead bodysciencescientistdecapitationimpalementfemale pubic hairwhite pantiessevered headman with glassesanti herobreast fondlinglatex glovesdangerscreaminginjectionglassesthreatfirst partsevered armsplattergirl in pantieshyphen in titlesyringedestructionhypodermic needledrugmad scientistmorgueblack humordead womanguardsevered fingerbased on storydead manh.p. lovecraftfemale doctorsexual assaultsurgeondeath of loved onebraindead girlintestinesdead fatheroverdosespreadeaglestrait jacketcrushed headdisembodied headmassachusettsexperiment gone wrongmacabrehit with a shoveldead catbagblack cathuman experimentmedical doctormolestationscience runs amokmad doctorsinistersurgical operationclothes rippingmedical experimentreanimationbitten handheadliterary adaptationevil scientisttalking headserummedical schooldecapitated bodyconvulsiondefibrillationdefibrillatorevil deadmedical researchzurich switzerlandneurosurgeonprofessional rivalryreanimated corpsebone sawcardiopulmonary resuscitationman undressing a womanexploding eyesurgical instrumentsglowshovel through throat (See All) |
Subgenre: | independent filmmartial artssuspenseconspiracycorporate conspiracy |
Themes: | panicbetrayalsuiciderevengedeathmurderkidnappingfearescapeinvestigationdeceptionangerbrutalityparanoiasurveillance β¦artificial intelligence (See All) |
Mood: | car chase |
Locations: | lakeforestwoodskitchenfarmlaboratoryresearch station |
Characters: | boyfriend girlfriend relationshipdoctorhostageinterracial relationshippsychiatristchinesesuicide by hangingbabe scientistfemale scientistgeneticist |
Period: | near future |
Story: | sabotagestrangulationshot in the headsurprise endingbloodcharacter name in titleviolenceone word titleinterviewflashbackbare chested malefighttitle spoken by characterknifechase β¦pistolshowercell phonebeatingcorpseblood splatterfistfightcar accidentmirrorshot in the chestrescuepunched in the facecomputercamerabrawlshowdownrifleheld at gunpointhand to hand combatbedinterrogationriversciencekung fuscientistshot in the backf wordfoot chasebedroomassassinambushdeath of friendimpalementstabbed to deathmixed martial artsdinerstabbed in the chestman with glassesdisarming someonedouble crossdrowningshot in the foreheadlatex glovesattempted murdertreecharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backkaratesuitcasecover upknocked outkicked in the faceshot in the shoulderinjectionisolationlaptopneck breakingsuspicionthreatened with a knifedirectorial debutsubtitled scenetrustfalling down stairsrevelationhead buttelectronic music scorehypodermic needlelooking at oneself in a mirrorcatfightmutantjoggingcooksecurity camerabeardkicked in the stomachpsychologistcompassionfemale killerandroidpresumed deadfull moonrampagestealing a carblood on facefight to the deathgash in the facestabbed in the neckevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiertied feetcorporationmutationcharacters killed one by onekilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerstabbed in the armclimbing through a windowhired killergenetic engineeringmercy killingwoman kills a mandeath of boyfriendexperiment gone wrongfilmed killinghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagebitten in the throatwoman's neck brokendeoxyribonucleic acidthroat rippingcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
Themes: | murderdeathtorturepsychopathbrutalitysupernatural powerinsanitysadismevil |
Mood: | goreslasherbreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | brother sister relationshipteenage girlteenage boyserial killerkillervillainterrorslasher killermysterious villainserial murderermysterious killer |
Period: | 1980s |
Story: | sadistic psychopathstabbed in the headpsychocabinstrangulationsurprise endingfemale nuditybare breastsbloodsexnumber in titlemale nudityviolencesequelfemale frontal nudity β¦masturbationmale rear nudityfemale rear nuditypantiescorpseunderwearblood splattermasklow budget filmsubjective cameradecapitationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurdererloss of motherobscene finger gesturekillingmaniacsexual attractionlifting someone into the airragemutilationmorguefourth partgrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn β¦that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
Subgenre: | cult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talegothic horrorfolk horror |
Themes: | panicbetrayalfriendshipdeathmurderrevengelovekidnappingfeartortureescapedeceptionseductionangerdeath of father β¦supernatural powerdeath of motherparanoiahumiliationunrequited loveexecutioncouragedeath of daughterautism (See All) |
Mood: | nightmaredarkness |
Locations: | lakeforestchurchsnowboatvillagewoodscavelog cabin |
Characters: | love trianglefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierpriesthostagesister sister relationshipgrandmother granddaughter relationshiphunting party β¦woodcutter (See All) |
Period: | winter |
Story: | sabotageaxefiresurprise endingbloodf ratedcharacter name in titleviolenceflashbackdancingpartyknifechasethree word titlevoice over narration β¦title directed by femaledreamcorpseblood splatterhorseshot in the chestrescueslow motion sceneswordarrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalfoot chaseorphanambushmassacremountainarmyimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossritualflash forwardtreecursedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherwaterfallloss of motherwerewolfcaptainwolfrevelationgothichelmetjail cellhuntersevered handtorchanimal attackpreacherfull moonrampageshieldvisionbraveryarranged marriagecrossbowhatredrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithunttaverncabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arrestglowing eyeshatchetcard trickhorse drawn carriagestagecoachmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All) |
While filming a horror movie of mummy in a forest, the students and their professor of the University of Pittsburgh hear on the TV the news that the dead are awaking and walking. Ridley and Francine decide to leave the group, while Jason heads to the dormitory of his girlfriend Debra Monahan. She do β¦es not succeed in contacting her family and they travel in Mary's van to the house of Debra's parents in Scranton, Pennsylvania. While driving her van, Mary sees a car accident and runs over a highway patrolman and three other zombies trying to escape from them. Later the religious Mary is depressed, questioning whether the victims where really dead, and tries to commit suicide, shooting herself with a pistol. Her friends take her to a hospital where they realize that the dead are indeed awaking and walking and they need to fight to survive while traveling to Debra's parents house. (Read More)
Subgenre: | independent filmmockumentaryfound footagefake documentarycreature featurezombie apocalypse |
Themes: | panicsuicidedeathrevengedrunkennessguiltapocalypsecannibalismmurder of a police officermurder of family |
Mood: | goresequel to cult horror |
Locations: | carforesthospital |
Characters: | boyfriend girlfriend relationshipzombieprofessorfilmmakerself inflicted gunshot wound |
Story: | stabbed in the headshovelvanshot in the headbloodgunviolencesequelchasepistolvoice over narrationshot to deathblood splattermachine guncar accident β¦shot in the chestswordshot in the backsubjective cameravideo cameramansionimpalementstabbed in the chestsevered headradiohit by a cartalking to the camerashot in the foreheadgravestabbed in the backcostumeelectrocutionkicked in the faceshot in the shoulderlong takemanipulationfilm within a filmexploding bodyunderwaterhandguncult directorheart attackriotbow and arrowbarnsecurity cameraloss of loved onemediasevered handsocial commentaryback from the deadeaten alivecorsetattempted suicidechaosgunshot woundshot in the facem 16dynamiteaccidental killingfifth partsequel to cult favoriteblood on camera lensintestinesvideo surveillancedirector cameomummyhead blown offabandoned houseacidbroken windowfalling into waterflaskburnt faceanarchyhanged manburnt bodyshot through the mouthfilmed killingrecreational vehiclezombie violenceloss of familyscarescythebitten in the throatno endingthroat rippingkiller clownamishbitten handfilm studentshot through a wallzombie childexposed breasttv broadcastbitten on the armfirst personsequel to cult filmnational guardstabbed in the foreheadabandoned hospitalhand cameramelting facedouble impalementsplit headchild shot in the headhanged bodyleft behindend of civilizationclothes torn offexploding eyeinternet broadcastindoor poolkilled in showerarrow through the headpanic roomm16 gun (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
Themes: | murderdeathprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
Mood: | gorecar chaseslasherdarknessbreaking the fourth wall |
Locations: | lakeforestcemeterysmall townboatwoodsamerica |
Characters: | policeteenagerzombieserial killerkillervillainsheriffterrorslasher killerserial murderer |
Period: | 1980s |
Story: | sadistic psychopathstabbed in the headshovelpsychosurprise endingsexcharacter name in titlenumber in titleviolencesequelflashbackblood splattermasknumbered sequeldemon β¦decapitationflashlightmassacreambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationvictimback from the deadmasked manrampagenew jerseybutcherslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
Subgenre: | martial artsblack comedysuspense |
Themes: | panicbetrayalsuicidemurderdeathrevengejealousyfearescapegangsterdeceptionseductionbrutalityparanoiamafia β¦exploitation (See All) |
Mood: | goreneo noircar chase |
Locations: | motorcyclenew york citybarrestauranttrainhotelelevatoritalyrooftopcavetunnelfire truckcar motorcycle chaseblood in water |
Characters: | african americanbrother sister relationshippolice officerpolicemantough guywarrioraction herohitmansniperrussianamerican abroadsniper rifleself mutilationhomeless manrussian mafia |
Period: | 2010s |
Story: | stabbed in the headbasementstrangulationshot in the headfiresurprise endinggunbloodcharacter name in titlenumber in titleviolencesequelfemale frontal nudityflashbackdog β¦fightcigarette smokingphotographexplosionpartyknifechasepistolcell phoneshootoutcorpsedigit in titleshot to deathblood splatterfistfightmachine guncar accidentmirrorshot in the chestshotgunslow motion scenepunched in the faceundressinggunfightbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatsecond partcar crashmanhattan new york cityshot in the backf wordsurvivalfoot chaseassassinambushconcertmassacremontagethroat slittingstabbed to deathmixed martial artsstabbed in the chestsubwayno opening creditsanti herodisarming someoneone man armyassassinationhit by a cardouble crosscigar smokingshot in the legshot in the foreheadon the runattempted murderlimousineone against manyorganized crimecharacter repeating someone else's dialoguedangerstabbed in the backprologuewidowerfugitiveproduct placementsuitcasecover upkicked in the facetough girlopening action sceneshot in the shoulderlong takemanipulationbodyguardneck breakingthreatened with a knifeshot in the armsilencerobscene finger gesturetypewritersubtitled scenearsonstylized violencehenchmancrime bossmachismoitalianfalling down stairsassassination attemptwarehouseheavy rainlooking at oneself in a mirrorrome italymobsterbeardkicked in the stomachpoolart galleryviolinhonorrocket launcherfemale killergun fufemale warriorthugstealing a cartarget practicefight to the deathdual wieldstabbed in the throatmanhuntmercilessnessstabbed in the neckmuteshot in the faceescape attemptstabbed in the legpunched in the chestdark heroaerial shotknife fightblood on shirtbounty hunterbulletproof vestbody landing on a carraised middle fingerlonercastrationdark pastdressing roombody counttragic herobruisesequel to cult favoriterpgsign languagecoingrenade launchermob bossvodkafemale assassinenglishman abroadshot through a windowblood on camera lenshandshakefinal showdownstabbed in the handshot in the neckcentral park manhattan new york cityspiral staircasesubway stationsubtitlessuit and tiearms dealerbrooklyn bridgesecret societystabbed in the armbullet ballethired killerman kills a womancrashing through a windowgun dueltimes square manhattan new york citycontract killermafia bossshot in the throatshot in the footopen endedrepeated linerooftragic pastwoman fights a manpool of bloodshooting rangetailorhouse on firefingerprintpencilassassination plotarmorybilingualismsecret roomthrown from a carred winecrime lordwoman's neck brokenhidden gunmedalliongold coincrushed by a carcoming out of retirementman fights a womanhotel managershot through a wallburning househidden doorromahomeless sheltershot in the kneestabbed in the crotchbirdcagehenchwomanchop shopneondragging a dead bodybourbongold barreference to the popeginslide locked backcosa nostrafemale bodyguardsororicideman with a ponytailprofessional assassinstabbed with a pencilstabbed in the earrunning out of ammohall of mirrorsfemale bounty hunterfemale crime bossmasculine womanhall of recordsrave musicgearing uployal dogugly womancobblestonecoliseumreference to applebee's (See All) |
When a videographer answers an advert of the website Craigslist for a one-day job in a remote mountain town to video the last messages of a dying man. The job takes a strange turn when the last messages get darker and darker. The videographer continues to see the job through, but when it is time to β¦leave he is unable to find his keys, and when he receives a strange phone call he finds his client is not at all what he initially seemed to be. (Read More)
Subgenre: | independent filmfound footage |
Themes: | murderfilmmakingdeceptionpsychopathobsessionhome invasionwilderness |
Mood: | nightmare |
Locations: | lakecarforestbathtubwoodsapartmenttown |
Characters: | serial killerkilleractor director writer |
Period: | year 2012 |
Story: | stabbed in the headshovelcabinaxesurprise endingone word titlebare chested maleknifetelephone callcell phonewritten by directormaskpaintinglielow budget film β¦subjective cameramountainvideo camerastabbed to deathdinerapologyno opening creditsbathnecklacetalking to the cameraconfessionparkstalkerwritten and directed by cast memberstalkingautomobilethreatsleepingsubtitled scenefreeze framehuggingwolfvideotapemasked manwhiskeydeath of protagonisthandheld cameratitle at the endintruderaxe murderbenchwritten by starlyingdrugged drinkserial murdervideo tapeminimal caststuffed animaldying mancabin in the woodsvideo footagemale in bathtubdisturbed individuallocketpackagevideo diaryaxe in the headcar keysdigital videostuffed toylock of hairtwo directorswatching someone sleeplake housejump scaregarbage baglooking for workvideo messagementally unstabletwo handersitting on a benchanimal maskcalling the policesecret filmingman in bathtubreference to craigslistantagonist as protagonistunpunished antagonistdisturbed personhonda civicopening creditshouse in the woodsmentally unstable manwolf costumewritten by actorlocket with photographmountain townrape confessiontape recorded confession (See All) |
The Draytons - David, Steff and their son Billy - live in a small Maine town. One night a ferocious storm hits the area, damaging their house. The storm is accompanied by a strange mist. David and Billy and their neighbour Brent Norton go into town. There they discover that the mist contains some fr β¦ightening creatures, creatures intent on killing humans. (Read More)
Subgenre: | cult filmsuspensetragedycreature featuresurvival horrormonster movie |
Themes: | panicsuicidedeathmurdermarriagefearmonstermilitarynatureangersupernatural powerparanoiainsanityapocalypse |
Mood: | gore |
Locations: | lakehelicoptersmall townrural setting |
Characters: | father son relationshipteachersoldierlawyerartistbiblesuicide by hangingreligious fanaticmilitary policehuman versus monster |
Period: | 2000s |
Story: | bandageexperimentaxeshot in the headfiresurprise endingbloodbased on novelsex scenefighttitle spoken by characterknifeblood splatterfistfightshot in the chest β¦face slappaintingneighborprayerrevolverscientistsurvivalflashlightstabbingwomanarmystabbed in the chestfalse accusationchild in perilcreatureshot in the foreheadtreedangerperson on firebased on short storylightningtankhangingmanagerdie hard scenariohandgunchainsawropesupermarketdestructionmedicinespearmutilationloss of loved oneloss of wifedesperationmobtorchpreacherearthquakeeaten alivemechanictrappedu.s. armythunderstormdeath of protagonistfogmurder of a childhighwaysiegedead boyflamethrowersirenwilhelm screamholding handshysteriafire extinguishergun in mouthhuman sacrificeacidrestroomwhisperingburnt facedenialpharmacymercy killingtentacleman kills a womanbloody body of childhanged manshockexperiment gone wrongparasitestresstragic endingmainegrudgeburn victimalternate dimensionarmy baseassisted suicidehummergiant spidercowardicemovie posterchild killeddrugstorepower failuremistrunning out of gasbritish actor playing american charactergiant insectclothes linemercedescashierresentmentwoman shot in the foreheadfilicidestabbed in the bellybased on novellabiblical quotescience experimentbased on the works of stephen kingsingle locationpet foodvenomno cellphone signalboy killeddimensionchild shotmopchild shot in the headfalling treerulesbattle tankzealotspiderwebcrazy womanlovecraftianmale soldierfeelings of guiltblack outproselytizingripped in halfbaseball cap worn backwardsmanuremaniaromantic kisssurvivalismvicodinpower generatorfather murders sonpainting as artmob rulem1 abrams tankelectrical generatorbehemothharbinger of deathinsect stingcommercial artisttownspeopleelectric lightgrocery marthouse by a lakehowitzersafety glasseschild killed by fathergroanreference to sesame streetstorm damage (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
Subgenre: | black comedy |
Themes: | betrayaldeathmurderfriendshipdrunkennessguilt |
Mood: | goreslasherhorror movie remake |
Locations: | kitchenfire truck |
Characters: | father son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend |
Story: | stabbed in the headbasementaxestrangulationfiresurprise endingfemale nuditybloodviolencefemale frontal nuditymale rear nuditybare chested malefemale rear nudityparty β¦knifechasepantiesshowercell phonecorpseblood splattermirrorshot in the chestblonderemakeshotgunslow motion scenepunched in the facebare buttsecretvomitingheld at gunpointlingeriecollegehallucinationhandcuffsvoyeuralcoholcleavageflashlightambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the necksenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
Max Renn runs a TV channel, and when looking for new material to show--he discovers "Videodrome." His girlfriend, Nicki Brand, goes to audition for the show, and Max gets drawn into the underlying plot that uses the show as its front for a global conspiracy.
Subgenre: | independent filmcult filmsuspenseconspiracyvideocyberpunkbody horrorcorporate conspiracy |
Themes: | panicbetrayalsuiciderevengemurderdeathsurrealismfeartortureescapedeceptionseductionparanoiainsanityexploitation β¦philosophytechnology (See All) |
Mood: | goresatirenightmareambiguous ending |
Locations: | restauranthotelapartmentusa |
Characters: | lustjapanesepsychiatristprofessorsecretaryself mutilationengineerwriter directorself inflicted gunshot woundsuicide by shootingsuicide by shooting one's self in the head |
Period: | 1980s |
Story: | shot in the stomachstrangulationshot in the headfiresurprise endingfemale nuditygunbloodsexnuditymale nudityviolenceone word titlefemale frontal nudityflashback β¦masturbationmale rear nuditybare chested malefemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterexplosionpistoldreamcorpseshot to deathblood splattershot in the chestface slapwritten by directorcondombare buttheld at gunpointbombhallucinationtelevisiontelephonebound and gaggedtied to a chaircultanti heroassassinationdouble crossnews reportshot in the foreheadattempted murderlimousinemicrophonedangerfantasy sequenceauditionlong takemanipulationscarexploding bodypremarital sexshot in the armlove interestwhippingcult directorpizzapornographyrevelationelectronic music scoregothicscene during opening creditsred dresstied to a bedmediavideotapecovered in bloodgrindhousevirtual realitysadomasochismmind controlmilksocial commentarywhipdark humordisembowelmentperversionalternate realitycorporationkilling spreegothintestinesvideo tapemysterious manbrainwashingworld dominationnight visionelectronic musicblack marketradio stationpiercingpornographersnuff filmfight the systemfilmed killinghomeless persontelevision setceomurder spreephilosophersocial decayvcrextreme close upman slaps a womanshoulder holstersex on first dateman slaps womanreference to sigmund freudhidden guntv stationtalk show hosttumorgarroteman hits womanconferencejamaicanhand through chestvisionaryradio hostactress breaking typecastremadeabsurd violenceheadsetsubliminal messagetrailer narrated by percy rodriguezacting musiciancanuxploitationabandoned shipentrailssatellite dishassimilationvirtualityabandoned churchillegalityspectacleshole in chestpinunderground pornographymovie reality crossovervideo recordercable tvtv show within a filmtrade showtelevision executiveblurred boundariesboat yardopticiangimp masktoronto canadapirate broadcastsatellite televisiontelevision as portaldesensitizationvideo libraryagony aunt (See All) |
While exploring g uncharted wilderness in 1823, legendary fronjitiersman Hugh Glass sustains injuries from a brutal bear attack. When his hunting team leaves him for dead, Glass must utilize his survival skills to find a way back home while avoiding natives on their own hunt. Grief-stricken and fuel β¦ed by vengeance, Glass treks through the wintry terrain to track down John Fitzgerald, the former confidant who betrayed and abandoned him. (Read More)
Subgenre: | martial artssuspenserevisionist western |
Themes: | panicbetrayalfriendshipdeathmurderrevengekidnappingrapemoneyfeardrunkennessescapedeceptionnaturebrutality β¦paranoiaguiltdeath of wifevengeancecouragehuntingwildernessnear death experienceregretmurder of sonmother nature (See All) |
Mood: | gorerainbreaking the fourth wall |
Locations: | forestbarsnowboatwoodscampfireusa |
Characters: | father son relationshiphostagetough guywarrioraction heronative americaninterracial relationshipsniperfrenchself mutilationdeath of a friendhunting party |
Period: | winter19th century1820s |
Story: | closureleft for deadstabbed in the headaxestrangulationshot in the headfiresurprise endingbloodbased on novelnudityviolenceflashbackmale frontal nuditymale rear nudity β¦two word titlebare chested malefightpartyknifechasepistolbased on true storybased on bookshootoutcorpseshot to deathblood splatterfistfighthorseshot in the chestrescuebattleswordgunfightbrawlshowdownlierifleheld at gunpointhand to hand combatsex standing uphallucinationrivercombatshot in the backsubjective camerasurvivalfoot chaseambushmassacrestabbingthroat slittingstabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequenceanti herobirddisarming someoneone man armydouble crossunderwater scenesearchshot in the leglooking at the camerashot in the foreheadracial sluron the runone against manydangerstabbed in the backspiritualitywidowercharacter's point of view camera shotlightningopening action scenehangingshot in the shoulderlong takepursuitdeath of sonpigneck breakingwaterfallshot in the armbearsubtitled scenearsonbattlefieldcaptainwolfbow and arrowkilling an animalspearwoundheavy raininjuryloss of friendstabbed in the stomachmale bondinghunterbeardloss of wifecovered in bloodrape victimgenocidetorchrapistanimal attackinterracial friendshipbroken legpresumed deadhaunted by the pasttensionlandscapesevered fingerbraveryblood on facefight to the deathloss of sonmanhuntstabbed in the legsafedark herobathingdisembowelmentknife fighthealingrainstormdeertribelonercastrationdark pastlens flaresexual assaulttragic herosevered legethnic slursymbolismmoral dilemmasouthern accenthorseback ridingman cryingblood on camera lenssuffocationfinal showdownstabbed in the handburied aliveshot in the neckpistol whipamerican indiantexanarms dealervery little dialogueintolerancegun held to headshot with an arrowyoung version of characterarcherystabbed in the armshot in the eyetavernstretchermercy killingblizzardswimming underwaterfinger cut offshot in the handhanged manshot in the throatshot in the footarcherinterracial couplefur coatmusketrighteous ragesorrowtragic pastdead wifeavalanchefrenchmandigging a gravearmy basedeterminationbilingualismforthatchetmissing daughterflintlock riflebuffalohorse chasefurflintlock pistolsnowstormthroat rippingcanteenfalling off a cliffbritish actor playing american charactertradecreekguerilla warfarecold weathertrackerblood on handscrawlinggunpowdershooting starscalpingtomahawkminimal dialoguebroken backgrizzly bearhit with a rifle buttbear attackelkdead horsemountain manseeing dead peopleteenage sondrinking waterwolf packmaulingstomachanimal bitealtruismbisonkilling a horsenude man murderedraw meatsnowy landscapestarting a firehorse jumpingnative american attackgangrenetrapperbear cubrapidsinjured legcoitus interruptusanimal skullvisceralhands upnursing back to healthregaining consciousnesseating raw meatman versus naturewidowed fatherleft to diemale star appears nudeanimal carcasscrow indianinterracial rapemanifest destinysneak attackblackfoot indianwillpoweranimal companionhelping othersback scarcauterizing a woundguttingcopingpillagingtremblingreflection on lifefur trapperman carrying a mansweat lodgetraumatic pastsafe robberystolen horsebearskinbuilding a shelterinjured handsleeping in the nudecomanche tribeeating raw fishfrontiersmanlacerationloosely based on a true storypawnee indian (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror |
Themes: | revengedeathmurderfearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
Mood: | gorenightslasherdarknessblood and gore |
Locations: | lakemotorcyclecarboatwaterwoodsrural settingpolice cartruck |
Characters: | friendpoliceteenagerteenage boypolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driverslasher killer β¦mysterious villainserial murderer (See All) |
Period: | 1970s1950ssummer |
Story: | sadistic psychopathpsychocabinaxesurprise endingfemale nuditybare breastssexnumber in titlemale nudityviolencemale rear nuditybare chested malekissfemale rear nudity β¦nipplesthree word titlepantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manmassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Ray Breslin is the world's foremost authority on structural security. After analyzing every high security prison and learning a vast array of survival skills so he can design escape-proof prisons, his skills are put to the test. He's framed and incarcerated in a master prison he designed himself. He β¦ needs to escape and find the person who put him behind bars. (Read More)
Subgenre: | martial artsblack comedyconspiracy |
Themes: | betrayalmurderdeathfriendshiprevengekidnappingmoneyprisontortureescapedeceptionsadismsurveillanceself sacrificeprison escape |
Locations: | beachhotelhelicopterairplanelos angeles californiashipcar explosioncar bombfire truckprison fightwater tortureship fireprison ship |
Characters: | father daughter relationshipdoctortattoolawyertough guywarriorbiblesnipersheriffmuslimsniper rifleship captainescape artist |
Period: | 2010s21st centuryyear 2013 |
Story: | escape planshot in the stomachaxestrangulationshot in the headfiresurprise endingbloodviolenceflashbacktwo word titlebare chested malefightcigarette smokingexplosion β¦knifechasepistolcell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshotgunrescueslow motion scenepunched in the facearrestbrawlletterheld at gunpointhand to hand combatinterrogationhandcuffsshot in the backf wordsubjective camerafoot chasegay slurflashlightdisguisebasketballprisonerstabbed in the chesttied to a chairmapexploding carno opening creditsone man armydrawingdouble crossunderwater sceneshot in the legshot in the foreheadauthorbinocularscharacter repeating someone else's dialogueperson on fireelectrocutionpay phonecharacter's point of view camera shotundercovershot in the shoulderinjectionneck breakingthreatened with a knifemercenaryex convictshot in the armsilencersubtitled scenefreeze framemachismofalling down stairsburned alivehead butthypodermic needlesociopathsecurity camerajail cellwalkie talkiephone boothfalse identitymasked manfull moonprison guardfloodexplosivedual wieldpower outagenew orleans louisianapunched in the stomachfalling to deathmiami floridaescape attemptstabbed in the legassault riflewisecrack humore mailundercover agentconvictraised middle fingerlasersightfirefightertracking deviceclose up of eyessatelliteshot through a windowblood on camera lenscia agentprayingface maskbag over headcafeteriatwist endingcomputer crackerfemale spycoloradofemale lawyercomputer hackermoroccostabbed in the shouldercar set on firehigh techairfieldpsychological torturecockney accentprison wardensolitary confinementfinger gunslow motion action sceneprison riotescaped prisonergas grenadeplanninguh 1 huey helicopterreference to allahgun fightwaterboardingcargo shipmaximum security prisonprison gangreference to houdinihit with a wrenchmisdirectiontaseredclimbing a ladderchocolate milksuturereference to the three musketeersinjected in necksadistic wardenkeypaddiversionary tacticfiring guns from both handssecurity expertmotion detectorsextantlocked in a carmorpho butterflytransponder (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t β¦he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
Subgenre: | independent filmsadistic horror |
Themes: | suicidedeathmurderkidnappingtorturepsychopathbrutalityinsanitysadismpolice brutality |
Mood: | goreslasherhorror movie remake |
Locations: | barbathtubwheelchairpolice carroad tripgas station |
Characters: | policemother son relationshipboyfriend girlfriend relationshippolice officerserial killercrying babyevil sheriff |
Period: | 1970s |
Story: | group of friendsbasementvanaxeshot in the headsurprise endingbloodviolenceknifevoice over narrationblood splatterremakeinterrogationpianotelephone β¦impalementsevered headno opening creditshit by a carpolice officer killedlocker roomevil manpigchickendirectorial debutsevered armobscene finger gesturecowdismembermentmoonmaniacchainsawfalling down stairspot smokingnipples visible through clothingheavy rainlifting someone into the aircowboy hatmutilationhomicidefull moonsevered fingerthrown through a windowdisfigurementbody countalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | independent filmsuspensepunksurvival horror |
Themes: | panicbetrayalrevengefriendshipdeathmurderkidnappingfearescapedeceptionracismtheftbrutalityparanoianear death experience |
Mood: | gore |
Locations: | forestbarrestaurantbicyclewoodsrural settingpolice carcampfire |
Characters: | policeboyfriend girlfriend relationshiptattoosingerpolicemanhostagetough guywarriorjewishreference to godcousin cousin relationshipgermanblonde girlkiller dog |
Period: | 2010s |
Story: | stabbed in the headvanstrangulationshot in the headsurprise endingbloodviolenceinterviewdogtwo word titlefightcigarette smokingphotographknifepistol β¦cell phoneshootoutcorpseshot to deathblood splattershot in the chestshotgunslow motion scenewritten by directorgunfightbrawlshowdownheld at gunpointbeercollegecolor in titlerevolvershot in the backf wordsurvivalgay slurflashlightbandambushconcertdeath of frienddrug dealermontagethroat slittingstabbed to deathdinerstabbed in the chestman with glassesno opening creditsdisarming someonedrawingshot in the legshot in the foreheadbartenderracial slurattempted murdermicrophonedangerstabbed in the backrace against timecover uptough girlbaseball batinjectionwitnessisolationpolicewomanstagedie hard scenariothreatened with a knifeheroinrecord playerhenchmantraitorrevelationhypodermic needlemachetetape recordersociopathmutilationguitariststabbed in the stomachdesperationcrying mananimal attackeaten alivefemale warriorthugpromisecrime scenepump action shotguntensionstealing a cartrappedface paintcouchstabbed in the throatmercilessnesspower outagestabbed in the neckshot in the faceevacuationdrummerescape attemptcigarette lighterframe updisembowelmentaerial shotone daycellphonegasolinedressing roombroken armduct tapecharacters killed one by oneethnic slurposterdrumsfire extinguisherstabbed in the handswastikagateshot in the neckremorseblackoutskinheadstandoffdisposing of a dead bodybunkertrailer homestabbed in the armneo naziself defensetape recordingcornfieldshot in the eyeelectric guitarman kills a womann wordwoman kills a manbleeding to deathmurder witnesssleeping in a caroregonbouncerfart jokemusic gigpool of bloodimprovised weapongang leaderanimal killingportland oregonclimbing out a windowreference to madonnavinylthroat rippingpunk musiccut armpacific northwestheld hostagegreen hairmohawk haircutradio hostreference to britney spearsconfederate flagshot in the kneewhite supremacistbar ownerstabbed in the foreheadbassistpep talk911 calldragging a dead bodymulletcleaverpitbullpunk bandbass guitarhuman shieldchoke holdbitten in the facebox cuttermeth labescalationmaulingrock clubbitten on the legkilled by a dogskating rinkreference to princereference to iggy popdrug labgas siphoningreference to simon and garfunkelreference to black sabbathbattle cryreference to ozzie osbournefalling asleep at the wheelgreen roomreference to odinreference to slayer (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and β¦ the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
Subgenre: | suspensetragedypost apocalypsedystopiaepicchrist allegory |
Themes: | panicbetrayalsuiciderevengefriendshipdeathmurderkidnappingfeartortureescapedeceptionmilitarytravelanger β¦brutalityobsessiondeath of motherparanoiaredemptionhopedeath of wifedyingself sacrificenear death experiencemurder of familyprison escapestarvationfuture war (See All) |
Mood: | raindarkness |
Locations: | forestbeachhelicoptersnowdesertwatervillagewoodscavejunglecampfiretunnelmilitary truck |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshiptattoobrother brother relationshipsoldierbabyhostagelittle girlsnipersniper rifledeath of a friend |
Period: | near future |
Story: | escape planleft for deadsabotageaxestrangulationshot in the headfiresurprise endingbloodviolencesequelflashbackbare chested malefightphotograph β¦explosionknifechasepistolshootoutbeatingdreamcorpseshot to deathfistfightfoodmachine gunhorseshot in the chestshotgunrescueslow motion scenebattlegunfightbrawlfalling from heightshootingshowdownrifleheld at gunpointsunglassesinterrogationhallucinationalcoholcombatshot in the backsubjective camerasurvivalorphanflashlightambushmassacremountaindeath of friendmontagebridgearmyimpalementprisonerweaponmapno opening creditspart of serieschild in perilfictional wardouble crossjourneythird partattempted murdertreebinocularsbeaten to deathdangerattackcharacter's point of view camera shotmissionrace against timedollknocked outtankopening action scenedeath of brotheramerican flagtragic eventexploding bodydeath of sonwaterfallflowerloss of motherhandgunwhippingsubtitled scenemonkeybattlefieldak 47missileropetraitorshavinghand grenadegrenadedestructionbow and arrowspearwarehouseheavy rainmachetetalking animalcagequesthelmetviruscaptivewalkie talkiecrucifixstealingloss of loved onebeardhammerexploding buildingloss of wifeblockbusterdesperationlaserrocket launchertorchburialanimal attackcolonelsocial commentaryprison guardfloodinvasionu.s. armycrossbowloss of sonwhiphatredmercilessnessmutespecial forcesdeath of protagonistassault rifleinfectionaerial shotprisoner of warshadowcommandocapturebulletproof vestcliffbordertribesnowingrescue missionlasersightarrowbonfiredeath of loved onerpgexploding helicopterloss of brothersign languagesmokemoral dilemmashaved headgatling gungrenade launchermain character diesimprisonmentfemale soldierabandoned buildingflagfinal showdownreturning character killed offarmored caralarmabandoned houseshot with an arrowgorillawallshoutinghugclimbingkidhelicopter crashfilm starts with textfallingbehind enemy linesmercy killingblizzardrazorleaderbody bagaltered version of studio logofinal battleskychainedchimpanzeepart computer animationcommando raidmurder attemptaperighteous ragedeath of familybowtragic endingholepsychological tortureavalancheheroic bloodshedloss of familyhermitanimal killingarmy baseassisted suicidevalleyknocked out with a gun buttberetfleeingloggas explosiontrilogyphotoepic battlehorse chasemercypunchingkeysleadershipbarricadeguerilla warfaremilitantorangutanshot in the sidewhite horsenational anthemsaddlestar spangled bannersurprise attackexoduspickaxeoutrunning explosionmissile launcherplatoonslave laborspear throwingforced laborprisoner of war campsecret tunneldarwinismtexthead shavingmute childunderground tunnelprovocationoasissimian fictionfeedingmilitary campexploding bridgelast wordsprequel and sequellockupcoveranimal fightman versus naturemilitary jeeptalkingcaesarfernplanet of the apes50. caliber machine gunsequel to a rebootthrowingturncoattalking animalsfall downapesrolling (See All) |
In a red light district, newswoman Karen White is bugged by the police, investigating serial killer Eddie Quist, who has been molesting her through phone calls. After police officers find them in a peep-show cabin and shoot Eddie, Karen becomes emotionally disturbed and loses her memory. Hoping to c β¦onquer her inner demons, she heads for the Colony, a secluded retreat where the creepy residents are rather too eager to make her feel at home. There also seems to be a bizarre connection between Eddie Quist and this supposedly safe haven. And when, after nights of being tormented by unearthly cries, Karen ventures into the forest and makes a terrifying discovery. (Read More)
Subgenre: | independent filmcult filmstop motionstop motion animationcreature featuresurvival horror |
Themes: | deathmurderfriendshiplovemarriageinfidelityrapejealousyadulterymonsterdeceptioncorruptionsupernatural powerunfaithfulnessfalling in love β¦amnesiaself sacrificehuntingmurder of brother (See All) |
Mood: | gorenight |
Locations: | forestbarbeachlos angeles californiawoodsrural settingofficegas stationcampfire |
Characters: | brother sister relationshipfemale protagonistserial killerpolicemanlustpsychiatristsheriffolder man younger woman relationship |
Period: | 1980s |
Story: | bandagecabinaxefiresurprise endingfemale nuditybased on novelnuditymale nudityfemale frontal nuditytwo word titlesex scenekissfemale full frontal nudity β¦nipplesfondlingcorpseshot to deathmirrorblondecamerabare buttriflevoyeurold mancaliforniafemale pubic hairexploding carbrunettedream sequencedrawingtransformationdangerscreamingfirst of seriespay phonesensualitystalkingarsoncorrupt copwerewolftv newsburned alivedesiredressgothictape recordermorguephone boothdesperationsevered handgrindhouseforbidden lovehomiciderampagewoman in jeopardyreverse footagebookstorefogperversionvegetarianbarbecueattractionlens flaresurprise after end creditsbushcartoon on tvsexual perversionacidrestroomsecret societycattlegroup therapyjacketsuicidalmetamorphosisflameorchestral music scoreshape shifterclawshapeshiftingpleasurecolonymurder victimregenerationfangsnews anchorawakeninghowlingwearing a sound wirehuman preyporn looplycanthropycampfire storysilver bulletfemale werewolfgrowlingwildfirecovelycanthropeadult bookstorewerewolf transformationwerewolf bitebloody scratchwerewolf packwerewolf family (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
Themes: | revengemurderdeathfeardeceptionpsychopathsurveillanceevilmurder of a police officer |
Mood: | goresatireslasher |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | teenage girlteenage boyserial killernursekillersecurity guardvillainpsychiatristslasher killercoroner |
Period: | 2000s |
Story: | sadistic psychopathstabbed in the headaxestrangulationfiresurprise endingfemale nuditybloodviolencesequelflashbacktwo word titlefightknife β¦chasecell phonecorpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo β¦u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
Subgenre: | independent filmmartial artsblack comedyexperimental filmsuspenseconspiracyabsurdismpunkrevenge plottech noir |
Themes: | panicbetrayalmurderrevengedeathsurrealismkidnappingrapetorturedrunkennessescapegangsterdeceptionmemorypsychopath β¦brutalitysupernatural powerterrorismsadismsurveillancehome invasionexploitationamnesiacourageself sacrificepolice brutalitypolice corruptionnear death experienceartificial intelligencerobotics (See All) |
Mood: | gorecar chaseavant garde |
Locations: | motorcycleforestbarbeachhelicopterairplanebuselevatorwoodswheelchairapartmentpolice cartruckrooftoprussia β¦strip clubbrothellaboratorycar motorcycle chaseairship (See All) |
Characters: | husband wife relationshippolicedoctortattooprostitutesoldierhostagetough guywarrioraction herobullysecurity guardsniperrussianpolice shootout β¦sniper riflepolice chaseself mutilationhomeless manbabe scientist (See All) |
Period: | near future |
Story: | left for deadstabbed in the headvanaxestrangulationshot in the headfiresurprise endingfemale nuditybare breastsbloodguncharacter name in titleviolenceflashback β¦dogbare chested malefemale rear nudityfightcigarette smokingexplosionknifechasepistoltopless female nuditycell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshotgunrescueslow motion scenepunched in the facecatwritten by directorbattleswordgunfightbrawlbare buttfalling from heightshowdownheld at gunpointhand to hand combatsunglassesbombcar crashinterrogationrobotorgyrevolvercombatstripperscientistshot in the backf wordsubjective cameradecapitationgood versus evilsurvivalfoot chasegay slurassassinambushterroristmassacredisguisemontagethroat slittingarmyimpalementcocainestabbed to deathmixed martial artsstabbed in the chesttied to a chairsubwayexploding carsevered headanti herodisarming someoneone man armyhit by a cardouble crossunderwater scenepolice officer killedfemme fataleshot in the legshot in the foreheadon the runpoint of viewparkattempted murderone against manydrug addictbeaten to deathdangerstabbed in the backperson on fireelectrocutionattackfantasy sequencefugitivecharacter's point of view camera shotevil manknocked outkicked in the facebaseball battankstreet shootoutshot in the shoulderlong takemanipulationbodyguardexploding bodyneck breakingpremarital sexcharacter says i love youmercenarydirectorial debutsevered armshot in the armsilencerobscene finger gesturedismembermentsubtitled scenecorrupt copstylized violencehenchmanak 47crime bossmachismouzihand grenadedestructionburned alivehead buttassassination attemptelectronic music scoremachetesociopathwalkie talkiemad scientistkicked in the stomachvillainesseccentricjumping from heightgrindhouserape victimfaked deathmind controllaserparking garagerock starrocket launcherrapistgun fucrushed to deathback from the deadmasked manbikergun battlecyborgthugrampagedamsel in distressshieldstealing a carbraveryfight to the deathhippiedual wieldstabbed in the throatinventormercilessnesschaosresurrectionmuteshot in the faceescape attemptcigarette lighterstabbed in the legexploding headpunched in the chestjumping through a windowgang rapeparachutemusical numbercommandoone dayeye gougingwedding ringbulletproof vestdisfigurementbody landing on a carknife throwingraised middle fingerstabbed in the eyefemale doctorcastrationbody countterrorist plotkilling spreeflamethrowerburned to deathwilhelm screamclonetelekinesisgatling gunshot multiple timesgrenade launcherbullet timemoscow russiatracking devicehit with a baseball batvodkamemory lossenglishman abroadtext messagingshot through a windowmarijuana jointabandoned buildingbazookablood on camera lensreference to elvis presleyterrorist groupfinal showdownstabbed in the handburied alivemolotov cocktailtaserspit in the facepistol whipstrongmanhead blown offscene before opening creditsarmored carsuper strengthparkourescalatorworld dominationmegalomaniacskyscraperstabbed in the armclimbing through a windowanarchycrash landingsawed off shotgunman kills a womanoffscreen killingcrashing through a windowwoman kills a mansex clubstabbed in the shoulderbullet woundfinal battledrive by shootingbritish soldierexperiment gone wronghigh techsome scenes in black and whitestabbed in the facegarbage truckcloningcut into piecesspitting bloodcockney accentcocaine snortingimprovised weapontommy gunshot through a doormurder spreefade to blacklifting person in airbreaking a bottle over someone's headheart in handknocked out with a gun buttarmoryhummerbilingualisminnocent person killedfreewaythrown from a carmotorcycle with a sidecarthroat cutwoman wearing black lingeriecryogenicsloss of memorythroat rippingdetonatorhit with a chairflame throwerreference to charlie chaplininvulnerabilityrescue attemptsong and dancebatteryshot through a wallbalisonghidden doorprosthetic limbbroken fingershaky camhand through chestsuper computervideo recordingsuper soldierlugerthrown through a windshieldalbinoescape podhit with a rockfirst personshipping containerover the topbroken backimplantprosthetic legsecret laboratorycamouflage uniformfighting in the airwater tankriding a busreference to darth vadertoy robotkilled by a propellerabandoned hotelcyberneticstaseredwalking in the woodsknife in handprosthetic armamnesiacshot through the floorstopped by policeclimbing up a buildingfighting with selfstabbed through the mouthfragmentation grenademil mi 8 hip helicopter50. caliber machine gundriver shotfiring guns from both handsghillie suitroof collapseevasionhanging from a ropechest ripped openclothes shoprobot hand (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | suiciderevengemurderdeathrapetorturepsychopathinsanityevilcannibalismrape and revenge |
Mood: | goreslasher |
Locations: | desertwaternew mexico |
Characters: | serial killervillainterrorslasher killer |
Period: | year 2007 |
Story: | sadistic psychopathstabbed in the headpsychoshot in the headfiresurprise endingfemale nuditybare breastsnuditysequelfightexplosionpistollickingcorpse β¦shot to deathblood splattershot in the chestremakefalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurstabbingarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplattermaniacropeclaim in titlemutantrageassaultaccidental deathbroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facedynamiteaccidental killingminebody countaxe murderkilling spreenude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitypsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
For the past 20 years, Frank Harrington has grudgingly driven his family to celebrate Christmas with his mother-in-law. This year, he takes a shortcut. It's the biggest mistake of his life: The nightmare begins. A mysterious woman in white wanders through the forest, leaving death in her wake. A ter β¦rifying black car - its driver invisible - carries the victims into the heart of the night. Every road sign points to a destination they never reach. The survivors succumb to panic, to madness; deeply buried secrets burst to the surface, and Christmas turns into a living hell. (Read More)
Subgenre: | black comedyghost storysupernatural horrorchristmas horror |
Themes: | panicdeathmarriagechristmaspregnancydysfunctional familybreak updeath of wifemadnessdeath of baby |
Mood: | night |
Locations: | carforestwoodscar driver |
Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabypregnant womancrying baby |
Story: | celebrationcabinsurprise endingfemale nuditybloodmasturbationfemale rear nuditycigarette smokingcar accidentshotgunsecrethallucinationgay slurdream sequenceshot in the leg β¦gunshotdeath of brotherdeath of sonmoonpornographysurvivormutilationloss of wifestrangervictimfull moonwhiskeymale masturbationloss of sonunfaithful wifelostchristmas evebody countloss of brothersurprise after end creditsdead girlbarbed wirefencereference to the beatlescabin in the woodsecstasybody bagdeath of boyfriendstation wagonshockin lawsslaptime loopchristmas carolman slaps a womanman slaps womansevered earmarital crisisdead babybaby carriagegay jokegrandparentsno cellphone signalmarital discordblood on mouthdrivemarital argumentmarital strifebarbed wire fencepotato chiproad signmale wearing an earringman in blackasleep at the wheelout of gasunfaithfulgoing in circlesjingle bellsreference to marilyn mansonfractured skulldark roaddestinationchristmas vacationfalse scarepumpkin piefalling asleep at the wheel (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie |
Themes: | revengemurderdeathkidnappingrapefeartorturevoyeurismseductionangerpsychopathbrutalityhumiliationsadismevil β¦exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
Mood: | goreslasher |
Locations: | lakecarforestnew york citychurchsmall townbathtubbicyclewatergas stationcountry |
Characters: | female protagonistgirlserial killerwriterkillerlustvillainserial murdererself justicesex with a stranger |
Period: | 1970s |
Story: | sadistic psychopathcabinaxefemale nuditybare breastsbloodgunmale nudityviolencefemale frontal nuditymale frontal nuditybare chested malefemale rear nudity β¦female full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurdererhandgunvigilantekillingrecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragemutilationdesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationbody countaxe murderbruisecharacters killed one by onekilling spreemisogynypsycho killerwoman in bathtubpervertserial murderpsychopathic killerkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
In the end of the Nineteenth Century, in London, Robert Angier, his beloved wife Julia McCullough and Alfred Borden are friends and assistants of a magician. When Julia accidentally dies during a performance, Robert blames Alfred for her death and they become enemies. Both become famous and rival ma β¦gicians, sabotaging the performance of the other on the stage. When Alfred performs a successful trick, Robert becomes obsessed trying to disclose the secret of his competitor with tragic consequences. (Read More)
Subgenre: | tragedysteampunk |
Themes: | panicbetrayalsuicidemurderrevengedeathfriendshiplovekidnappinginfidelityadulteryprisonpregnancydrinkingfear β¦drunkennessfuneraldeceptionmagicextramarital affairangerobsessiongriefunfaithfulnessrivalryexecutiontheatredeath of wifewilderness (See All) |
Mood: | rainambiguous ending |
Locations: | forestbarrestauranttrainhotelsnowcemeterysmall townlondon englandwaterwoodscourtroomstorm |
Characters: | friendhusband wife relationshippolicefather daughter relationshipbrother brother relationshipboygirlpolice officerpolicemanactorbabylawyerlittle girllittle boydaughter β¦chinesefatheramericanaunt nephew relationshipself inflicted injury (See All) |
Period: | 19th century1900s1890s |
Story: | bandageshovelsabotageaxefiresurprise endinggunbloodbased on novelflashbacktwo word titlebare chested malephotographtitle spoken by characterpistol β¦voice over narrationcorpseshot to deathhorseshot in the chestshotguncatdrinksecretfalling from heightlettershootingheld at gunpointbeerlingeriedead bodycafejailhandcuffsrevolvercandleold manmountaindisguisemontageprisonernonlinear timelinejudgetrialno opening creditsbirdcoffinvoice overgraveyarddrowninggunshotflash forwardtheaterargumentcostumechampagnelightninghangingdiarycourtdeath of brotherhairy chesttrapstagecharacter says i love youshot in the armtwinsacrificetrustapplauseropeentertainmentfireplacebulletkilling an animalrevelationcagefameperformancejail cellmagicianloss of loved onemorgueagentlossservantaudiencefaked deathtorchbroken legguardattorneysevered fingerthundermourninginventorbackstageimpostorpartnerwizardtheatre audiencemakeupevidencefogcanetied feetblind manlanternbroken armhorse and carriagecoinframed for murderteleportationmain character diesposterplaying cardsdoppelgangervictorian eraillusionstage showelectricitywifemagic trickburied alivenotebookgatetwist endingjournalseancetelling someone to shut upinventiontombstoneperformerwatchdouble barreled shotguncoloradotwin brotherdrunkardshow businesshusbandnewspaper articletavernassistantbusiness cardfinger cut offshot in the handhanged manchainedenglishmanentertaineranimal experimentationcarouseldead birdlimpin medias resblack catdeath by drowningtrapdoorhorse and wagoncockney accentsledgehammerdeath by gunshotfake moustacheflashback within a flashbackcasketfake accentlockdovetop hatarm slingcryptfalling through the floorflintlock pistoldoubleprotective malestagecoachmistlight bulbshacklestransportationdevotionhand injuryillusionistman wearing a wigoil lampbaby carriagebroken fingergallowsgeneratorheadstonehanged womanransackinghidden identitylimpingstopwatchtheatrical agentdualitystage magicianhand woundsame actor playing two characterslocksmithsolicitoractor playing dual roleelectric fencecanarymagician's assistantlightbulbcompetitorexecution by hangingmachinerydying repeatedlywater tankreference to thomas edisonlookalikesame actor playing two characters simultaneously on screenhuman duplicationpledgeartificial humancondemned to deathyear 1899duplicatepantaloonarm in a slingsleight of handencryptionhangman's noosecoin trickduplicationprotective fathershowmanfingers shot offholding someone's head underwateridentity swappingdoor keyfalling through a staircasestage actvoice over diaryelectrical generatorhansom cabparallel montageunderwater escapefake hangingshowmanshipfinger injuryroyal albert hall londonworkhousebookingbouncing a balluncertainty principlecolorado springs coloradoprestigerubber ballgymnastic ringscatching a bulletroyal albert hall (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
Themes: | suiciderevengedeathmurderkidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of motherinsanity β¦evilabductiontraumafear of water (See All) |
Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
Locations: | lakeforestcemeterysmall townpolice stationschool nurse |
Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | sadistic psychopathpsychocabinvanfiresurprise endingbloodcharacter name in titleviolencesequelflashbackphotographexplosionpartypistol β¦showervoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskcar crashdemondecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenedrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderersevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationsevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | cult filmslasher flickamerican horror |
Themes: | revengemurderdeathpsychopathabductionexploitation |
Mood: | goreslasherdarkness |
Locations: | lake |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boyserial killerkillervillainterrorslasher killerserial murdererlow self esteemmysterious killer |
Period: | 1980s |
Story: | sadistic psychopathpsychocabinaxebloodsexnuditynumber in titlesequelshowerdigit in titlebikinimasknumbered sequelsubjective camera β¦impalementthird partcharacter's point of view camera shotevil manmurderersevered armdismembermentsplattermaniacmass murdermachetelifting someone into the airragebarnroman numeral in titlesevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killerpsycho killertorso cut in halfserial murderpsychopathic killerbad guycar troublemadmandefecationhuman monstersexual violencehomicidal maniacslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitypsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
Mort Rainey is a successful writer going through a rather unfriendly divorce from his wife of ten years, Amy. Alone and bitter in his cabin, he continues to work on his writing when a stranger named John Shooter shows up on his doorstep, claiming Rainey stole his story. Mort says he can prove the st β¦ory belongs to him and not Shooter, but while Mort digs around for the magazine which published the story in question years ago, things begin to happen around Shooter. Mort's dog dies, people begin to die, and his divorce proceedings with Amy continue to get uglier. It seems that Shooter has Mort over a barrel, but perhaps Mort has his own ideas on how to resolve all the problems that plague him lately. (Read More)
Subgenre: | cult filmpsycho thriller |
Themes: | panicdeathmurderinfidelityjealousyadulterydrinkingfeardrunkennessinvestigationmemoryextramarital affairangerdivorcetheft β¦paranoiainsanityunfaithfulnessmental illnessjusticeclaustrophobia (See All) |
Mood: | gorenightmare |
Locations: | lakerestaurantsnowsmall townwoodspolice stationpolice carmotelgas stationsuvcar in water |
Characters: | husband wife relationshippoliceboyfriend girlfriend relationshipdetectivepolicemanwriterthiefmaidsheriffex husband ex wife relationshiptalking to oneself in a mirrorself doubtself reflection |
Period: | winter |
Story: | stabbed in the headshovelcabinaxefiresurprise endingbloodgunbased on novelflashbackdogbare chested malefightcigarette smokingtitle spoken by character β¦pistoltelephone callvoice over narrationcryingdreamcorpseunderwearblood splattermirrorpunched in the facecomputerdrinkfalling from heightletterbookvomitingheld at gunpointtearsdead bodycafehallucinationrevolverdecapitationflashlightstabbingdinerman with glassesflash forwardauthorstalkerkeyproduct placementkicked in the facescreamactor shares first name with characterthreatisolationratsuspicioncheating wifearsonprivate detectiveeyeglassesfireplacedestructionkilling an animalrevelationmass murderfaintinghatmousemagazineassaultpsychologywristwatchtimestrangerburialschizophreniawhiskeyloss of sonstabbed in the throatunfaithful wifepet dogconvenience storetitle appears in writingheadphonesnovelistdelusionscissorsstabbed in the legevidencecliffnotebruisemarital problemseparationprivate investigatorsouthern accentlaptop computerdead dogfiremanintimidationvillain played by lead actorconfusioninvestigatornotebookmolotov cocktailhit in the facedead animalkilling a dogmental breakdownmetaphorinspirationsexual tensiondisposing of a dead bodywatchanimal crueltysquirrelbroken mirrorcottagesplit personalityhearing voicestennesseecabin in the woodscreativitybathrobewriter's blockcleaning ladysleeping in a carsole black character dies clichemacabremanuscripthit with a shovelcadillacrepeated linepost officedigging a gravereference to john waynehusband murders wifecornbreaking a mirrorfinger gunmississippihatchetsleeping on a couchthrown from a carplagiarismshort storytalking to oneselfmultiple personalitypaddlescrewdriverwriting on a walltimerfire enginebreakdownhit with a rockbracesnew york statebased on the works of stephen kinginsurance companydestruction of propertyseclusionlake houseinsurance investigatorhit on the head with a rockliterary agentmysterious eventupstate new yorkloss of petparcelreservoirfire pokerhickstory within a storyarthritisjack danielsmystery writercorn on the cobdelivery truckpounding on a doorrock thrown through a windowburying a dead dogisolatedreclusivenesscar goes over a cliffdestroying a roomburnt down houseslinkyupslunch counterpet doorneedlepointcattle dogincriminationpage torn from book (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | friendshipmurderdeathsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | gorenightmarecar chasenightslasherdarknessblood and gore |
Locations: | foresthospitalbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | friendfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend β¦killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | sadistic psychopathpsychovanaxeshot in the headsurprise endingfemale nuditybare breastsbloodgunf ratedviolencefemale frontal nudityflashback β¦masturbationdogcigarette smokingphotographknifelesbian kisschaseshowertelephone calldreamcorpseblood splattercar accidentmirrorurinationshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedmassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femaleon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachsevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends β¦ must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)
Subgenre: | cult filmsupernaturalsupernatural horrorcult horror |
Themes: | panicmurderdeathfriendshipghostfearinvestigationvoyeurismsupernatural powerparanoiaevilsupernatural beingsupernatural rape |
Mood: | rainhigh schoolambiguous ending |
Locations: | lakecarforesthospitalbeachschoolswimming poolboatbicyclewaterwheelchairpolice carsex in carsex in hospital |
Characters: | friendteenagerteenage girlprostituteteenage boyfemale protagonistsister sister relationshipneighbor neighbor relationshipsex with a strangersupernatural killer |
Story: | group of friendsshot in the headbare breastsbloodsexviolencefemale frontal nuditymale frontal nuditymale rear nuditytwo word titlebare chested malesex scenekissfemale rear nudity β¦photographmale full frontal nuditychasepantiespistoltopless female nuditycorpseshot to deathblood splatterurinationwatching tvwritten by directorbikinibookcar crashlow budget filmcafebathroomneighbordemonvoyeurclassroommale pubic hairf wordsubjective camerafoot chasebedroomflashlightbanddeath of friendhousetied to a chairwhite pantiesunderwater scenesearchshot in the legold womanpublic nuditycursedangersuburbelectrocutionknocked outcollege studentlightningstalkingautomobilethreatdatelove interestteenage sexcard gamegameelectronic music scorelooking at oneself in a mirrorsexual attractionmovie theaterpooldesperationflatulenceswimsuitstrangervictimteenage protagonistpeeping tombroken leggirl with glassesvisiontarget practiceplaygroundthunderstormboyfriendswingtied feetlooking at self in mirrorbroken armliving roomneighborhoodchloroformbeing followedabandoned buildingsuffocationgirl in bra and pantiesinvisibilityporn magazineapparitionshot in the neckhead wounddetroit michiganreading aloudabandoned housebroken windowhospital bedswimming underwaterbreaking a windowhallwaycowgirl sex positionshot in the handfrightmenaceshape shiftertied up while barefoottalking about sexpsychotronic filmscaregrindhouse filmyoung adultoverhead shotsexual intercoursehit with a chairrunning for your lifefalse nameentityhead bandageloss of innocencetarget shootinggirl next doorsexually transmitted diseasemidnight movieporchnipple sliparm castindoor swimming poolwashing a carincest subtextconsequenceshape shiftingmotor boatsleep overmysterious personcollateral damagefootstepsguessing gamebare breastnear drowninghigh school yearbookneo 80schevrolet impalaopening creditstimelessnessdemonic presencesex horrordead woman on a beachdemonic entityelectric typewriterhorror movielounging on a beachtied to a wheelchair (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β¦ end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | independent filmcult filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
Themes: | murdersurrealismghostdancemonstermemorytime travelsadismbook of evil |
Mood: | gorenightmareavant garde |
Locations: | forestairplanewoodskitchencastlestormbackwoods |
Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation |
Period: | 1980s1990s20th centuryyear 1987 |
Story: | shovelcabinbasementaxesurprise endingbloodsexnumber in titleviolencesequelkisschasethree word titlepantiesvoice over narration β¦songunderwearblood splattermirrorshotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianodemonhallucinationdecapitationgood versus evilstabbingstabbed in the chestsevered headanti herotreecursestabbed in the backpossessionskeletonhauntingratsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu β¦rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)
Subgenre: | black comedysuspense |
Themes: | panicbetrayalmurderfriendshipdeathrevengekidnappingjealousydrinkingescapeinvestigationvoyeurismpsychopathdeath of fatherparanoia β¦photographymurder of a police officer (See All) |
Mood: | neo noirhigh schoolslasher |
Locations: | carswimming poolbicyclepolice carcourtroomrooftopstormfishing boat |
Characters: | friendfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipboyteenage boyteacherserial killerstudentpolicemandancerwriter β¦police detectivevillainterrorcousin cousin relationship (See All) |
Story: | shovelpsychobasementgunbloodviolenceone word titledogkissfightdancingtitle spoken by characterpartyknifechase β¦telephone callcell phonecorpseblood splatterfoodcar accidentpunched in the facewatching tvcomputerdrinkarrestbikinibookplace name in titlerunningdead bodybathroomneighborhandcuffsvoyeurclassroomswimmingnewspapervideo camerawomaneatingimpalementstabbed to deathstabbed in the chestjudgesevered headtrialfishingduelflash forwardbinocularssuburbmissing personevil manreadingrabbitbaseball batlightningskeletonpranklong takescarwighigh school studentstalkingwitnessneck breakinggardenclassobscene finger gesturesubtitled scenegaragemaniacflirtingtv newsteen angstbreaking and enteringlistening to musicsociopathcaptiveassaultskullparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassscissorsstabbed in the legyoung lovedeerduct tapeextortioncellarkilling spreereckless drivingchocolatexboxpsychopathic killerbad guyearphonesmadmanboredomclosetlaundryhuman monsterhomicidal maniaccoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomcurtainfictional cityfordhardware storetv hostlawn mowerchevroletsnorricamwatching someoneipoddishwashermissing womanpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized β¦ city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
Subgenre: | martial artsblack comedysuspensepunk |
Themes: | panicbetrayalrevengemurderdeathkidnappinglesbianismfeartorturedrunkennessescapeinvestigationdeceptionseductionbrutality β¦paranoiasadismhome invasion (See All) |
Mood: | goreneo noircar chase |
Locations: | motorcyclebarrestauranttrainhotelsnowairplaneparis francebathtubnightclublondon englandwatertaxiairportelevator β¦apartmentpolice carrooftoptunneltrain stationcar firecar in watercar into waterescape from a car in water (See All) |
Characters: | husband wife relationshippolicefather daughter relationshipmother daughter relationshiptattoofemale protagonistsoldierpolice officerhostagehitmansniperrussiangermanamerican abroadpolice shootout β¦sniper riflepolice chasecoroneramerican in the uk (See All) |
Period: | 1980syear 1989 |
Story: | strangled to deathstabbed in the headvanstrangulationshot in the headfiresurprise endingfemale nuditybare breastsgunbloodf ratedbased on novelmale nudity β¦violenceflashbacktwo word titlebare chested malesex scenefemale rear nudityfightcigarette smokingphotographexplosionpartyknifelesbian kisschasepistoltopless female nudityvoice over narrationshootouthigh heelsbeatingcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestblonderescueslow motion scenepunched in the facecameragunfightbrawlfalling from heightbased on comicshowdownheld at gunpointbeerhand to hand combatsunglassesbedcar crashdead bodyinterrogationbritishcolor in titlerevolverfightingtelephonekung fushot in the backf wordspybisexualsurvivalfoot chasebraassassinbased on comic bookambushmassacredisguisewomanmontagethroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestnonlinear timelineexploding carman with glassesradiodisarming someonehit by a cardouble crossbathunderwater scenepolice officer killedfemme fatalenews reportshot in the legdrowningshot in the foreheadbartenderlatex gloveson the rungunshotflash forwardattempted murderone against manystalkerhotel roombinocularscharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuekarateprotestattackpay phoneumbrellamissionundercoverproduct placementrace against timecover upknocked outkicked in the facetough girlopening action scenelong takemanipulationscarwigstalkingneck breakingpremarital sexsuspicionthreatened with a knifeprofanityhandgunsecret agentsilencerlove interestespionageciasubtitled scenekillingarsonstylized violencehenchmanberlin germanyriotcold waritalianiceropetraitorfalling down stairsbulletrevelationhead buttassassination attemptelectronic music scorewoundheavy rainscene during opening creditstold in flashbackbeardmorguekicked in the stomachcaucasianmovie theatereccentricwristwatchphone boothjumping from heightcovered in bloodbuttskateboardstrong female leadfollowing someoneaction heroinefemale killerfemale warriorpassportthugstealing a carblood on facefight to the deathintrigueresistancestabbed in the throathit in the crotchmercilessnessshot in the faceevacuationescape attemptblack bracigarette lightertime lapse photographystabbed in the legpunched in the chestassault rifleaerial shotblack eyeknife fightblood on shirtundercover agentbody landing on a carknife throwinggasolinepolice raiddressing roombruisewilhelm screamswearingstick fightroundhouse kickfast motion scenevodkafemale assassinenglishman abroadbisexual womanblood on camera lenscia agentporn magazinehistorical fictionalleyfinal showdownset uppistol whipscene before opening creditssuit and tieblonde womanarms dealerwatchstabbed in the armfemale spybearded manshot in the eyefilm starts with textcigarettebased on graphic novelstrong languageman kills a womangun violencekgbmacguffinraveski maskwoman kills a manaudio cassettejudocar set on fireshot in the throatmetal detectortwo way mirrorgraphic violencelighting a cigaretteoverturning carberlin wallrogue agentstabbed in the facespy herowoman fights a manmagnifying glassbloody violencedeath by drowningfrenchmanpool of bloodsecret policeone woman armyimprovised weaponcar rolloverfreedom fighterresistance fighterabandoned warehouserookieanti heroineassassination plotbreaking a bottle over someone's headdouble agentknocked out with a gun buttwalkmanwiretappingbilingualismhidden gunslow motion action scenecassette tapeenglishwoman abroadwoman punches a mangarrotecrushed by a carman fights a womanbrass knucklesblond hairdefectorman punches a womanbatonblood on handsborder guardfrenchwomanbritish secret serviceaudio recordingstabbed in the foreheadbritish intelligencewearing a sound wireneonlistcode nameneon lightmicrofilmfake passportstasiforgerc wordstolen police carsmoking a cigarettesex on bedknife in chestrussian spymi6stabman with a ponytailghetto blastercar falls into waterdrownedtough womancivil unrestdrownlighting a cigarette for a womaneast berlinkgb agentice bathphotographic memorytrapped underwaterphoto labwearing a wirewatchmakerhand in pantieswest berlincounter espionageeurospylesbian sex scenetelevision news reportcar falling into waterreference to david hasselhoffgarrotteoni presssubmerged in car (See All) |
In an America wracked by crime and overcrowded prisons, the government has sanctioned an annual 12-hour period in which any and all criminal activity-including murder-becomes legal. The police can't be called. Hospitals suspend help. It's one night when the citizenry regulates itself without thought β¦ of punishment. On this night plagued by violence and an epidemic of crime, one family wrestles with the decision of who they will become when a stranger comes knocking. When an intruder breaks into James Sandin's (Ethan Hawke) gated community during the yearly lockdown, he begins a sequence of events that threatens to tear a family apart. Now, it is up to James, his wife, Mary (Lena Headey), and their kids to make it through the night without turning into the monsters from whom they hide. (Read More)
Subgenre: | suspensedystopiapsycho thrillersurvival horror |
Themes: | betrayalmurderdeathrevengefeartorturedeceptionpsychopathdeath of fathersurveillancehome invasion |
Mood: | satireneo noirslasherone night |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiphomeless manneighbor neighbor relationship |
Period: | 2020s |
Story: | left for deadshot in the stomachbasementaxeshot in the headsurprise endingbloodviolencetitle spoken by characterknifepistolcell phoneshootoutbeatingcorpse β¦shot to deathblood splattermachine gunshot in the chestshotgunrescuewritten by directorheld at gunpointinterrogationneighborrevolvershot in the backf wordsurvivalflashlightbound and gaggedmansiondeath of friendstabbed to deathstabbed in the chesttied to a chairchild in perildouble crossnews reportshot in the legattempted murdercharacter repeating someone else's dialoguebeaten to deathstabbed in the backsuburbstalkingthreatdeath of husbanddie hard scenariocharacter says i love youfirst partclass differencesmachetescene during opening creditssecurity camerastabbed in the stomachnosebleedsocial commentaryclockmasked manmoralityduct tape over mouthpower outagepool tabletitle appears in writingstabbed in the legjumping through a windowone dayschoolgirl uniformfamily dinnerlens flareaxe murderkilling spreemoral dilemmamedia coveragehit with a baseball batblood on camera lenshiding in a closetminimal castself defense18 year oldfilm starts with textupper classdeath of boyfriendfilmed killingbroken nosehiding under a bedtormenttreadmillsocial decaycat and mousechild with a gundog tagsecurity systemfamily in dangersingle set productionmasked womanremote controlled toy cartooth knocked outcontainmentemergency broadcast systemmasked intruderhit with a pool cueunder the bed (See All) |
Ray Ferrier (Cruise) is a divorced dockworker and less-than-perfect father. When his ex-wife and her new husband drop off his teenage son Robbie and young daughter Rachel for a rare weekend visit, a strange and powerful lightning storm suddenly touches down. What follows is the extraordinary battle β¦for the future of humankind through the eyes of one American family fighting to survive it in this contemporary retelling of H.G. Wells seminal classic sci-fi thriller. (Read More)
Subgenre: | cult filmsuspensedisaster film |
Themes: | panicbetrayalmurderdeathkidnappingpregnancyfeartorturedrunkennessescapemonsterdeceptionmilitarydivorcebrutality β¦abductiondyingapocalypsenear death experiencealien abduction (See All) |
Mood: | gorerain |
Locations: | new york cityrestauranttrainchurchhelicopterlos angeles californiaparis francelondon englandbicycleaustraliashiptruckbaseballouter spacestorm β¦usatunnelsuvcar in water (See All) |
Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipsingerbrother brother relationshipbrother sister relationshipteenage boygirlsoldieralienpoliceman β¦hostagelittle girljapaneseex husband ex wife relationshipsingle fathership captainmother in law son in law relationshipairplane stewardess (See All) |
Period: | 2000s |
Story: | shovelbasementvanaxefiresurprise endingbloodgunviolencefightphotographexplosionsingingpistoltelephone call β¦voice over narrationcryingcell phonesongcorpseblood splatterfoodmachine guncar accidentmirrorremakeshotgunrescuewatching tvbattlerifletearsdead bodycaferivercombatreportergood versus evilsurvivalflashlightambushmassacrevideo camerabridgeeatingfour word titlesubwaybirdchild in perilfictional warspaceshipunderwater scenecreaturedrowningbeaten to deathdangerscreamingelectrocutionstatuelightningtanklong takeamerican flagcrossexploding bodyratblindfoldsleepingrefugeeeuropeufobattlefieldriotpickup truckdisastertv newsundergroundhand grenadegrenadedestructionjeepcagesurvivorrome italyworking classexploding buildingblockbusterdesperationmobskateboardrocket launcherearthquakealien invasionremote controltensionstealing a carinvasionnew jerseyu.s. armyboston massachusettsmercilessnesschaoshungerevacuationescape attemptsunairplane crashcellarferryneighborhoodreckless drivingasiabazookaearphonesextraterrestrialelectricitycartoon on tvmachineplane crashbroken windowdiggingtv reportertraffic jamcredit cardtentacleauto mechanicsouth americacarjackingalien contactallergypatriot10 year oldmass gravepsychotronic filmu.s. air forceathens greecealien creaturealien racecruiserefugee campdriver's licenseextinctionalgeriapower failurehuman versus alienauto theftfreezingipodhiroshima japanartillerymass destructionpeanut butterlullabybacteriamini vanmass deathsinking shipbridge collapsealien attackelectro magnetic pulsehumanity in perilplaying catchreflection in waterdestroyed cityblood donationjurassic parkhiding under a tableplane wrecksolar flaremilitary convoyrunaway trainsmashing a windowcar enginedeath rayunidentified flying objectcosmic zoomfalling overboardopening creditscapsized boatstalled cardead body floating in a riveru.s. national guardcapsizing shipexploding persontv news crewwoman disintegrateddisintegrating body (See All) |
Set against the backdrop of 1977 Los Angeles, The Nice Guys opens when single father and licensed PI Holland March (Gosling) is hired to investigate the apparent suicide of famous porn star Misty Mountains. As the trail leads him to track down a girl named Amelia (Qualley), he encounters less licens β¦ed and less hands-off private eye Jackson Healey (Russell Crowe) and his brass knuckles, both hired by the young hippie. However, the situation takes a turn for the worse when Amelia vanishes and it becomes apparent that March wasn't the only party interested. As both men are forced to team up, they'll have to take on a world filled with eccentric goons, strippers dressed as mermaids and even a possible government conspiracy. (Read More)
Subgenre: | black comedyexperimental filmconspiracyslapstick comedybuddy comedycorporate conspiracy |
Themes: | panicbetrayalsuiciderevengefriendshipdeathmurderchristmasmoneypoliticsfeartorturedrunkennessescapeinvestigation β¦deceptioncorruptionpsychopathbrutalityparanoiadysfunctional familyredemptionsadismhome invasionalcoholismcouragenear death experienceunlikely hero (See All) |
Mood: | neo noircar chase |
Locations: | motorcycleforesthospitalbarswimming poolhotelairplanelos angeles californiabathtubtaxiairportelevatorwoodswheelchairurban setting β¦apartmentpolice cargas stationcar explosionfire truckcar fire (See All) |
Characters: | policefather daughter relationshipteenagermother daughter relationshipafrican americanteenage girldetectivedancerhostagelawyertough guywarrioraction herohitmanalcoholic β¦secretarydaughtersingle fathermermaidgo go dancerself inflicted gunshot wound (See All) |
Period: | 1970s20th centuryyear 1977 |
Story: | left for deadstrangled to deathvanstrangulationshot in the headfiresurprise endingfemale nuditybare breastsbloodnudityviolencefemale frontal nudityflashbackdog β¦bare chested malefemale rear nudityfightfemale full frontal nuditycigarette smokingdancingtitle spoken by characterexplosionpartyknifelesbian kisschasethree word titlepistoltopless female nudityvoice over narrationshootouthigh heelsbeatingdreamcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshotgunrescuepunched in the facewatching tvwritten by directorarrestgunfightbrawlbare buttfalling from heightshowdownheld at gunpointsunglassesbirthdaycar crashinterrogationhallucinationreference to jesus christrevolverstrippertelephonef wordfoot chasegay slurassassinambushcaliforniaambulancemansiondinertoiletfishexploding carman with glassesnundream sequenceanti herodisarming someonechild in perilhit by a cardouble crossbirthday partyunderwater scenefemme fatalenews reportcigar smokingshot in the legcoffeeshot in the foreheadbartenderracial sluron the runflash forwardskinny dippingattempted murderlimousinecharacter repeating someone else's dialoguebeaten to deathdangerprologueprotestwidowerelectrocutionfantasy sequencepay phoneundercovermistaken identityrace against timesuitcasemissing personcover upknocked outkicked in the facechristmas treebaseball batstreet shootoutshot in the shoulderbodyguardexploding bodyautomobilewitnesssuspicionthreatened with a knifeprofanityshot in the armhandgunsilencernewspaper headlinesingle parentstrong female characterhenchmanprivate detectiveak 47machismopornographyshavingfalling down stairspot smokinghand grenadegrenaderevelationassassination attemptreference to adolf hitlersociopathscene during opening creditswalkie talkieoverallshollywood californiakicked in the stomachnosebleedphone boothjumping from heightfollowing someonesocial commentarygas maskthugstupiditybarefootcrime scenepump action shotgundamsel in distressreverse footageswitchbladestealing a carbraverycynicismhippiedual wieldmercilessnessporn starfalling to deathtitle appears in writingaquariumcigarette lighterpunched in the chestjumping through a windowthrown through a windowbooby traphot tubaerial shotwisecrack humorpollutionfilm producerdisfigurementbody landing on a carmustachenotebowlingbroken armethnic slurmisogynysports carmoral dilemmaprivate investigatorshot through a windowmarijuana jointmale objectificationbriberyporn magazinemagic trickbreak inex cophiding in a closetcar drivingpistol whipexotic dancerblonde womanporn industrytwo man armyquick drawdisposing of a dead bodyfilm projectorfish tankwhodunitbuddy copfemale lawyerhired killerurban decay13 year oldcostume partyvaletporn actressdistrict attorneyassistantbowling alleyreluctant herofall from heightone linerbusiness cardman kills a womanoffscreen killingpornographerhollywood signmacguffinsense of smellbreaking a windowpalm treecorrupt politicianaltered version of studio logoprosecutorashesmercedes benzfight the systemdrive by shootingcontract killerdecadencereading a newspapercorrupt officialtragic pastdistrustradio newsmale in bathtubtommy gunprivate eyereference to richard nixonhedonismsocial decaychild with gunarm slingunicorngovernment conspiracybody paintcourthouseprotestorcard trickhidden gunchild swearingchild with a gunjumping out a windowdiscovering a dead bodycorporate crimegovernment corruptionhit with a chairbuddy moviecut armenglishwomanporn actorperson in a car trunkfemale objectificationpenthousebrass knucklesprojectionistfilicidefilm reelpeep showreference to sherlock holmeslugerwoman hits a manbowling ballprotest signenforcerafrohit with a car doorfalling into a swimming poolarm castchild driving a carfalling down a hillfalling off a balconydefenestrationmother daughter estrangementnewspaper adreference to wonder womanman murders a womancollateral damagehiding in a car trunkkiller beeporno shopsuburbiaeating an appleporno filmtwenty dollar billyellow dresscorporate corruptionhit by a vanwearing clothes in a bathtubcar crashing into a treerolling down a hillsucker punchdyefalling through a glass roofsmogfalling on a carfilm canisterwriting on handcar showfifty dollar billhome aquariumautomobile industryauto showdye packburnt down housecut throatmermaid costumeburbank californiafiring guns from both handsreference to pocahontasu.s. department of justiceunderage driverarm breakingin bathtub with clothes onself driving carfalling asleep while drivingman in a bathtubrolling downhillblue paintenvelope of moneyplaying solitairechekhov's gunfemale prosecutorgiant bee (See All) |
Jordan Turner ('Halle Berry' (qv)) is an experienced 911 operator but when she makes an error in judgment and a call ends badly, Jordan is rattled and unsure if she can continue, but then teenager Casey Welson ('Abigail Breslin (I)' (qv)) is abducted and calls 911. Jordan is the one called upon to u β¦se all of her experience, insights and quick thinking to try to help Casey escape and also to make sure the man is brought to justice. (Read More)
Subgenre: | suspense |
Themes: | panicrevengemurderdeathkidnappingfearguilt |
Mood: | gore |
Locations: | carhelicoptertunnelpolice helicopter |
Characters: | policefemale protagonistpoliceman |
Story: | left for deadshovelpsychobloodf ratedtwo word titlecell phoneblood splatterpunched in the facewomanperson on fireamerican flagdie hard scenariobreaking and enteringdriving a car β¦shopping mallblack eyechloroformstolen carbreak inmallfemale herochainedhit with a shovelmusic boxhiding under a bedoverhead camera shotman on fireimmolationtear on cheekzippo lightercutting hairstabbed multiple timesincest overtonesscrewdriverextreme closeuphitting a womanscalpingwashing hairtoyotanight cityscapeman carrying a womanperson in car trunkblack herocar trunkdodgepixilated nudityeurocopter as350 squirrelhead held underwaternitrous oxideflag polestabbed with a screwdriverlincoln automobilelincoln town carleft to diedodge chargerstolen vehicleamber alertpumping gascalling 911recapturecamera shot from inside car trunkcan of paintpolice incompetencestolen license plateemployee supervisor relationshippolice pursuitwhite villain (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | independent filmblack comedysuspensepsycho thrillerslasher flickpsychological thrillerholiday horrorchristmas horror |
Themes: | panicbetrayaldeathrevengemurderkidnappinginfidelitychristmasfeardrunkennessescapeinvestigationdeceptionlonelinesspsychopath β¦obsessionparanoiainsanitymental illnesssurveillanceabductioncrueltymadnessnear death experience (See All) |
Mood: | goreneo noircar chaseslasherdarknessone night |
Locations: | carnew york citysnowwatertaxielevatorurban settingpolice carcityoffice |
Characters: | policefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectiveslasher killermysterious villain |
Period: | winter |
Story: | stabbed in the headaxestrangulationfiresurprise endingbloodnumber in titleviolenceone word titledogfightexplosionpartyknifechase β¦telephone callcryingcell phonehigh heelsbeatingcorpsedigit in titleblood splatterfistfightcar accidentmirrorpunched in the facebrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasenewspaperflashlightbound and gaggedwinevideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backscreamingperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootwoman in jeopardydamsel in distresstensionfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com β¦plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensestop motion animationcreature featureteen romancebody horror |
Themes: | panicfriendshipmurderdeathfeardrunkennessescapemonsterdeceptionmilitaryparanoiaredemptioncourageself sacrificenear death experience β¦unlikely hero (See All) |
Mood: | gorehigh schoolpoetic justiceone nighthorror movie remake |
Locations: | motorcyclecarforesthospitalchurchhelicoptersnowcemeterysmall townwoodskitchenpolice stationpolice carouter spacesewer β¦car motorcycle chasemotorcycle chasetruck accident (See All) |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girlteenage boysoldier β¦nursepriesttough guywaitressvillainbiblesheriffself mutilationhomeless manbiologistalcoholic drink (See All) |
Period: | 1980s |
Story: | vanaxefiresurprise endingbloodgunviolencedogcigarette smokingexplosionchasepistolcorpseblood splattermachine gun β¦car accidentremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverscientistdecapitationsurvivalorphanflashlightambushambulancedeath of friendbridgefootballdinermapexploding carfalse accusationsevered headanti herodisarming someonechild in perilhit by a carcreaturepolice officer killednecklacetransformationdangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderfilm within a filmexploding bodydateratsevered armdismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachercrushed to deathsocial commentarybikereaten alivefemale warriormechanicrampagereverse footageexplosivebraveryu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiummutationjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage loveurban legendfirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemexperiment gone wrongmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stuntjumping from a carhazmat suitmotorcycle crashprojectionistyo yosinkmass deathbiohazardjarpart stop motionfreeze to deathbiological warfaregeiger counterblobmanholetown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerchild eatenface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikecrash siteevil preachertoilet plungerteen heroteen couple eaten (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | independent filmsuspensesupernaturalpost apocalypsesurvival horrorzombie apocalypsedisaster film |
Themes: | panicsuiciderevengemurderdeathfeardrunkennessescapedeceptionbrutalitysupernatural powerparanoiainsanitysurveillancehome invasion β¦apocalypsecannibalismnear death experience (See All) |
Mood: | gorebehind the scenesnightmareambiguous ending |
Locations: | forestbartraincemeteryairplaneairportwoodskitchenapartmentcampfiretunnelschool teachercar bombnew englandcar fire β¦train driver (See All) |
Characters: | father son relationshipmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteacherzombiepolice officerstudentartistsecurity guardteacher student relationship |
Period: | 2010s |
Story: | shovelaxeshot in the headfiresurprise endingbloodbased on novelviolenceone word titledogfightcigarette smokingdancingtitle spoken by character β¦explosionpartyknifechasepistolbased on bookcell phonebeatingdreamcorpseshot to deathblood splattershot in the chestshotgunrescueslow motion scenecatswordbrawlfalling from heightshowdownrifleheld at gunpointbombshot in the backsurvivalfoot chaseflashlightambushmontageimpalementstabbed to deathdinertoiletstabbed in the chestsubwayexploding cardisarming someonedrawingchild in perilhit by a cardouble crosssearchtransformationshot in the foreheadbartenderattempted murderbeaten to deathdangerscreamingkeyperson on fireattackfantasy sequencepay phoneon the roadbaseball batexploding bodyundeaddisasterfireplacebow and arrowburned aliverevelationmachetelistening to musicscene during opening creditssurvivormutantviruscooksecurity cameracaught having sexeccentriccovered in bloodmind controlend of the worldburialeaten alivebarefootmobile phonedual wielditalian americanboston massachusettscannibalchaosstabbed in the legairplane crashaccidental killingaerial shotatticblood on shirtdisfigurementrefrigeratorgasolineaxe murdermutationburned to deathsmokesurprise after end creditshit with a baseball batenglishman abroadtext messagingdjmysterious manliving deadvietnam veteranfinal showdownbag over headhiding in a closetconstruction workervomitepidemictowerworld dominationabandoned housejukeboxmegalomaniacinsomniaanarchyexploding truckdamman kills a womansuicide bomberwoman kills a manburnt bodymetal detectortitle same as bookmatricidecrowbarpool of bloodmainehoodiemass gravepsychotronic filmimprovised weaponexploding airplanehusband murders wifeman hits a womangrindhouse filmvietnam war veteransausageice cream truckdoomsdayhooded figurec4 explosivesscreenplay adapted by authorset on fireconspiracy theoristtaxidermyabandoned cartire ironairport securitybased on the works of stephen kingelectromagnetic pulsehusband wife estrangementmass deathstrapped to a bombthrown from heighttennis ballfoaming at the mouthdrive in theaterwoman murders a manshared dreamsignalabandoned apartmentaxe in the chesthordehooded sweatshirtinsomniacabandoned cityexplosives expertabandoned schoolprep schoolterminalwhiskysoccer fieldcontrol towerfalse endingcell phone detonatorsuicide vestmysterious figure (See All) |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
Subgenre: | american horror |
Themes: | revengemurderfriendshipdeathkidnappingrapetorturepsychopathbrutalityguiltsadismcrueltyvengeancemurder of a police officer |
Mood: | goreslasherhorror movie remake |
Locations: | lakecarforestboatwoodskitchenmotelstorm |
Characters: | friendhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipteenage girlserial killerhostagekillerterrorserial murderer |
Story: | stabbed in the headstrangulationshot in the headfemale nuditybloodviolencefemale frontal nuditybare chested malefemale rear nuditychasepantiespistolshowercell phone β¦beatingcorpseblood splattercar accidentshot in the chestremakepunched in the facemaskheld at gunpointcar crashshot in the backswimmingcleavagefoot chasebound and gaggedwinedeath of friendstabbed to deathstabbed in the chestwhite pantiesscantily clad femalenecklaceon the runstabbed in the backliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonmurdererthreatened with a knifegirl in pantiesmaniacfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusrape victimrapistfemale killerwoman in jeopardystealing a carfight to the deathpunched in the stomachgunshot woundexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationpsycho killermarijuana jointpsychopathic killergirl in bra and pantiesmadmanparalysisviolence against womenshot in the neckhead woundmisogynisthuman monsterremorsefemale friendshipsexual violencehomicidal maniac17 year oldescaped convictshot in the eyenihilismheld captivesummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerfemale serial killerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All) |
Alone among assassins, Jack is a master craftsman. When a job in Sweden ends more harshly than expected for this American abroad, he vows to his contact Pavel that his next assignment will be his last. Jack reports to the Italian countryside, where he holes up in a small town and relishes being away β¦ from death for a spell. The assignment, as specified by a Belgian woman, Mathilde, is in the offing as a weapon is constructed. Surprising himself, Jack seeks out the friendship of local priest Father Benedetto and pursues romance with local woman Clara. But by stepping out of the shadows, Jack may be tempting fate. (Read More)
Subgenre: | independent filmcult filmsuspense |
Themes: | betrayalfriendshiprevengedeathmurderlovemoneydeceptionlonelinesstheftparanoiaredemptionguiltunrequited loveexecution |
Mood: | neo noirnightmareavant gardeambiguous ending |
Locations: | lakemotorcycleforestbarrestauranttrainhotelsnowcemeterysmall townvillagewoodsitalygas stationbrothel β¦train stationcar motorcycle chaselog cabin (See All) |
Characters: | father son relationshipboyfriend girlfriend relationshiptattooprostitutepriesttough guyhitmansniperamerican abroadsniper riflesex with prostitute |
Period: | winter |
Story: | shot in the stomachsabotageshot in the headsurprise endingfemale nuditygunbloodcharacter name in titlebased on novelnuditymale nudityviolencefemale frontal nudityflashback β¦male rear nuditytwo word titlebare chested malesex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterknifechasepistolshowertelephone callcell phoneshootoutcorpseshot to deathblood splattercar accidentshot in the chestwatching tvcameragunfightsex in bedbare buttfalling from heightriflecar crashdead bodycaferiveralcoholtelevisioncriminalshot in the backfoot chaseassassinwineambushwomandinerfemale pubic hairweaponmapbrunetteanti heroone man armydouble crossshot in the legshot in the foreheadon the runconfessionskinny dippingbinocularscharacter repeating someone else's dialogueprologuepay phonemissionundercovermassagesuitcaseopening action scenestreet shootoutlong takestalkingdateneck breakingpremarital sexsuspicionsilencersleepingespionageeuropesubtitled scenegarageitalianwaiterfireplacebulletassassination attemptscene during opening creditsrome italywatching a moviephone boothparadefollowing someonedead womanfalse identitymexican standofffemale killerpicnicfull moonmechanicrear entry sexstealing a cartarget practicegash in the facedeath of protagonistdark herobutterflyswedenaerial shotsexy womanblood on shirtlonerred pantiespassionate kissbriefcasetragic heronewspaper clippingmain character diesfemale assassinenglishman abroadvillain played by lead actorquick drawvery little dialoguegunslingerhired killerpush upspursecabin in the woodsman kills a womannickname in titletragic endingmain character shotwoman with gunlong brown hairassassination plotbilingualismmotor scooterman wearing towellast standhidden gunone last jobswimming in underwearfalling off a roofsee through pantiesferry boatdinner datebrandywine bottlewoman smoking cigarettehero kills a womanred lightred rosetarget shootingstrong sexual contentdying womanfake idcar repairfast drawimplied cunnilingustaking off shoescrisis of consciencetalking during sexequipmentkissing in publicsmoking after sextalking after sexroman catholicauto repairkissing breastsalleywaywoman undressing for a manopen air marketmercuryfemale snipermisfiring gunshooting out tireloading gungunsmithrepairing a cardalarna swedenfailed murder attemptassembling a rifle (See All) |
The film centers on a wounded Gulf war veteran who returns to his native Vermont suffering from bouts of amnesia. He is hitching and gets picked up by a stranger, things go pear shaped when a cop pulls them over and is murdered by the stranger. The vet. is wrongly accused of killing the cop and land β¦s up in an asylum. A quack doctor prescribes a course of experimental therapy, restraining him in a heavy duty straight jacket-like device, and locks him away in a body drawer of the basement morgue. During course of his treatment he gets flashbacks and visions of his future , where he can foresee he is to die in four days time. The catch is he doesn't know how. Thus commences the classic race against time. (Read More)
Subgenre: | alternate history |
Themes: | murderdeathlovechristmasmilitarytime travelmental illnessamnesiamurder of a police officernear death experiencecheating death |
Characters: | mother daughter relationshipsoldierpolice officerpsychiatristdoctor patient relationshipalcoholic mother |
Period: | 1990s2000sfuturethe future |
Story: | insane asylumpsychoexperimentbasementshot in the headsurprise endingfemale nuditygunbloodsexcigarette smokingtitle spoken by charactershot to deathblood splattershot in the chest β¦hallucinationrevolverbathpolice officer killedjourneysmokingcover uppremarital sexmedicinecopmorguesergeantpsychologypsychologistveteranchristmas evelieutenantbruiseburned to deathframed for murderclose up of eyesman cryingdeadhead woundnew yeartime machinemajorstrait jackethead injuryexperiment gone wrongcop killerpsychological tortureenigmawrongful arresttruck stopgulf warrestraintvermontextreme closeupambiguitytime travelerchild uses gunbackwards time travelgirl man relationshiplucid dreamaltering historymilitary veteranchild uses a gunfuture time travelgulf war veteranelectroconvulsive therapypersian gulfpsychological experimentbutterfly effectiraq war veteranmale time travellerbronze starreference to the four horsemen of the apocalypse (See All) |