Please wait - finding best movies...
Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find … out. Living on this hidden island is a giant gorilla and this beast now has Ann is its grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. But Carl has another plan in mind. (Read More)
| Subgenre: | monster movieepicmelodramamartial arts |
| Themes: | unemploymentpanicwrestlingfilmmakingmonsterescapekidnappingdeathmurder |
| Locations: | storm at seacanyonairplane accidentjunglerooftoptaxinew york city |
| Characters: | human animal relationshipfilm directoractressactorpolice |
| Period: | 1930s |
| Story: | remake of remakefalling over a cliffspear through chestwilhelm screamlifting a woman into the airbarefoot womandirector actor relationshiprescue partycolor remake of black and white filmremake of cult filmmonster as victimanimal deathgas bombdisaster in new yorkgiant bat …giant apelost worldbroken jawlibrary bookindian oceancentral parkbrontosaurussimian fictionscreening roomsteamshipking kongempire state building manhattan new york citychasmravinedrawbridgeseamancartwheeltroubled youthnative tribelifting an adult into the airsea captainalliterative titletriceratopsstampededeath of title characterfrozen lakeimpossible lovevaudevillegiant insectvinekaijulifting female in airgiant spiderjugglinggiant animalcheckfootprintlogprohibitionacrobaticsstarvingtommy guncavernbiplanetimes square manhattan new york citybroadway manhattan new york cityair raidtyrannosaurus rexcowardfilm studiogreat depressionfalling into watercentral park manhattan new york citytrue lovehuman sacrificecameramanplaywrightwallskyscrapergorillagatetributeexpeditionanimal name in titlechloroformplaypierfilm producercliffrainstormfogrowboatcrushed to deathbackstagedamsel in distressshopliftingeaten aliverampageanimal attackladdermovie starblockbusterlifting someone into the aircookslow motionspeareavesdroppingtypewritershot in the armfilm within a filmskeletonscreamjourneyno opening creditsmapdeath of frienddinerimpalementarmybridgewomanstabbingmanhattan new york cityislandfalling from heightrescueremakeshot in the chestcar accidentmachine gunshot to deathchasedancingcharacter name in titletwo word titlekiss (See All) |
Carl Denham needs to finish his movie and has the perfect location; Skull Island. But he still needs to find a leading lady. This 'soon-to-be-unfortunate' soul is Ann Darrow. No one knows what they will encounter on this island and why it is so mysterious, but once they reach it, they will soon find … out. Living on this hidden island is a giant gorilla and this beast now has Ann in it's grasps. Carl and Ann's new love, Jack Driscoll must travel through the jungle looking for Kong and Ann, whilst avoiding all sorts of creatures and beasts. (Read More)
| Subgenre: | monster movie |
| Themes: | unemploymentpanicfilmmakingmonsterescapekidnappingdeath |
| Locations: | airplane accidentjunglerooftopnew york city |
| Characters: | film directoractressactorpolice |
| Period: | 1930s |
| Story: | director actor relationshipmonster as victimanimal deathgas bombdisaster in new yorkgiant apelost worldbroken jawbrontosaurussimian fictionking kongsteamshipempire state building manhattan new york citychasmravine …native tribelifting an adult into the airalliterative titletriceratopsdeath of title charactervinekaijulifting female in airgiant spidergiant animalfootprintlogstarvingbiplanebroadway manhattan new york cityair raidtyrannosaurus rexgreat depressionfalling into waterhuman sacrificewallgorillagateexpeditionanimal name in titleclifffogcrushed to deathdamsel in distressshopliftingeaten aliverampageanimal attackladderblockbusterlifting someone into the aircookspearscreamjourneymapdinerbridgewomanstabbingmanhattan new york cityislandfalling from heightrescuecar accidentmachine gunshot to deathchasedancingcharacter name in titletwo word titlekiss (See All) |
An expedition of the "Petrox" company, is exploring in search of petrol. A strange island where they arrive is the home of a giant ape, King Kong, that is captured by the expedition in order to make money exhibiting it to the world. When in the U.S. the huge gorilla becomes restless, trying to retur …n home... (Read More)
| Subgenre: | monster movieepic |
| Locations: | new york city |
| Story: | color remake of black and white filmmonster as victimgiant apesimian fictionking kongalliterative titleimpossible lovekaijugiant animalfootprintgorillaexpeditionanimal name in titlefogcrushed to death …blockbustermanhattan new york cityislandfalling from heightremakeshot to deathcharacter name in titletwo word title (See All) |
A washed up monster chaser convinces the U.S. Government to fund a trip to an unexplored island in the South Pacific. Under the guise of geological research, the team travels to "Skull Island". Upon arrival, the group discover that their mission may be complicated by the wildlife which inhabits the …island. The beautiful vistas and deadly creatures create a visually stunning experience that is sure to keep your attention. (Read More)
| Subgenre: | monster moviemartial arts |
| Themes: | panicmonsterescapedeathmurder |
| Locations: | storm at seajungletaxi |
| Story: | giant apelost worldsimian fictionking kongnative tribekaijugiant spidergiant animalfootprintwallgorillaexpeditionrainstormcrushed to deatheaten alive …blockbusterspeartypewriterskeletonmapimpalementislandfalling from heightrescuemachine gunchasecharacter name in title (See All) |
Following the French atomic bomb tests in the South Pacific, an unknown creature is spotted passing eastward through the Panama Canal. Scientist Niko Tatopolous is called in to investigate the matter, and he quickly arrives at the conclusion that a giant, irradiated lizard has been created by the ex …plosions. Godzilla then makes its way north, landing at Manhattan to begin wreaking havoc in the big city. Even with the combined forces of the U.S. military to fight the monster, will it be enough to save the people of New York? (Read More)
| Subgenre: | monster movie |
| Themes: | panicmonsterescape |
| Locations: | storm at seataxinew york city |
| Story: | color remake of black and white filmremake of cult filmdisaster in new yorkempire state building manhattan new york citydeath of title characterkaijufootprintcentral park manhattan new york citypiercrushed to deatheaten aliverampageanimal attackblockbusterlifting someone into the air …dinermanhattan new york cityislandremakecar accidentmachine gunchasecharacter name in title (See All) |
Following his parents' death in Africa, John Clayton has been be raised by an ape, was known by the name Tarzan, but eventually left Africa and for his parents' home in England, along with the woman he fell in love with and married, Jane Porter. He is asked by Belgian King Leopold to go to Africa to … see what he has done there to help the country. Initially, he refuses. But an American, George Washington Williams, wants him to accept so he can accompany him. He says that Leopold might be committing all sorts of atrocities to achieve his goal, like slavery. Clayton agrees and his wife insists that she accompany him because she misses Africa. When they arrive, a man named Rom, who works for Leopold, attacks their village and captures Tarzan and Jane. With Washington's help he escapes and sets out to rescue Jane by going across the jungle. Washington joins him despite being told that he might not make it. (Read More)
| Subgenre: | martial arts |
| Themes: | escapekidnappingdeathmurder |
| Locations: | jungle |
| Story: | steamshipstampedevinegorillaexpeditionpierrainstormfogrowboatdamsel in distresseaten aliveanimal attackblockbusterspearno opening credits …maparmywomanfalling from heightrescueshot in the chestmachine gunshot to deathchasecharacter name in titlekiss (See All) |
Caesar and his apes are forced into a deadly conflict with an army of humans led by a ruthless Colonel. After the apes suffer unimaginable losses, Caesar wrestles with his darker instincts and begins his own mythic quest to avenge his kind. As the journey finally brings them face to face, Caesar and … the Colonel are pitted against each other in an epic battle that will determine the fate of both their species and the future of the planet. (Read More)
| Subgenre: | epic |
| Themes: | panicescapekidnappingdeathmurder |
| Locations: | jungle |
| Story: | simian fictionlogwallgorillacliffanimal attackblockbusterspearjourneyno opening creditsmapdeath of friendimpalementarmybridge …falling from heightrescueshot in the chestmachine gunshot to deathchase (See All) |
When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army … of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)
| Subgenre: | monster movie |
| Themes: | panicmonsterescapemurderdeath |
| Locations: | rooftop |
| Story: | stampedekaijuacrobaticswalleaten aliverampagespearjourneyno opening creditsmapimpalementarmyfalling from heightrescueshot in the chest …chase (See All) |
Cloverfield follows five New Yorkers from the perspective of a hand-held video camera. The movie is exactly the length of a DV Tape and a sub-plot is established by showing bits and pieces of video previously recorded on the tape that is being recorded over. The movie starts as a monster of unknown …origin destroys a building. As they go to investigate, parts of the building and the head of the Statue of Liberty come raining down. The movie follows their adventure trying to escape and save a friend, a love interest of the main character. (Read More)
| Themes: | panicmonsterescapedeath |
| Locations: | rooftopnew york city |
| Story: | disaster in new yorkempire state building manhattan new york citykaijufootprintcentral park manhattan new york cityskyscrapercrushed to deatheaten aliverampageno opening creditsdeath of friendarmymanhattan new york cityrescue |
Once again we're plunged into the world of sword fights and "savvy" pirates. Captain Jack Sparrow is reminded he owes a debt to Davy Jones, who captains the flying Dutchman, a ghostly ship, with a crew from hell. Facing the "locker" Jack must find the heart of Davy Jones but to save himself he must …get the help of quick-witted Will Turner and Elizabeth Swan. If that's not complicated enough, Will and Elizabeth are sentenced to hang, unless will can get Lord Cutler Beckett Jack's compass, Will is forced to join another crazy adventure with Jack. (Read More)
| Themes: | monsterescapemurder |
| Story: | wilhelm screamchasmnative tribesea captainrainstormrowboateaten aliveblockbusterlifting someone into the airslow motionskeletonno opening creditswomanislandfalling from height …rescuechase (See All) |
22 years after the original Jurassic Park failed, the new park (also known as Jurassic World) is open for business. After years of studying genetics the scientists on the park genetically engineer a new breed of dinosaur. When everything goes horribly wrong, will our heroes make it off the island?
| Subgenre: | monster movie |
| Themes: | escapedeath |
| Locations: | jungle |
| Story: | tyrannosaurus rexcrushed to deatheaten aliverampageanimal attackblockbusterskeletonno opening creditsmapimpalementwomanislandfalling from heightrescuemachine gun …chasetwo word titlekiss (See All) |
| Subgenre: | martial arts |
| Themes: | panicmonsterescapekidnappingdeathmurder |
| Story: | giant batgiant animalhuman sacrificerowboatcrushed to deatheaten aliveanimal attackblockbusterspearshot in the armmapimpalementarmybridgeisland …falling from heightrescueshot in the chestshot to deathchasecharacter name in title (See All) |
In the future, crime is out of control and New York City's Manhattan is a maximum security prison. Grabbing a bargaining chip right out of the air, convicts bring down the President's plane in bad old Gotham. Gruff Snake Plissken, a one-eyed lone warrior new to prison life, is coerced into bringing …the President, and his cargo, out of this land of undesirables. (Read More)
| Subgenre: | martial arts |
| Themes: | wrestlingescapemurderdeath |
| Locations: | airplane accidentrooftoptaxinew york city |
| Characters: | police |
| Story: | central park manhattan new york cityskyscrapermapbridgewomanstabbingmanhattan new york cityrescueshot in the chestcar accidentmachine gunshot to deathchase |
In 1939, an intrepid reporter in New York City makes a connection between the story she's covering -- of famous scientists suddenly disappearing around the world, and a recent attack on the city by giant robots. Determined to find the solution to these happenings, she seeks the help of her ex-boyfri …end, the captain of a mercenary legion of pilots. The two are investigating the case when the robots attack the city again, though in a stroke of luck, Sky Captain's right-hand man is able to locate their source. They then set off on an adventure in search of the evil mastermind behind these schemes, who is bent on creating a utopia and destroying the current world. (Read More)
| Themes: | kidnappingmurderdeath |
| Locations: | airplane accidentjungletaxinew york city |
| Characters: | police |
| Period: | 1930s |
| Story: | wilhelm screamdisaster in new yorkchasmempire state building manhattan new york cityair raidtypewriterskeletonmapwomanmanhattan new york cityfalling from heightmachine guncharacter name in titlekiss |
Jackie Chan, a top secret militant soldier, crashes into the South African jungle after his mission of kidnapping three scientists (who were experimenting with a powerful mineral) has gone awry. Waking up in a village of local natives, Chan has no memory of who he is, thus being addressed as "Who Am … I". His journey with aid from two female sidekicks to find out his identity leads him all the way to Rotterdam where he coincidentally discovers the location of the organization that kidnapped the three scientists. With no memory, Chan is thirsty for answers by any means necessary. (Read More)
| Subgenre: | martial arts |
| Themes: | panicescapekidnappingmurderdeath |
| Locations: | junglerooftoptaxi |
| Characters: | police |
| Story: | drawbridgenative tribeskyscraperspeareavesdroppingskeletonjourneymapbridgefalling from heightrescuecar accidentmachine gunchasecharacter name in title |
Huge advancements in scientific technology have enabled a mogul to create an island full of living dinosaurs. John Hammond has invited four individuals, along with his two grandchildren, to join him at Jurassic Park. But will everything go according to plan? A park employee attempts to steal dinosau …r embryos, critical security systems are shut down and it now becomes a race for survival with dinosaurs roaming freely over the island. (Read More)
| Subgenre: | epic |
| Themes: | monsterdeath |
| Locations: | jungle |
| Story: | brontosauruslifting an adult into the airtriceratopstyrannosaurus rexrainstormeaten aliverampageanimal attackblockbusterlifting someone into the airno opening creditsislandrescuechasetwo word title |
The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit …e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)
| Themes: | unemploymentpanicmonsterescapekidnappingdeathmurder |
| Locations: | taxi |
| Characters: | police |
| Story: | kaijugiant animalstarvingcrushed to deatheaten aliverampageanimal attackeavesdroppingmapimpalementarmybridgeislandrescuechase …two word title (See All) |
In 1941, New York intellectual playwright Barton Fink comes to Hollywood to write a Wallace Beery wrestling picture. Staying in the eerie Hotel Earle, Barton develops severe writer's block. His neighbor, jovial insurance salesman Charlie Meadows, tries to help, but Barton continues to struggle as a …bizarre sequence of events distracts him even further from his task. (Read More)
| Themes: | wrestlingmurder |
| Locations: | new york city |
| Story: | screening roomlifting female in airfilm studioplaywrightplayfilm producerlifting someone into the airtypewriterfilm within a filmscreamdancingcharacter name in titletwo word title |
A research team is sent to an island miles away from the previous home of Jurassic Park, to document and photograph the now liberated dinosaurs. However, InGen the BioEngineering company has sent another larger team to the same island to catch, sedate, and transport some dinosaurs to San Diego where … they will be used in a new Jurassic Park location. But life always finds a way. Will both teams return to the mainland with successful findings? Or will another tragedy occur? (Read More)
| Subgenre: | martial arts |
| Themes: | monster |
| Locations: | jungle |
| Story: | triceratopstyrannosaurus rexexpeditionrainstormcrushed to deatheaten aliverampageblockbusterno opening creditsimpalementislandrescuecar accident |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc …hanted. (Read More)
| Themes: | panicmonsterescapekidnapping |
| Locations: | rooftop |
| Story: | remake of cult filmfrozen laketrue loverainstormanimal attackblockbusterno opening creditsmapbridgewomanfalling from heightrescueremakeshot in the chestchase …dancingcharacter name in titlekiss (See All) |
In San Andreas, California is experiencing a statewide earthquake that goes on record as easily the biggest earthquake in history. Dwayne Johnson plays Ray Gaines, a helicopter rescue pilot for the Los Angeles Fire Department, who is trying to find his daughter, Blake (Alexandra Daddario), who is in … San Francisco amidst the chaos. Ray's estranged wife, Emma, is forced to turn to Ray for help, as he is her last resort. Together they journey to save their daughter. (Read More)
| Themes: | panicescapedeath |
| Story: | cameramanskyscrapercrushed to deathdamsel in distressblockbusterjourneyno opening creditsmapimpalementbridgewomanfalling from heightrescuecar accidenttwo word title …kiss (See All) |
The 17-year-old Sean Anderson receives a coded signal and his stepfather Hank helps him to decipher the message. They find that Sean's grandfather Alexander Anderson has found the mysterious island in the Pacific described by Jules Verne and two other writers in their novels. The stubborn Sean wants … to travel to the coordinates and Hank decides to buy the tickets and travel with the teenager to a small island nearby the location. They rent an old helicopter owned by the locals Gabato and his teenage daughter Kailani and the group heads to the unknown spot. Along their journey, they cross a hurricane and crash on the island. They find a beautiful and dangerous place, surrounded by forests, volcanoes with lava of gold and menacing life forms. They also meet the old Alexander and Hank discovers that the island is sinking. Now their only chance to survive is to find the legendary Nautilus. (Read More)
| Themes: | monster |
| Locations: | storm at seajungle |
| Story: | lost worldgiant spidergiant animalanimal attackskeletonjourneyno opening creditsmapislandfalling from heightrescueremakechasekiss |
A prehistoric epic that follows a young mammoth hunter named D'Leh's journey through uncharted territory to secure the future of his tribe. When a band of mysterious horse-riding warlords raid the Yaghal camp and kidnaps his heart's desire - the beautiful Evolet along with many others, D'Leh is forc …ed to lead a small group of hunters south to pursue the warlords to the end of the world to save her. Driven by destiny, the unlikely band of warriors must battle saber-toothed cats and terror birds in the Levant. (Read More)
| Subgenre: | epic |
| Themes: | monsterkidnappingdeathmurder |
| Locations: | jungle |
| Story: | stampedehuman sacrificerainstormanimal attackspearskeletonjourneydeath of friendarmystabbingfalling from heightrescuechasedancingkiss |
This swash-buckling tale follows the quest of Captain Jack Sparrow, a savvy pirate, and Will Turner, a resourceful blacksmith, as they search for Elizabeth Swann. Elizabeth, the daughter of the governor and the love of Will's life, has been kidnapped by the feared Captain Barbossa. Little do they kn …ow, but the fierce and clever Barbossa has been cursed. He, along with his large crew, are under an ancient curse, doomed for eternity to neither live, nor die. That is, unless a blood sacrifice is made. (Read More)
| Themes: | escapekidnapping |
| Locations: | storm at sea |
| Story: | wilhelm screamsea captaincavernpierfogrowboatdamsel in distressskeletonarmywomanislandfalling from heightrescueshot in the chest |
Set in 1935, a professor, archaeologist, and legendary hero by the name of Indiana Jones is back in action in his newest adventure. But this time he teams up with a night club singer named Wilhelmina "Willie" Scott and a twelve-year-old boy named Short Round. They end up in an Indian small distresse …d village, where the people believe that evil spirits have taken all their children away after a sacred precious stone was stolen! They also discovered the great mysterious terror surrounding a booby-trapped temple known as the Temple of Doom! Thuggee is beginning to attempt to rise once more, believing that with the power of all five Sankara stones they can rule the world! Now, it's all up to Indiana to put an end to the Thuggee campaign, rescue the lost children, win the girl and conquer the Temple of Doom. (Read More)
| Subgenre: | martial arts |
| Themes: | escapekidnappingdeathmurder |
| Locations: | airplane accidentjungle |
| Period: | 1930s |
| Story: | tommy gunfalling into waterhuman sacrificecrushed to deatheaten aliveblockbusterlifting someone into the airspearskeletonbridgefalling from heightrescuechasecharacter name in titlekiss |
30 years after the defeat of Darth Vader and the Empire, Rey, a scavenger from the planet Jakku, finds a BB-8 droid that knows the whereabouts of the long lost Luke Skywalker. Rey, as well as a rogue stormtrooper and two smugglers, are thrown into the middle of a battle between the Resistance and th …e daunting legions of the First Order. (Read More)
| Subgenre: | epicmartial arts |
| Themes: | monsterescapekidnappingmurderdeath |
| Story: | wilhelm screamdamsel in distresseaten aliveblockbusterspearshot in the armno opening creditsmapdeath of friendarmywomanislandfalling from heightrescueremake …shot in the chestshot to deathchase (See All) |
After successfully crossing over (and under) the Misty Mountains, Thorin and Company must seek aid from a powerful stranger before taking on the dangers of Mirkwood Forest--without their Wizard. If they reach the human settlement of Lake-town it will be time for the hobbit Bilbo Baggins to fulfill h …is contract with the dwarves. The party must complete the journey to Lonely Mountain and burglar Baggins must seek out the Secret Door that will give them access to the hoard of the dragon Smaug. And, where has Gandalf got off to? And what is his secret business to the south? (Read More)
| Subgenre: | martial arts |
| Themes: | monsterescapemurderdeath |
| Story: | giant spiderfoganimal attackblockbusterspearshot in the armskeletonjourneyno opening creditsmapimpalementarmybridgefalling from heightrescue …shot in the chestshot to deathchasecharacter name in title (See All) |
When a documentary crew traveling through the Amazon jungle, picks up a stranded man, they are unaware of the trouble that will occur. This stranger's hobby is to capture the giant Anaconda snake, and plans to continue targeting it on their boat, by any means necessary.
| Subgenre: | monster movie |
| Themes: | panicmonster |
| Locations: | jungle |
| Characters: | film director |
| Story: | giant animalfilm producerrainstormcrushed to deatheaten aliveanimal attackcookwoman |
It is 1942, America has entered World War II, and sickly but determined Steve Rogers is frustrated at being rejected yet again for military service. Everything changes when Dr. Erskine recruits him for the secret Project Rebirth. Proving his extraordinary courage, wits and conscience, Rogers undergo …es the experiment and his weak body is suddenly enhanced into the maximum human potential. When Dr. Erskine is then immediately assassinated by an agent of Nazi Germany's secret HYDRA research department (headed by Johann Schmidt, a.k.a. the Red Skull), Rogers is left as a unique man who is initially misused as a propaganda mascot; however, when his comrades need him, Rogers goes on a successful adventure that truly makes him Captain America, and his war against Schmidt begins. (Read More)
| Subgenre: | epicmartial arts |
| Themes: | escapemurderdeath |
| Locations: | rooftoptaxinew york city |
| Story: | wilhelm screamtommy guntimes square manhattan new york citycrushed to deathtypewritershot in the armskeletonno opening creditsmapdeath of friendarmyfalling from heightrescueshot in the chestcar accident …machine gunshot to deathchasecharacter name in titlekiss (See All) |
A growing nation of genetically evolved apes led by Caesar is threatened by a band of human survivors of the devastating virus unleashed a decade earlier. They reach a fragile peace, but it proves short-lived, as both sides are brought to the brink of a war that will determine who will emerge as Ear …th's dominant species. (Read More)
| Subgenre: | epic |
| Themes: | murderdeath |
| Story: | simian fictiongorillacrushed to deathanimal attackblockbusterspearno opening creditsdeath of friendimpalementfalling from heightrescueshot in the chestmachine gunshot to death |
At the story's heart is Caesar ('Andy Serkis' (qv)), a chimpanzee who gains human-like intelligence and emotions from an experimental drug. Raised like a child by the drug's creator, Will Rodman ('James Franco' (qv)) and a primatologist Caroline Aranha ('Freida Pinto' (qv)), Caesar ultimately finds …himself taken from the humans he loves and imprisoned in an ape sanctuary in San Bruno. Seeking justice for his fellow inmates, Caesar gives the fellow apes the same drug that he inherited. He then assembles a simian army and escapes the sanctuary - putting man and ape on a collision course that could change the planet forever. (Read More)
| Themes: | escapedeath |
| Locations: | jungle |
| Characters: | human animal relationshippolice |
| Story: | wilhelm screamsimian fictionfalling into watergorillafogrampageanimal attackno opening creditsarmyfalling from heightshot in the chestcar accidentmachine gunshot to deathchase …character name in title (See All) |
The North American counter-terrorism force Team America attacks a group of terrorists in Paris. Later, the leader of the organization, Spottswoode, invites the famous Broadway actor Gary Johnston to join his world police and work undercover in Cairo, infiltrating a terrorist organization in the hope … they will disclose their plan of destroying the world. Team America destroy the cell of terrorists, but then the Panama Canal is attacked by the criminals as a payback. Gary feels responsible for the death of many innocents and leaves the counter-terrorism organization. When the leader of North Korea, Kim Jong Il, joins a group of pacifist actors and actresses with the intention of using weapons of massive destruction, Team America tries to avoid the destruction of the world. (Read More)
| Subgenre: | martial arts |
| Themes: | death |
| Locations: | airplane accidentnew york city |
| Characters: | actorpolice |
| Story: | wilhelm screamtimes square manhattan new york citybackstageeaten aliveanimal attackimpalementmanhattan new york cityfalling from heightrescueshot in the chestmachine gunshot to deathkiss |
Madison Avenue advertising man Roger Thornhill finds himself thrust into the world of spies when he is mistaken for a man by the name of George Kaplan. Foreign spy Philip Vandamm and his henchman Leonard try to eliminate him but when Thornhill tries to make sense of the case, he is framed for murder …. Now on the run from the police, he manages to board the 20th Century Limited bound for Chicago where he meets a beautiful blond, Eve Kendall, who helps him to evade the authorities. His world is turned upside down yet again when he learns that Eve isn't the innocent bystander he thought she was. Not all is as it seems however, leading to a dramatic rescue and escape at the top of Mt. Rushmore. (Read More)
| Themes: | escapekidnappingmurderdeath |
| Locations: | airplane accidenttaxi |
| Characters: | police |
| Story: | falling over a cliffbiplanedamsel in distressblockbustereavesdroppingimpalementstabbingmanhattan new york cityfalling from heightrescueshot in the chestcar accidentshot to deathchasekiss |
In the Maya civilization, a peaceful tribe is brutally attacked by warriors seeking slaves and human beings for sacrifice for their gods. Jaguar Paw hides his pregnant wife and his son in a deep hole nearby their tribe and is captured while fighting with his people. An eclipse spares his life from t …he sacrifice and later he has to fight to survive and save his beloved family. (Read More)
| Subgenre: | epic |
| Themes: | deathmurder |
| Locations: | jungle |
| Story: | human sacrificecliffrainstormanimal attackspearno opening creditsdeath of friendimpalementstabbingfalling from heightshot in the chestchase |
Japan is thrown into a panic after several ships explode and are sunk. At first, the authorities think its either underwater mines or underwater volcanic activity. The authorities soon head to Odo Island, close to where several of the ships were sunk. One night, something comes onshore and destroys …several houses and kills several people. A later expedition to the island led by paleontologist Professor Kyohei Yamane, his daughter Emiko, and young navy frogman Hideto Ogata (who also happens to be Emiko's lover, even though she is betrothed to Dr. Daisuke Serizawa) soon discover something more devastating than imagined in the form of a 164-foot-tall (50-meter-tall) monster whom the natives call Gojira. Now, the monster begins a rampage that threatens to destroy not only Japan but the rest of the world as well. Can the monster be destroyed before it is too late, and what role will the mysterious Serizawa play in the battle? (Read More)
| Subgenre: | monster movie |
| Themes: | panicmonster |
| Story: | death of title characterkaijuexpeditionplayrampageskeletonmapislandmachine guncharacter name in title |
Having seen his father killed in a major gang fight in New York, young Amsterdam Vallon is spirited away for his own safety. Some years later, he returns to the scene of his father's death, the notorious Five Points district in New York. It's 1863 and lower Manhattan is run by gangs, the most powerf …ul of which is the Natives, headed by Bill "The Butcher" Cutting. He believes that America should belong to native-born Americans and opposes the waves of immigrants, mostly Irish, entering the city. It's also the time of the Civil War and forced conscription leads to the worst riots in US history. Amid the violence and corruption, young Vallon tries to establish himself in the area and also seek revenge over his father's death. (Read More)
| Subgenre: | epic |
| Themes: | deathmurder |
| Locations: | new york city |
| Story: | playpierfogrowboatslow motionno opening creditsdeath of friendimpalementarmywomanstabbingmanhattan new york cityrescueshot in the chestshot to death …chasedancingkiss (See All) |
When his brother is killed in a robbery, paraplegic Marine Jake Sully decides to take his place in a mission on the distant world of Pandora. There he learns of greedy corporate figurehead Parker Selfridge's intentions of driving off the native humanoid "Na'vi" in order to mine for the precious mate …rial scattered throughout their rich woodland. In exchange for the spinal surgery that will fix his legs, Jake gathers intel for the cooperating military unit spearheaded by gung-ho Colonel Quaritch, while simultaneously attempting to infiltrate the Na'vi people with the use of an "avatar" identity. While Jake begins to bond with the native tribe and quickly falls in love with the beautiful alien Neytiri, the restless Colonel moves forward with his ruthless extermination tactics, forcing the soldier to take a stand - and fight back in an epic battle for the fate of Pandora. (Read More)
| Subgenre: | epicmartial arts |
| Themes: | panicmonsterdeathmurder |
| Locations: | jungle |
| Story: | wilhelm screamnative tribecrushed to deathanimal attackblockbusterlifting someone into the airspearno opening creditsimpalementarmyfalling from heightrescueshot in the chestmachine gunshot to death …chasekiss (See All) |
In a world ravaged by a virus infection, turning its victims into the Undead, Alice (Jovovich), continues on her journey to find survivors and lead them to safety. Her deadly battle with the Umbrella Corporation reaches new heights, but Alice gets some unexpected help from an old friend. A new lead …that promises a safe haven from the Undead takes them to Los Angeles, but when they arrive the city is overrun by thousands of Undead - and Alice and her comrades are about to step into a deadly trap. (Read More)
| Subgenre: | martial arts |
| Themes: | monsterescapekidnappingdeathmurder |
| Locations: | airplane accidentrooftop |
| Story: | fogeaten aliveanimal attackcookshot in the armjourneydeath of friendimpalementarmyfalling from heightrescueshot in the chestmachine gunshot to deathchase |
Set on a colorful Greek island, the plot serves as a background for a wealth of ABBA songs. A young woman about to be married discovers that any one of three men could be her father. She invites all three to the wedding without telling her mother, Donna, who was once the lead singer of Donna and the … Dynamos. In the meantime, Donna has invited her backup singers, Rosie and Tanya. (Read More)
| Locations: | rooftoptaxinew york city |
| Story: | lifting an adult into the airlifting female in airladderblockbusterlifting someone into the airno opening creditsbridgewomanislandfalling from heightdancingkiss |
High school outcasts stumble upon an old alien ship, where they acquire superpowers and are dubbed the Power Rangers. Learning that an old enemy of the previous generation has returned to exact vegenance, the group must harness their powers and use them to work together and save the world.
| Subgenre: | martial arts |
| Themes: | panicmonsterescapekidnappingmurderdeath |
| Locations: | storm at sea |
| Story: | wilhelm screamkaijuwallrainstormcrushed to deathrampageeavesdroppingno opening creditsmaparmyfalling from heightrescueremakeshot in the chestcar accident …chasekiss (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi …nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
| Subgenre: | epicmartial arts |
| Themes: | panicmonsterescapekidnappingmurderdeath |
| Locations: | rooftop |
| Story: | wilhelm screamindian oceanskyscrapercrushed to deathdamsel in distressrampageblockbusterspeareavesdroppingdeath of frienddinerimpalementarmyfalling from heightrescue …shot in the chestmachine gunshot to deathcharacter name in title (See All) |
After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.
| Subgenre: | epicmartial arts |
| Themes: | escapemurderdeath |
| Story: | giant batcowardcrushed to deathanimal attackblockbusterspearno opening creditsmapdeath of friendarmybridgefalling from heightrescueshot in the chestshot to death |
Outside a movie premiere, enthusiastic fan Peppy Miller literally bumps into the swashbuckling hero of the silent film, George Valentin. The star reacts graciously and Peppy plants a kiss on his cheek as they are surrounded by photographers. The headlines demand: "Who's That Girl?" and Peppy is insp …ired to audition for a dancing bit-part at the studio. However as Peppy slowly rises through the industry, the introduction of talking-pictures turns Valentin's world upside-down. (Read More)
| Themes: | filmmaking |
| Characters: | human animal relationshipfilm directoractressactor |
| Period: | 1930s |
| Story: | screening roomfilm studiofilm producerbackstageladdermovie startypewriterfilm within a filmcar accidentdancingtwo word titlekiss |
| Themes: | panicmonsterescape |
| Locations: | rooftoptaxinew york city |
| Characters: | police |
| Story: | disaster in new yorktimes square manhattan new york cityrampageno opening creditsmapdinerarmymanhattan new york cityfalling from heightrescueremakecar accidentmachine gunchasedancing |
Alice awakes at home with her daughter Becky and her husband. But soon she realizes that she is actually in an Umbrella Corporation's underground facility. Out of the blue, the computer security system shuts-down and Alice flees to the central control room of the facility. She meets Ada Wong, who wo …rks with Albert Wesker, and she learns that a five-man team has been sent by Wesker to rescue them. However, the Red Queen sends Jill Valentine and Rain to hunt them down. (Read More)
| Subgenre: | martial arts |
| Themes: | monsterescapekidnappingdeathmurder |
| Locations: | rooftoptaxi |
| Story: | times square manhattan new york citycrushed to deatheaten aliveshot in the armmapimpalementarmyfalling from heightrescueshot in the chestcar accidentmachine gunshot to deathchase |
After being trapped in a jungle board game for 26 years, a Man-Child wins his release from the game. But, no sooner has he arrived that he is forced to play again, and this time sets the creatures of the jungle loose on the city. Now it is up to him to stop them.
| Locations: | jungle |
| Story: | stampedegiant insectgiant spiderplayrampageanimal attackblockbusterlifting someone into the airno opening creditsbridgecar accident |
| Subgenre: | martial arts |
| Themes: | escapekidnappingmurderdeath |
| Period: | 1930s |
| Story: | giant animalair raideaten aliveanimal attackspearskeletonjourneyno opening creditsmapfalling from heightrescuechasecharacter name in title |
When his partner is killed by the mysterious and possibly nonexistent Jaguar Shark, Steve Zissou and his Team Zissou crew set off for an expedition to hunt down the creature. Along with his estranged wife, a beautiful journalist and a co-pilot who could possibly be Zissou's son, the crew set off for … one wild expedition. (Read More)
| Themes: | filmmakingmurderdeath |
| Story: | steamshipbiplaneexpeditioneaten aliveanimal attackfilm within a filmmapdeath of friendstabbingislandrescueshot in the chestmachine guncharacter name in title |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | martial arts |
| Themes: | panicmonsterescapekidnappingmurderdeath |
| Locations: | jungle |
| Story: | falling into wateranimal attacklifting someone into the airskeletonno opening creditsimpalementfalling from heightrescueshot in the chestmachine gunshot to deathchase |
A young FBI agent infiltrates an extraordinary team of extreme sports athletes he suspects of masterminding a string of unprecedented, sophisticated corporate heists. Deep undercover, and with his life in danger, he strives to prove these athletes are the architects of the mind-boggling crimes that …are devastating the world's financial markets. (Read More)
| Themes: | escapedeathmurder |
| Locations: | storm at seajungle |
| Characters: | police |
| Story: | skyscrapereavesdroppingno opening creditsmapdeath of friendfalling from heightrescueremakeshot in the chestcar accidentmachine gunshot to deathchase |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com