Please wait - finding best movies...
Jeff, who has been diagnosed with AIDS, decides to get his revenge on the world by attacking people with hypodermic needles filled with his blood.
Subgenre: | black comedyvideo |
Themes: | exploitationartsuicidedeathrevenge |
Mood: | slasher |
Characters: | psychiatristpolice |
Period: | 2000s1980s |
Story: | boom boxdomestic violenceshot on videofailed suicide attemptfailed suicidefamiliarideaextrasnotesstickerboomneedlesmashupquestionsreaction β¦hypodermicbootlegpitchtalkscannerdomesticinfectedmicro budgetshootfansobscurityvintagemindno budgettrackcrazyblackposterfallhookersuicide attemptcultnuditybloodviolence (See All) |
Max Renn runs a TV channel, and when looking for new material to show--he discovers "Videodrome." His girlfriend, Nicki Brand, goes to audition for the show, and Max gets drawn into the underlying plot that uses the show as its front for a global conspiracy.
Subgenre: | videoindependent filmcult filmsuspenseconspiracycyberpunkbody horrorcorporate conspiracy |
Themes: | exploitationsuiciderevengedeathmurdersurrealismbetrayalfeartortureescapedeceptionseductionparanoiainsanitypanic β¦philosophytechnology (See All) |
Mood: | goresatirenightmareambiguous ending |
Locations: | restauranthotelapartmentusa |
Characters: | psychiatristlustjapaneseprofessorsecretaryself mutilationengineerwriter directorself inflicted gunshot woundsuicide by shootingsuicide by shooting one's self in the head |
Period: | 1980s |
Story: | cultnudityviolencebloodsexfemale nuditymale nudityone word titlefemale frontal nudityflashbackmasturbationmale rear nuditybare chested malegun β¦female rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterexplosionsurprise endingpistolfiredreamcorpseshot to deathblood splattershot in the chestface slapshot in the headwritten by directorcondombare buttheld at gunpointbombhallucinationtelevisiontelephonebound and gaggedstrangulationtied to a chairanti heroassassinationdouble crossnews reportshot in the foreheadattempted murderlimousinemicrophonedangerfantasy sequenceauditionlong takemanipulationscarexploding bodypremarital sexshot in the armlove interestwhippingcult directorpizzapornographyrevelationelectronic music scoregothicshot in the stomachscene during opening creditsred dresstied to a bedmediavideotapecovered in bloodgrindhousevirtual realitysadomasochismmind controlmilksocial commentarywhipdark humordisembowelmentperversionalternate realitycorporationkilling spreegothintestinesvideo tapemysterious manbrainwashingworld dominationnight visionelectronic musicblack marketradio stationpiercingpornographersnuff filmfight the systemfilmed killinghomeless persontelevision setceomurder spreephilosophersocial decayvcrextreme close upman slaps a womanshoulder holstersex on first dateman slaps womanreference to sigmund freudhidden guntv stationtalk show hosttumorgarroteman hits womanconferencejamaicanhand through chestvisionaryradio hostactress breaking typecastremadeabsurd violenceheadsetsubliminal messagetrailer narrated by percy rodriguezacting musiciancanuxploitationabandoned shipentrailssatellite dishassimilationvirtualityabandoned churchillegalityspectacleshole in chestpinunderground pornographymovie reality crossovervideo recordercable tvtv show within a filmtrade showtelevision executiveblurred boundariesboat yardopticiangimp masktoronto canadapirate broadcastsatellite televisiontelevision as portaldesensitizationvideo libraryagony aunt (See All) |
A double-bill of thrillers that recall both filmmakers' favorite exploitation films. "Grindhouse" (a downtown movie theater in disrepair since its glory days as a movie palace known for "grinding out" non-stop double-bill programs of B-movies) is presented as one full-length feature comprised of two β¦ individual films helmed separately by each director. "Death Proof," is a rip-roaring slasher flick where the killer pursues his victims with a car rather than a knife, while "Planet Terror" shows us a view of the world in the midst of a zombie outbreak. The films are joined together by clever faux trailers that recall the '50s exploitation drive-in classics. (Read More)
Subgenre: | black comedycult filmb movieslasher flickholiday horror |
Themes: | exploitationrevengedeathmurderfriendshipghostjealousylesbianismescapeextramarital affairpsychopathsupernatural powersadismcannibalismmurder of a police officer |
Mood: | slashergorecar chaseblood and gore |
Locations: | hospitalbarbeachrestauranthelicoptermotorcycleelevatorstrip clubmexicokiller car |
Characters: | mother son relationshipfather daughter relationshipdoctortattoobrother brother relationshipteenage girlteenage boyzombiesoldierserial killernursepriestactresssingle mother β¦killersherifftruck driver (See All) |
Period: | year 2007 |
Story: | violencebloodf ratedone word titlefemale frontal nuditysex sceneinterracial sextitle spoken by characterfireshootoutshot to deathunderweartesticles β¦machine guncar accidentshot in the headfalling from heightmarijuanadecapitationgood versus evilstabbingbridgestabbed to deathdinerstabbed in the chestexploding carapologysevered headman with glassesassassinationhit by a cardouble crossshot in the legmarriage proposalshot in the foreheadracial slurbeaten to deathstabbed in the backperson on fireringattempted rapescarcheerleaderfilm within a filmexploding bodybasementpremarital sexsevered armshot in the armdismembermentmaniacwerewolfsyringekilling an animalmachetewoman with glassesbabysittercookmad scientistmorguedrug abuseexploding buildingassaultgrindhouseparadeend of the worldinterracial friendshipeaten alivetensionsevered fingerloss of sonstabbed in the neckshot in the faceexploding headassault rifleinfectiondisfigurementsiegestabbed in the eyebarbecuecastrationsevered leggatling gungrenade launcherthanksgivingtext messagingserial murdercar troublestabbed in the handhomagehead blown offexotic dancerhuman monsterjukeboxhomicidal maniacold flamecameo appearancetennesseehit by a truckmilitary basesaxophoneretrotrampolinedirector also cinematographerflesh eating zombiedisc jockeywalking deadstuntmandeformitybroken neckchild with gunaustin texasunwed pregnancyfake commercialmakeup artistbroken handfake trailerdirected by several directorsmultiple cameosanthropophaguswooden legthermometercinephiliachemical weaponsripped in halfaccidental suicidenazi experimentintentional goofmelting manreal twins playing twinsfilm breakon hood of moving car (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn β¦'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | independent filmcult filmsuspenseconspiracytragedyparanormal phenomenabody horror |
Themes: | exploitationsuicidedeathmurdersurrealismpregnancytortureescapeinvestigationdeceptionpsychopathbrutalitysupernatural powerterrorismsurveillance β¦home invasionregret (See All) |
Mood: | gorecar chasenight |
Locations: | trainhotelhelicoptertaxigas stationschool busart museumabandoned factorycar on fire |
Characters: | doctorbrother brother relationshipartisthitmansecurity guardprofessorself mutilationhomeless mansuicide by gunshotself inflicted gunshot wounddeath of killer |
Period: | 1980s |
Story: | hypodermicscannerviolencebloodone word titleflashbackbare chested malecigarette smokingphotographtitle spoken by characterexplosionchasesurprise endingpistoltelephone call β¦firecorpseshot to deathblood splattermachine guncar accidentshot in the chestface slapshot in the headshotguncomputerwritten by directorfalling from heightshowdownheld at gunpointcar crashinterrogationhallucinationrevolvertelephonescientistshot in the backsubjective camerafoot chaseassassinterroristsubwayexploding carbrunetteapologyman with glassescigar smokingshot in the legshot in the foreheadon the runduelscreamingperson on firefactorypay phonecharacter's point of view camera shotmissionproduct placementstatuecover upevil manshot in the shoulderinjectionexploding bodyautomobileshot in the armcult directorpsychictraitorfalling down stairssabotagedestructionburned aliverevelationassassination attemptelectronic music scorehypodermic needledrugtied to a bedsecurity cameramagazinenosebleedphone boothpress conferencevisitgrindhousedriving a carladdermind controlart gallerycrushed to deathreverse footagesurveillance camerablood on facegash in the faceshopping mallsculptureblack and white sceneexploding headlaughterthrown through a windowopening a doormeetingburned to deathtelekinesisholding handspipe smokingtelepathyshot through a windowvillain played by lead actoryellingneedlehit in the facesubway stationarmored cartelephone boothescalatorworld dominationfilm projectormegalomaniachot dogdenialhearing voicesautumncabin in the woodsman kills a womancrashing through a windowlying on bedwoman kills a manshot in the handseizurebullet woundsuper powerburnt bodypsychic powershot in the footlighting a cigarettemurder by gunshotman on firehuman experimenttwo brothersmind readingschizophrenicwoman with gunfade to blackdriving at nightfast food restaurantkicking in a doorscience runs amokpackagefratricideman slaps a womanrevolving doormusic storepublic phonethreatened with a gunmegacorporationthreat to killwaiting roomlooking at pictureshaking handsextrasensory perceptiontranquilizer dartburned bodyforced suicideclimbing stairscanuxploitationpsionic powerpublic telephonethrown through a wallmelting facesprinkler systemdrill in the headcomputer programpharmaceuticalsbus crashdart gunknocking on a windowside effectcanadian science fictioncar crashing through a windowreference to sleeping beautyburnt corpseexploding eyecrashing through glasswhite eyesclimbing ladderraising one's handcain and abelbrother killing brotherdriveby shootingexploding gas stationcomputer roomcomputer operatorcar crashes into buildinglighting pipe (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | black comedycult filmcoming of agesuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof |
Themes: | revengedeathmurderfriendshipinfidelitybetrayalfeardrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | slashergoresatirehigh schooldarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | policefamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistserial killervillainsheriff β¦single fatherslasher killerself referential (See All) |
Period: | 1990s |
Story: | questionsblackviolencebloodf ratedone word titlebare chested malecigarette smokingtitle spoken by characterpartyknifechasesurprise endingpistolfire β¦cell phonecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed to deathstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman, β¦will try to stop him and the plague of worms generated by the creature. (Read More)
Subgenre: | black comedycult filmb moviecreature feature |
Themes: | murderdrunkennessmonstercannibalismmurder of a police officer |
Mood: | gorehigh school |
Locations: | barswimming poolforestsmall townpolice station |
Characters: | husband wife relationshipteenagerzombiealienmayorcountry singer |
Period: | year 2005 |
Story: | domestic violenceinfectedviolencebloodsexone word titleflashbackmale rear nuditybare chested malephotographexplosionpartypistolcorpseshot to death β¦blood splattershot in the chestshot in the headshotgunwritten by directorriflecar crashclassroomdecapitationfoot chasebandimpalementstabbed to deathstabbed in the chestmapsevered headchild in perilhit by a cartransformationshot in the foreheadcharacter repeating someone else's dialogueexploding bodybasementpolicewomancharacter says i love youdirectorial debuttwincowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controlanimal attackeaten alivealien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchmutationfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | black comedysuspensesuperherotragedypsycho thrillersurvival horrorteen horrorpsychological thrilleramerican horror |
Themes: | deathmurderfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeceptionvoyeurismpsychopathdeath of father β¦brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | psychiatristfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerserial killerhostagekillersecurity guardvillainterroruncle niece relationshipslasher killer β¦serial murdererpolice dog (See All) |
Period: | 2010s |
Story: | boom boxviolencebloodone word titlesequelflashbackdogbare chested maledancingtitle spoken by characterpartyknifechasesurprise endingpanties β¦cell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingmaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive mothervideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
When a bumbling pair of employees at a medical supply warehouse accidentally release a deadly gas into the air, the vapors cause the dead to re-animate as they go on a rampage through Louisville, Kentucky seeking their favorite food, brains.
Subgenre: | black comedyindependent filmcult filmpunksurvival horror |
Themes: | suicidedeathdeceptioncannibalismblindnessmurder of a police officer |
Mood: | goreone night |
Locations: | helicoptercemetery |
Characters: | policezombiemilitary officer |
Period: | 1980s |
Story: | cultbloodfemale nudityfemale frontal nuditydogchasesurprise endingpistolshot to deathblood splattermachine guncar accidentshot in the chestshotgun β¦written by directorvomitingdecapitationmassacreambulanceexploding carsevered headpart of serieshit by a carstrippingbusinessmanstripteaseperson on firefirst of seriesskeletonconvertiblebasementfirst partsevered armdismembermentundeadmissilefalling down stairsburned alivewarehouseelectronic music scoreloss of friendexploding buildingeaten aliveswitchbladestabbed in the headstairsthunderstormjumping through a windowatticsiegenude woman murderedtorso cut in halfliving deadhit in the facecremationdead animalacidburnt faceparamedicbitten in the neckdisembodied headnaked dead womansan diego californiachapelarm cut offpsychotronic filmsledgehammerbarrelmortuarynuclear weaponmorticianno survivorsthroat rippingpick axecrushed by a carcrematoriumcadaverpoison gasexposed brainsplit in twolouisville kentuckyhead chopped offripped in halfrigor mortisoffice clerkbody in a bag (See All) |
David and Amy Fox find themselves stranded in the middle of nowhere when their car breaks down. Luckily, they come across a motel with a TV to entertain them during their overnight stay. However, there's something very strange and familiar about the Grade-Z slasher movies that the motel broadcasts f β¦or its guests' enjoyment. They all appear to be filmed in the very same room they occupy! Realizing that they are trapped in their room with hidden cameras now aimed at them filming their every move, David and Amy desperately find a means of escape through locked doors, crawlspaces and underground tunnels before they too become the newest stars of the mystery filmmaker's next cult classic! (Read More)
Subgenre: | cult filmsurvival horrorsadistic horror |
Themes: | deathmurderdeceptionvoyeurismmurder of a police officer |
Mood: | slasherone night |
Locations: | police carmoteltunnel |
Story: | familiarcultbloodknifechasepistolshot to deathcar accidentshot in the chestflashlightstrangulationstabbed in the chestman with glasseshit by a carattempted murder β¦death of sonratobscene finger gesturestabbed in the stomachapplemasked mantrappedloss of sonlostblood on shirthandheld cameratitle at the endraised middle fingerstolen carvideo surveillancecar troublehit in the facecockroachtelephone boothmotel roombody in a trunksnuff filmhanged manstarssix shooterpsychological tortureraccoontruckerdirtcar mechaniccrushed by a carbritish actor playing american characterbarricadestabbed in the sidesparklerfinger cutestranged couplesingle locationbroken down caridentificationcrawlspacehit with a doorbickering couplevcr tapescratching facesunroofbeaniedragged by hair (See All) |
When a Yakuza boss named Anjo disappears with 300 million yen, his chief henchman, a sadomasochistic man named Kakihara, and the rest of his mob goons go looking for him. After capturing and torturing a rival Yakuza member looking for answers, they soon realize they have the wrong man and begin look β¦ing for the man named Jijii who tipped them off in the first place. Soon enough Kakihara and his men encounter Ichi, a psychotic, sexually-repressed young man with amazing martial arts abilities and blades that come out of his shoes. One by one Ichi takes out members of the Yakuza and all the while Kakihara intensifies his pursuit of Ichi and Ichi's controller Jijii. What will happen as the final showdown happens between the tortured and ultra-violent Ichi and the pain-craving Kakihara? (Read More)
Subgenre: | black comedyindependent filmmartial artscult filmart horror |
Themes: | exploitationsuiciderevengedeathmurdersurrealismdrugsrapetorturegangsterangercorruptiondeath of fatherbrutalitymafia β¦humiliationsadismcruelty (See All) |
Mood: | gorenightdarkness |
Locations: | bicyclecityrooftopbrothelrooftop fight |
Characters: | father son relationshipbrother brother relationshipprostitutebullyhitmanpimpself mutilationsuicide by hangingblonde asianjapanese mafia |
Story: | needlesfallviolencebloodfemale nuditycharacter name in titlenumber in titlemale nudityflashbackmasturbationbondagetwo word titlegun β¦nipplesknifetelephone callcryingcell phonebeatingdigit in titleunderwearblood splatterfoodfalling from heightmaskshootingvomitinginterrogationvoyeurcriminalkung fudecapitationbisexualbedroomassassinbased on comic bookgangmassacrestabbingthroat slittingtied to a chairsevered headanti herohit by a cartonguecontroversycigar smokingshot in the legpainorganized crimebeaten to deathcostumebased on mangaevil mankicked in the facebaseball batscreamhanginglong takemanipulationtragic eventglassesmurderersevered armtwincult directordismembermentcorrupt copchild murdercrime bosssyringestreetmass murderdrugsexual abuseragemutilationmobstermobclubsadomasochismmind controlblack humordead womans&mapartment buildingkickingdark humorkicked in the crotchhypnosisstabbed in the headaquariumdisembowelmentgang rapeperversiondead manmurder of a childslaughteryakuzadead boychainpunchcrowmob bosstorso cut in halfpervertintestinesbisexualitymysterious manneedleex copbandagemusclemanrepressionsexual perversionmasochismdegradationpiercingsoupman punching a womankickbloody body of childrazor bladehanged manextreme violencemafia bossbladesexual repressionstabbed in the facecleaningjumpingcut into piecesfemale victimchainssevered footviolent deathbroken necksexual humiliationhookhorror artsolidaritybitedepravityburningjumpshock humorarm ripped offcutbitingdutch anglesliced in twostabbed in the footburnsuspensionbitten handsexual sadismcriminal syndicatebodily dismembermentbroken fingerbanned filmsevered tonguedead prostitutesevered facegangster bossfalse memoryfiendentrailsshrimpmouthboy killeddenturesmisanthropytransgressionstabbed through the chinnumber 1 in titletransgressive filmtongue cut outextreme filmtasting bloodtongue piercingdecapitated childcinema extremewoman hatercredits rolling downpredator turns victimasian mobsexual victimshinjukupredator becomes preychelsea smilepushing the envelopehung by a hookboiling oilface cut offart censorship (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo β¦od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
Subgenre: | ghost storyparanormal activity |
Themes: | suicidedeathmurderfriendshipreligionghostpregnancyweddinginvestigationpsychopathsupernatural powerevilhome invasioncrueltytrauma β¦self sacrificedevilpolice investigationnear death experience (See All) |
Mood: | nightdarknessmoving |
Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
Characters: | policehusband wife relationshipafrican americanfrienddoctorfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godlittle girlkiller β¦christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
Period: | 1970syear 1969year 1970 |
Story: | vintagesuicide attemptcultviolencebloodf ratedcharacter name in titleone word titleflashbackfightphotographtitle spoken by characterknifechasebased on true story β¦telephone callfirecryingshot to deathblood splattershot in the chestslow motion scenepunched in the facewatching tvcamerashootingbookneighbordemonhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingnonlinear timelinenunno opening creditsdrawingchild in perilritualnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementhaunted housesacrificegraffitiblood spattercouplerecord playeroccultspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends β¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
Subgenre: | black comedyindependent filmcult filmsuspensesupernaturalparanormal phenomena |
Themes: | suicidedeathmurdersurrealismfearescapemonsterinvestigationdeceptionparanoiainsanityapocalypseself sacrificepolice brutalityghost town β¦end of mankind (See All) |
Mood: | neo noirnightmare |
Locations: | new york citybarchurchhotelcarsmall townbusbicycleelevatormoteltunneltownnew england |
Characters: | psychiatristpolicedoctorpolice officerwriterlawyersecretaryhomeless manself referentialinsurance agentevil monster |
Period: | 1990s |
Story: | posterviolencebloodflashbackdogguncigarette smokingtitle spoken by characterchasesurprise endingbeatingcorpseshot to deathblood splattercar accident β¦shot in the chestshot in the headshotgunarrestpaintingbookriflecar crashbathroomdemonhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilfoot chaseaxeambulancebridgedinerweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonecharacter's point of view camera shotmissing personlightningcrossfilm within a filmbasementsuspicionmurderercinemasevered armcult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudtorchend of the worldanimal attackschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murdermutationasylumriding a bicycleshot multiple timesmedia coveragealleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguninsane asylumcornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All) |
Jerry (Ryan Reynolds) is that chipper guy clocking the nine-to-five at a bathtub factory, with the offbeat charm of anyone who could use a few friends. With the help of his court-appointed psychiatrist, he pursues his office crush (Gemma Arterton). However, the relationship takes a sudden, murderous β¦ turn after she stands him up for a date. Guided by his evil talking cat and benevolent talking dog, Jerry must decide whether to keep striving for normalcy, or indulge in a much more sinister path. (Read More)
Subgenre: | black comedydark comedy |
Themes: | suicidemurderkidnappingdrunkennesspsychopathmental illnessevilchildhood trauma |
Mood: | gore |
Locations: | barbathtubpolice carchinese restaurant |
Characters: | psychiatristpolicefather son relationshipmother son relationshipserial killerkilleremployer employee relationshipstepfather stepson relationshipsuicide by fire |
Story: | violencebloodflashbackdogbare chested maleexplosionknifecryingtitle directed by femalecorpsebig breastscar accidentwatching tvcatvomiting β¦tearsrunningdead bodyhallucinationreference to jesus christcleavagestabbingthroat slittingstabbed to deathfishchild abusebrunettesevered headfactorydatecharacter says i love youdismembermentkillingblood spatterheavy raintherapistbarefoot malecrushdead womanbreakfastbossgas maskcamera shot of feetimaginationattempted suicideblood on facekaraokeco workerdelusionmedicationheavendeath of protagonistbutterflyaccidental killingmusical numbersexy womantied feetmale in showerreference to elvis presleytaking a showerdisposing of a dead bodyhearing voicesbowling alleyfactory workermercy killingoffice workerbare feetelvis impersonatorknife murdercut into pieceswhite brawet clothesschizophreniclocked in a roomtalking dogfeet on tableassisted suicidemale vomitingforkliftfridgeheadtalking headbiblical referencecaught in the rainroadkilltalking catabusive stepfatherchildhood homeknife woundstuffed animal toysock puppetcar won't startchildhood flashbacktape over mouthbritish womandismembered bodymale bare feetmurder by stabbingson murders motherwoman directorknife in chesttraumatic childhoodelvis presley impersonatorstood upfist bumppsychopath as protagonistbloody knifekilling a deerreflection in mirrorscared womanshippingvomiting in a toiletparanoid schizophrenicmentally ill mothermoving a dead bodyconga lineson kills motherkiller as protagonisttalking to a corpsekissing a dogreturning to childhood homeblack humourcompulsive hoardingmental illness in family (See All) |
Subgenre: | black comedyindependent filmcult filmsuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | revengedeathmurderfriendshipkidnappingfeartortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | slashergore |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | violencebloodsexcigarette smokingexplosionknifechasesurprise endingpistolfirecryingcell phonebeating β¦corpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendstabbed to deathtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
Themes: | revengedeathmurderfriendshipsurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic β¦self sacrificenear death experience (See All) |
Mood: | slashersatirespoofhigh schoolparodyambiguous ending |
Locations: | hospitalforestwoodssinging in a car |
Characters: | homosexualteenagermother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlserial killernursehostagekillermotherex boyfriend ex girlfriend relationship β¦parent child relationshipslasher killerself referentialparty girl (See All) |
Period: | 1980syear 1986year 1987 |
Story: | fanscultviolenceflashbacktwo word titlebare chested malecigarette smokingdancingexplosionknifechasethree word titlesurprise endingpantiesfire β¦cell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurf worddecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementstabbed to deathdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastbody countcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousemetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
Helen Lyle is a student who decides to write a thesis about local legends and myths. She visits a part of the town, where she learns about the legend of the Candyman, a one-armed man who appears when you say his name five times, in front of a mirror. Of course, Helen doesn't believe all this stuff, β¦but the people of the area are really afraid. When she ignores their warnings and begins her investigation in the places that he is rumored to appear, a series of horrible murders begins. Could the legend be true? (Read More)
Subgenre: | cult film |
Themes: | artrevengekidnappingbetrayalghostprisonfearescapefuneralinvestigationseductionangerpsychopathgriefabduction |
Mood: | slashergore |
Locations: | schoolelevatorwheelchairapartmentchicago illinoisslum |
Characters: | psychiatristpoliceboyfriend girlfriend relationshipserial killerphotographerartistlittle boymother |
Story: | cultbloodfemale nuditycharacter name in titleone word titledogkisscigarette smokingtitle spoken by charactersurprise endingfirebeatingcorpsemirror β¦paintingrunningcollegetelephonetoiletfalse accusationdrivingbathgravelegendstabbed in the backscreamingperson on firegraffitichild murderburned alivenipples visible through clothinggothicslow motionlifting someone into the aircovered in bloodparking garagemental institutionhatredmakeupbathingghettoblack eyedisfigurementcastrationbonfireframed for murdermental patientyellingtaking a photographlevitationneedlefolkloreforced to stripdead animalkilling a dogurban legenddiscoverybeeabandonmentgang violenceframedurban decaykidamputationbeliefmacabrealtarsecret passageaggressionhookbudweiserlifting female in airmuralhidden roomdead babyslide projectorrottweilerpublic restroomtall mandeath of doghousing projectlifting an adult into the airpast lifecheating on wifelynch mobfalse accusation of murderswarmdisbeliefdisembodied voicepolice lineupsociologistapartment complexaccused of murderfilthraw meatkiller beemedicine cabinetviciousnessbathroom mirrorbloody maryafter lifehook for a handhole in a wallabusive policemanloathingrepulsioncandymanloss of penisvacant apartmentdisbelieving authorityburnt hairhypnotized cast (See All) |
The killer doll is back! Glen, the orphan doll offspring of the irrepressible devilish-doll-come-to-life Chucky and his equally twisted bride Tiffany. When production starts on a movie detailing the urban legend of his parents' lethal exploits, Glen heads for Hollywood where he brings his bloodthirs β¦ty parents back from the dead. The family dynamics are far from perfect as Chucky and Tiffany go Hollywood and get rolling on a new spree of murderous mayhem; much to gentle Glen's horror. Chucky can't believe that his child doesn't want to walk in his murdering footsteps, and star-struck Tiffany can't believe that the movie will star her favorite actress, Jennifer Tilly, who soon becomes an unwitting hostess to this new family in more ways than one... (Read More)
Subgenre: | black comedymartial arts |
Themes: | murderkidnappingpregnancyescapefilmmakingevil |
Mood: | slashergore |
Locations: | hospitalcemeterylos angeles californiaengland |
Characters: | policefather son relationshipmother son relationshipserial killeractressdirector |
Period: | 2000s1990syear 1998 |
Story: | violencefemale nuditycharacter name in titlesequelmasturbationsurprise endingshowercar accidentface slapslow motion scenereenactmentvomitingsubjective cameradecapitationbound and gagged β¦stabbingdream sequencebirthday partylimousinefired from the jobperson on fireauditionpossessionscreamratsevered armloss of motherobscene finger gesturetwindismembermentoccultgothiccampinterracial romancedisembowelmentsexual humoraxe murderfifth partchauffeuracidwetting pantspatricidepaparazzihollywood signdarkroomartificial inseminationvillain not really dead clichesanta claus suitventriloquistset on fireevil dollhermaphroditereference to britney spearsnightiecandy barkiller dollreference to martha stewartincantationimmoralitytwo killersvixenvictim invited to dinneranimate dollevil versus evilmultiple birthturkey bastertwelve step programreference to john waters (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | black comedyindependent filmcult filmpsycho thrillersadistic horror |
Themes: | exploitationsuiciderevengedeathmurderfriendshipkidnappingrapebetrayalfeartortureescapedeceptionseductionanger β¦psychopathdeath of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismevilcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
Mood: | gorenightmareambiguous ending |
Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | policefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officerserial killernurse β¦hostagetough guyvillainmaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | cultviolencebloodsequelflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotograph β¦title spoken by characterexplosionknifechasepantiespistolshowerfireshootoutwoman on topbeatingdreamcorpseshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingimpalementcocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiesdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
Having discovered they could turn animals invisible, a group of scientists test the subject on a human. Head of research, Dr. Sebastian Caine decides to use himself as the subject. After the experiment can't be reversed, it takes a toll on Caine's personality, causing him to hunt down and kill his c β¦olleagues (Read More)
Subgenre: | black comedycult filmsuspenseslasher flicksurvival horror |
Themes: | revengedeathmurdersurrealismrapedrinkingfearescapevoyeurismangerpsychopathsupernatural powerparanoiainsanitysurveillance β¦evilpanictechnologymadness (See All) |
Mood: | slasher |
Locations: | restaurantswimming poolelevatorlaboratory |
Characters: | boyfriend girlfriend relationshipfemale protagonistreference to godsecurity guardbabe scientistslasher killer |
Period: | 2000s1990s |
Story: | violencebloodfemale nudityfemale frontal nuditymale rear nuditydogbare chested malegunkissfightnipplesexplosionchasepanties β¦showertelephone callfiredreamcorpseunderwearblood splattermirrorshot in the chesturinationface slappunched in the facecomputerdrinkthongmaskvomitingshowdownsunglassesbombdead bodycafebathroomvoyeursciencescientistsurvivalfoot chasestrangulationimpalementman with glassesanti herounderwater scenedrowningtransformationstalkerdangerstabbed in the backsuburbperson on fireelectrocutioninjectionpursuitstalkingneck breakingratfirst partcult directormonkeywashington d.c.experimenteavesdroppingburned alivekilling an animalwarehousemass murdercagesociopathlifting someone into the airstabbed in the stomachmad scientistpoolcovered in bloodcgipeeping tomrampagetrappedsurveillance cameraresearchthirty somethingbody countcharacters killed one by onelasersightkilling spreeflamethrowerburned to deathsports carpipe smokinggeniusvillain played by lead actorinvisibilityfire extinguishertimebombveterinariankilling a dogacidgorillabroken windowanimal abuseelectric shockgiving a toastseizuretop secretburnt bodysole black character dies clichecowardchainedexperiment gone wrongquarantineromantic rivalryanimal experimentationdeath of title characterhuman experimentreference to supermanlocked in a roomelevator shaftpentagonvillain not really dead clichescience runs amokscientific researchloss of controlresearchertragic villainhuman experimentationevil scientistmagnetanimal testingvisionaryinvisible mancaressingmedical researchtranquilizerinfra redfly the insecticiclesprinkler systemmurder by drowningsecret projectsee you in hellanimal bitecardiac arrestreference to wonder womancode breakingdart gunfreezing to deathlockdownfalling down an elevator shaftvideo screennu metalnitromale antagonistunderground laboratoryveinsulfuric acidbreaking glass windowreference to jonas salk (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon β¦don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | black comedymartial artscult filmcoming of agesuspensesupernaturalheist |
Themes: | suiciderevengedeathmurderfriendshipsurrealismkidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power β¦paranoiasurveillanceevilhome invasionpanic (See All) |
Mood: | gorenightmare |
Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
Characters: | father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
Period: | 2000s |
Story: | suicide attemptviolencebloodsexcharacter name in titlenumber in titleflashbackbare chested malegunfightphotographexplosionpartyknifelesbian kiss β¦chasesurprise endingpistoldreamcorpseshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
Will Graham is a former FBI agent who recently retired to Florida with his wife Molly and their young son. Graham was a 'profiler'; one who profiles criminal's behavior and tries to put his mind into the minds of criminals to examine their thoughts while visiting crime scenes. Will is called out of β¦his self-imposed retirement at the request of his former boss Jack Crawford to help the FBI catch an elusive serial killer, known to the press as the 'Tooth Fairy', who randomly kills whole families in their houses during nights of the full moon and leaves bite marks on his victims. To try to search for clues to get into the mind of the killer, Will has occasional meetings with Dr. Hannibal Lecktor, a charismatic but very dangerous imprisoned serial killer that Will captured years earlier which nearly drove him insane from the horrific encounter that nearly cost Will's life. With some help and hindrance, Will races against the clock before the next full moon when the 'Tooth Fairy' will strike again. Elsewhere, a local photographer named Francis Dollarhyde, the killer that Will is looking for, struggles to stay undetected while seeing a hope of redemption when be begins a relationship with a blind woman who is not aware of his double life. (Read More)
Subgenre: | independent filmcult filmsuspense |
Themes: | deathmurderkidnappingprisontortureinvestigationpsychopathbrutalityguiltinsanitysadismhome invasioncannibalismblindnessmadness β¦murder of a police officermurder of family (See All) |
Mood: | slashergoreneo noirstylization |
Locations: | beachforestairplanewoodswheelchairpolice station |
Characters: | psychiatristpolicehusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshiptattooserial killerdetectivehostagehomosexualityvillainmysterious killer |
Period: | 1980s |
Story: | mindcultviolencebloodbased on novelone word titlebare chested maleguncigarette smokingphotographtelephone callcell phoneshootoutdream β¦corpseshot to deathblood splattercar accidentmirrorshot in the chestshotgungunfightkissingshootingshowdownheld at gunpointrevolvercriminaltelephonegood versus evilgay slurjournalistambushstabbed in the chesttied to a chairman with glassesanti heroshot in the legstalkerhotel roomfbiperson on firemistaken identityrace against timeevil manstalkingtrappremarital sexcharacter says i love younewspaper headlinewashington d.c.freeze framesupermarketelectronic music scoregothictape recordersociopathfbi agentvideotapefloridapsychohome movieparking garagecrying manwhite housemental institutioncrime scenepump action shotguncannibalgash in the facemental hospitalpsychotronicmiami floridapolice officer shotjumping through a windowblack eyemurder of a childdisfigurementtigernotekilling spreephoneburned to deathholding handsman cryingserial murderpsychopathic killerveterinarianhuman monsterpolice officer shot in the chestbroken mirrorbearded mankiss on the lipsscene of the crimeblind womanpalm treepsychoanalysisdarkroompsychological torturewatching a videoman on firebaltimore marylandsadistic psychopathtoilet paperbreaking a mirrorpsychosisnewspaper reporterwoman in dangerdepravityman in a wheelchairslide showtalking to oneselfset on fireposing for a photographcriminal mastermindcoming out of retirementst. louis missouriliterary adaptationweirdofamily in dangerslide projectorends with freeze frameforensicsphone conversationfamous songoedipus complexgrocery shoppinganthropophagusneonreference to the new york timesvoice recordingtwo killerscharacter appears on front page of a newspaperreference to houdinicode breaking8 trackreference to harry houdiniprofilervisually impaired personclimbing a ropefamily photohomicide investigationlighting a cigarette for a womantabloid reporterfirearm pointed at the cameraphoto labphotograph in newspaperreference to william blakefbi profilerhannibal lecterface slashedgin and tonichaving picture takenbalding mannote read aloudfax transmissioncamera flashmalevolencevhs videoex fbi agentlighting a cigarette for someonepreventing a murderforensic psychiatristmuzzle flashphreakingpunching one's fist into a mirrorred dragontied to a wheelchair (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those β¦friends. (Read More)
Subgenre: | cult filmslasher flickamerican horror |
Themes: | exploitationrevengedeathmurderpsychopathabduction |
Mood: | slashergoredarkness |
Locations: | lake |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boyserial killerkillervillainterrorslasher killerserial murdererlow self esteemmysterious killer |
Period: | 1980s |
Story: | nuditybloodsexnumber in titlesequelshowerdigit in titlebikinimasknumbered sequelsubjective cameraaxeimpalementthird partcharacter's point of view camera shot β¦evil manmurderercabinsevered armdismembermentsplattermaniacmass murdermachetelifting someone into the airragebarnroman numeral in titlepsychosevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killerpsycho killertorso cut in halfserial murderpsychopathic killerbad guycar troublemadmandefecationhuman monstersexual violencehomicidal maniacslashingshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmurder spreemass murdererdisturbed individualgrindhouse filmcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthcult favoriteserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
The film revolves around Park Hee-bong, a man in his late 60s. He runs a small snack bar on the banks of the Han River and lives with his two sons, one daughter, and one granddaughter. The Parks seem to lead a quite ordinary and peaceful life, but maybe they are a bit poorer than the average Seoulit β¦e. Hee-bong's elder son Gang-du is an immature and incompetent man in his 40s, whose wife left home long ago. Nam-il is the youngest son, an unemployed grumbler, and daughter Nam-joo is an archery medalist and member of the national team. One day, an unidentified monster suddenly appears from the depths of the Han River and spreads panic and death, and Gang-du's daughter Hyun-seo is carried off by the monster and disappears. All of the family members are in a great agony because they lost someone very dear to them. But when they find out she is still alive, they resolve to save her. (Read More)
Subgenre: | black comedyindependent filmcult filmsuspensetragedycreature featureasian horror |
Themes: | suiciderevengedeathmurderkidnappingbetrayalfeardrunkennessescapefuneralmonsterdeceptionmilitaryangerdeath of father β¦dysfunctional familygriefabductionpanicunemploymenthomelessnessenvironmentself sacrificenear death experience (See All) |
Mood: | goresatirerain |
Locations: | hospitalsnowboatwatertaxielevatorpolice cartrucktunnelsewer |
Characters: | policefamily relationshipsfather son relationshipfather daughter relationshipteenagerdoctorchildrenbrother brother relationshipbrother sister relationshipteenage girlsoldierpolice officernursephotographerhostage β¦little girllittle boydaughteramericanamerican abroadsingle fatherfishermangrandfather granddaughter relationshiphomeless man (See All) |
Period: | 2000syear 2000year 2006 |
Story: | hypodermicviolencebloodone word titletwo word titlephotographtitle spoken by characterexplosionchasesurprise endingpistolfirecryingcell phoneblood splatter β¦urinationshotgunrescueslow motion scenewatching tvcamerashowdownrifleheld at gunpointbeertearsislandriverscientistsurvivalfoot chaseorphanflashlightgangambushdisguiseambulancebridgearmyimpalementmapfishfishingchild in perildouble crosscreaturesearchvannews reportlatex glovesflash forwarddangerprologueprotestpoisonrace against timecover updeath of childdeath of brotherinjectiontragic eventgovernmentsleepingsacrificesingle parenteavesdroppingsabotagesyringebow and arrowathleteburned alivehypodermic needleheavy rainmutantvirusdemonstrationmorguenosebleedgiantdesperationjumping from heightskullparking garageanimal attackcrushed to deatheaten alivegas maskrampagepump action shotgunremote controlbraverymourningpower outagehungerevacuationheadphonesescape attemptdead childinfectionpollutiongasolinemutationburned to deathsirenmedia coverageparking lottext messagingfinal showdownmolotov cocktailkoreagiant monstersuit and tiedead childrenshot with an arrowarcherymedalchangeshot in the eyewetting pantsmegaphoneteenage daughtertentaclesouth koreashot through the mouthquarantinearcherhomeless personrecreational vehicletoxic wastecoughing bloodcheckpointpsychotronic filmimprovised weaponanimal killingmortuarygiant animalgrindhouse filmstarvinglootingdustflaming arrowrescue attemptkaijujumping off a bridgesquidhazmat suitflash driveboneshuman skulltarget shootingmealblood samplebiohazardvomiting bloodchild in dangersocial criticismreference to robin hoodlong tongueseoulbeer cancollege graduatetoxicurinating in fearman eating monsterchild eatenboy eatenpaddle boatbio hazardkiller fishman versus naturedemonstratorformaldehydelazyworld health organizationjumping from a bridgemounted animal headeaten by animalman versus monstersnack barbullseyecell phone tracedropkickirresponsible fatherriot squadchild killed by an animalbronze medalworld cinema (See All) |
Shaun doesn't have a very good day, so he decides to turn his life around by getting his ex to take him back, but he times it for right in the middle of what may be a zombie apocalypse... But for him, it's an opportunity to show everyone he knows how useful he is by saving them all. All he has to do β¦ is survive... And get his ex back. (Read More)
Subgenre: | black comedyindependent filmcult filmpost modernbritish comedyzombie apocalypsezombie survivalbritish horrorzombie outbreak |
Themes: | deathfriendshipmilitarydeath of mothercannibalism |
Mood: | goresatiresocial satirezombie parodyzombie film |
Locations: | london england |
Characters: | husband wife relationshipmother son relationshipboyfriend girlfriend relationshipzombieactressbest friendstepfather stepson relationshipzombie girl |
Period: | 2000s |
Story: | cultviolencecharacter name in titleexplosionchasesurprise endingcryingcell phoneshot to deathmachine guncar accidentshot in the chestslow motion scenerifledead body β¦neighborf worddecapitationthroat slittingimpalementfour word titlesevered headno opening creditsanti heroroommateshot in the foreheadbeaten to deathsuburblong takesevered armflowerloss of motherpubdismembermentarsonanswering machinefriendship between menlifting someone into the airswat teamimpersonationflatulenceeaten alivebreakupgash in the faceconvenience storedisembowelmentsalesmanslackersiegeloss of husbandsevered legshot multiple timesspoof titlehit and runbeheadingaccountantmolotov cocktailshot in the necktelevision newsjukeboxclimbing through a windowold ladyshot in the eyebitten in the neckbritainlook aliketrampolineflesh eating zombiehit with a shovelzombie violenceimprovised weaponbroken bottlesecret lovewinchester riflezombie attackgeneration xflower shoptv show in filmzombie childinkpool cuedartcar alarmtire ironmale tearsair raid sirencricket batcorkscrewflesh eating zombiesshot repeatedlythe color redzombie biteshop assistantbitten by a zombieimpressionrecord collectiontool sheddysfunctional societyreference to queenelectronic storebloody handprintssmashing through a windowtetherballzombie walkhuman versus zombienational emergencykilling a zombie (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | suspensesupernaturalparanormalpsycho thriller |
Themes: | suicidedeathmurderkidnappingmarriagerapeghostprisonfeartortureescapememorypsychopathsupernatural powerparanoia β¦drug useinsanitymental illnesssurveillanceevilunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | slashergorerainneo noirnightmaredarkness |
Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
Characters: | psychiatristpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipdoctortattoofemale protagonistserial killernursepolicemanlawyerreference to god β¦killersecurity guardvillainsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | suicide attemptviolencebloodsexfemale nudityf ratedfemale frontal nudityinterviewflashbackbare chested malegunkissfightphotograph β¦explosionknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcorpseblood splattercar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerawomanthroat slittingbridgeprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Sang-hyun, a priest working for a hospital, selflessly volunteers for a secret vaccine development project intended to eradicate a deadly virus. However, the virus eventually takes over the priest. He nearly dies, but makes a miraculous recovery by an accidental transfusion of vampire blood. He real β¦izes his sole reason for living: the pleasures of the flesh. (Read More)
Subgenre: | black comedycult filmtragedysupernatural horror |
Themes: | suicidedeathmurderinfidelityrapereligiondrunkennessexperimentalsupernatural powercancerfaithchildhoodcatholic guilt |
Mood: | gore |
Locations: | hospitalwheelchairocean |
Characters: | husband wife relationshipmother son relationshipfrienddoctornursepriestvampirechristianitylustcatholicself mutilationchildhood friendcatholic priestmother in law daughter in law relationshipsex with a priest β¦self inflicted injury (See All) |
Period: | 2000s |
Story: | bloodone word titlemale frontal nuditymasturbationmale rear nuditybare chested maletitle spoken by characterknifepantiessongcorpseface slap β¦falling from heightliehallucinationprayermale pubic hairmenage a troisbrastrangulationvideo cameraambulancestabbed in the chesttied to a chairfishinghit by a cardrowningparkfantasy sequencetentattempted rapefemale full rear nudityneck breakingcheating wifeafricanburned aliveflyingdesireloss of virginitycomadiseasevirusbuttockstoe suckingstabbed in the throatfirst kisssuninfectionhealingbody landing on a carmale full rear nudityblind manbroken armpassionate kissmahjongvodkaprayingex coppaintfluteconfessionalfemale vampiresicknessvolleyballwrist slittingconsciencesouth koreawheelchair boundashesburnt bodyexperiment gone wrongdigging a gravecoughing bloodlocked in a roomsevered footjumping from a rooftopmedical experimentblood drinkingdrinking bloodlifted by the throatblood transfusioncprhead bandagefinger cutwaterbedobese manblood vomitingfilipinajumping off a buildingdoomed romancevampire sexjumping from a windowear bleedingbleeding from eyesblisterchildhood friendshiding in a car trunkbone breakinglesionfinger suckingloud noisemale genitaliadeadly viruseye blinkingback to lifedeath by sunrise (See All) |
Worn down and out of luck, aging publisher Will Randall is at the end of his rope when a younger co-worker snatches both his job and wife out from under his nose. But after being bitten by a wolf, Will suddenly finds himself energized, more competitive than ever, and possessed with amazingly heighte β¦ned senses. Meanwhile, the beautiful daughter of his shrewd boss begins to fall for him - without realizing that the man she's begun to love is gradually turning into the creature by which he was bitten. (Read More)
Subgenre: | black comedycult film |
Themes: | revengedeathmurdermarriageinfidelitybetrayaladulterypsychopathwealthhuntingpolice investigation |
Mood: | satiremyth |
Locations: | new york cityhotelsnowelevatorkitchenurban settingpolice stationoffice |
Characters: | policehusband wife relationshipfather daughter relationshippolice officerwriterlawyersecurity guardpolice detectivesecretaryolder man younger woman relationshipemployer employee relationshipolder woman younger man relationship |
Period: | 1990swinter |
Story: | fallbloodone word titlephotographtitle spoken by characterpartypantiespistolshot to deathhorseurinationslow motion scenewatching tvcomputerbrawl β¦bookshowdownanimal in titleinterrogationhandcuffsrevolvermanhattan new york cityjournalistambulancemansiontoiletnews reporttransformationparkfired from the jobattempted rapehorse ridingpremarital sexwerewolfwolfhypodermic needlebarnloss of wifejumping from heightfull moonsevered fingerunfaithful wiferejectionzooco workermedical examinationsexy womandeerowllingerie slipphoto albumcontractfire extinguisherloss of jobhairpublishermetaphorcrisisphysicianeditorbillionaireyuppiemetamorphosisdnasense of smellstablemuggingcleaning ladywoman wearing only a man's shirtfatal attractionamuletpitchforkhypocritenew york skylinetycoonchrysler building manhattan new york citysnoringbitten in the throateast indianvermontdead brotherhowlingroadkillmuggerpreywolf packinstinctracehorseeyesightpublishing houseriding accidentlycanthropewerewolf biteprofessionfive senseswolf bite (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | exploitationdeathmurderdrugsrapetortureincestpsychopathbrutalityinsanityevilmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | brother sister relationshipprostituteserial killerkillervillainterrorslasher killermysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | nudityviolencebloodfemale nuditycharacter name in titlebare breastsgunsurprise endingshot to deathblood splattershot in the chestlow budget filmmarijuanacriminal β¦decapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherbody countkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji β¦mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
Subgenre: | black comedyindependent filmcult filmsuspenseabsurdismcreature featureteen movieteen horrormonster movielgbt horror |
Themes: | revengedeathmurdersurrealismjealousyfeardrunkennessescapemonsterseductionsupernatural powerparanoiawrestlingrivalryhome invasion |
Mood: | satirehigh schoolnightmare |
Locations: | barlos angeles californianightclubelevatorpolice carofficemuseumfire truck |
Characters: | policehomosexualteenagerboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature |
Period: | 2000s |
Story: | nudityviolencebloodmale nudityone word titlemale rear nuditydogbare chested malekissfemale rear nudityfightphotographtitle spoken by characterpartyknife β¦chasesurprise endingpistolcell phonebeatingcorpseshot to deathfistfightcar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the faceswordbrawlbare buttfalling from heightshowdowncar crashdead bodybathroomdecapitationfoot chasegay slurorphanambushcaliforniamassacreambulancestabbed to deathdinerstabbed in the chestinternetsevered headhit by a carcreaturenews reporttransformationshot in the foreheadpublic nuditylimousinecursecoming outelectrocutionattackproduct placementknocked outkicked in the faceshot in the shoulderscargymhigh school studentcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzawerewolfactor playing himselfwolflooking at oneself in a mirrorscene during opening creditscatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivalanimal attackeaten alivefull moonrampagecameoblood on facestabbed in the throatpower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowbody landing on a carcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hosthuman becoming an animalcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalahowlingwoman hits a mangay jokesilvertroubled productiongay athletepublicistlycanthropypalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationlycanthropeburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | black comedyindependent filmmartial artspost modernhorror spoof |
Themes: | revengedeathmurderkidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheftbrutality β¦paranoiacelebrityhome invasioncourage (See All) |
Mood: | slashergoresatirenightmare |
Locations: | barswimming poolhelicopterlos angeles californiaapartmentpolice stationpolice car |
Characters: | policefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officerserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm directorex boyfriend ex girlfriend relationship β¦death of girlfriendself referentialpregnant from rape (See All) |
Period: | 2000s1990s |
Story: | violencebloodf ratednumber in titlesequeldogbare chested malefightcigarette smokingphotographpartyknifechasesurprise endingpistol β¦showercell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretfalling from heightmaskshowdownheld at gunpointsunglassesbirthdaycar crashhallucinationhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalfoot chaseflashlightjournalistbound and gaggedambushstrangulationambulancemansionthroat slittingstabbed to deathtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingrace against timecover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
Subgenre: | black comedycult filmsuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
Themes: | suiciderevengedeathmurderfriendshipsurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoiapanic β¦homelessnessmurder of a police officermurder of family (See All) |
Mood: | goresatirenightmaremurder of a boy |
Locations: | hospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtrucktaxi driver β¦laboratorysex in shower (See All) |
Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
Period: | 1980s |
Story: | suicide attemptnudityviolencebloodsexfemale nuditymale nuditybare breastsfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested malesex scene β¦female rear nuditycigarette smokingknifechasesurprise endingshowertopless female nuditydreamcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off β¦and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | exploitationsuicidedeathghostdrunkennesspsychopathbrutalityinsanityevilhomelessnessmurder of a police officerdeath of daughter |
Mood: | slashergorerainnightmaredarkness |
Locations: | hospitalhelicopterstrip club |
Characters: | psychiatristmother son relationshipfather daughter relationshiptattoosingerserial killersniper riflecoroner |
Story: | violencebloodfemale nuditynumber in titlesequelfemale frontal nudityinterviewflashbackfemale rear nuditysingingpartychasepistolbeatingdream β¦corpseblood splattercar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperf worddecapitationhalloweenflashlightbandstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackevil manhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzamaniacsurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybody countbroken armaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
Subgenre: | black comedy |
Themes: | deathmurderfriendshipbetrayaldrunkennessguilt |
Mood: | slashergorehorror movie remake |
Locations: | kitchenfire truck |
Characters: | father son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend |
Story: | violencebloodfemale nudityfemale frontal nuditymale rear nuditybare chested malefemale rear nuditypartyknifechasesurprise endingpantiesshowerfire β¦cell phonecorpseblood splattermirrorshot in the chestblonderemakeshotgunslow motion scenepunched in the facebare buttsecretvomitingheld at gunpointlingeriecollegehallucinationhandcuffsvoyeuralcoholcleavageflashlightstrangulationaxeambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
Ana goes home to her peaceful suburban residence, but she is unpleasantly surprised the morning that follows when her husband is brutally attacked by her zombified neighbor. In the chaos of her once picturesque neighborhood, Ana flees and stumbles upon a police officer named Kenneth, along with more β¦ survivors who decide that their best chances of survival would be found in the deserted Crossroads Shopping Mall. When supplies begin running low and other trapped survivors need help, the group comes to the realization that they cannot stay put forever at the Shopping Mall, and devise a plan to escape. (Read More)
Subgenre: | black comedycult filmsuspensedark comedypost apocalypsesurvival horrorzombie apocalypseamerican horrorzombie outbreakfrench horrorcanadian horrorjapanese horror |
Themes: | suicidedeathmurderpregnancyfearbrutalitysadismapocalypsecannibalismself sacrificemadness |
Mood: | goredarknesshorror movie remakeblood and gore |
Locations: | hospitalhelicopterboatelevatorcitysex in showeryachtsewer |
Characters: | policezombiepolice officernursepolicemanbabyinterracial relationshipsecurity guardsniperterrorzombie baby |
Period: | 2000syear 2003 |
Story: | violencebloodfemale nuditydogbare chested malegunexplosionsurprise endingpistolcorpseshot to deathblood splattercar accidentremakeshot in the head β¦shotgunslow motion scenegunfightdead bodybathroomislandrevolverf wordsubjective camerasurvivalgay sluraxevideo cameraambulancewomanmontageimpalementexploding carsevered headhit by a carshot in the legshot in the foreheadbinocularsprologuesuburbperson on firecharacter's point of view camera shotshot in the shoulderhairy chestchildbirthexploding bodyloss of fatherdie hard scenariodirectorial debutprofanityshot in the armhandgunsplatterchesschainsawmachismogolfwoundmass murdervirusloss of loved oneparking garageend of the worldgun fuback from the deadgun battleeaten aliverear entry sexshopping mallstabbed in the headexploding headinfectionaccidental killingsiegestabbed in the eyelens flaresurprise after end creditsbullet timetorso cut in halfpervertblood on camera lensliving deadkillhead blown offhideoutmallbullet balletshot in the eyeanarchyhillbillystrong languagegun duelfriends who live togetherconsumerismextreme violenceflesh eating zombiegraphic violencewalking deadcrowbarzombie violenceblack copstarvingbody partoutbreakzombie attackbitten in the throatmarinathroat rippingdoomsdaystudio logo segues into filmmidwestzombie childmayhembodily dismembermentflesh eatingactress breaking typecastevil deadgun storeanthropophagusgory violenceremake of cult filmzombificationairbageating human fleshhell on earthbody partschainsaw murdercut in halfflesh eating zombiesdeadly diseasesurvivingend of civilizationcelebrity look alikezombie invasionviaducthuman versus undeadhuman versus zombiereference to dairy queenremake of sequel (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | black comedyindependent filmcult filmsuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | exploitationrevengedeathmurderfriendshipdrinkingfeardrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited love β¦home invasionpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed |
Characters: | policefather son relationshipafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | violencebloodfemale nudityfemale frontal nudityflashbackmasturbationdogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographparty β¦knifechasesurprise endingpantiespistolshowerfirecell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushaxemassacreambulancedeath of friendimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
In an Earthly world resembling the 1950s, a cloud of space radiation has shrouded the planet, resulting in the dead becoming zombies that desire live human flesh. A company called Zomcon has been able to control the zombie population. Zombies can be temporarily neutralized by being shot, but can onl β¦y be permanently neutralized by their brain being destroyed. Their ultimate disposal is through cremation, or burial, the latter which requires decapitation with the head being buried separately from the body. Conversely, Zomcon has created the domestication collar, when activated and placed on a zombie makes the zombie controllable and thus an eternally productive creature within society. Because all dead initially become zombies, the elderly are viewed negatively and suspectly. And all people, adult or child, learn to shoot to kill to protect society. Zomcon is the go to organization for all things zombie. In the town of Willard, the Robinsons - father Bill, mother Helen, and adolescent son Timmy - are one family who don't own a zombie as a domestic since Bill is afraid of zombies, as, when he was a child, he had to shoot his own zombie father, who tried to eat him. Bill has thus become fascinated with funerals to see zombies put away permanently. But Helen feels pressured to get a zombie when Zomcon's new head of security in Willard, the officious Jonathan Bottoms, moves into the neighborhood with his family. Never having had to deal with a zombie directly, Timmy is initially waβ¦ (Read More)
Subgenre: | black comedycult film |
Themes: | exploitationdeathmurderfriendshippregnancyfuneralmonstercrueltycannibalismfirst loveunlikely hero |
Mood: | goresatirespoofmurder of a boy |
Locations: | cemeterykitchen |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipboyzombiewarriorbully |
Period: | 1950s |
Story: | domesticshootcharacter name in titleone word titlekisscigarette smokingchasemachine gunshot in the chestshot in the headslow motion scenewatching tvrunningdead bodyneighbor β¦classroomdecapitationsevered headcoffinhit by a carcreatureold womanshot in the foreheadbeaten to deathsuburbscreamsevered armnewspaper headlineeaten aliverampageremote controltarget practicechild's point of viewchild protagonisthousewifemurder of a childsiegedead boysevered legneighborhood12 year oldfenceacidpeer pressurehazingunplanned pregnancykiller childzombie violencedelivery manevil corporationzombie attackgrave diggingevil childconformitytied to a treechild with a gunchild killerzombie childnext door neighborleashmass destructionwalkercanuxploitationreal life mother and daughter playing mother and daughterloud shirtchild as main characterchild uses a gunmultiple monsterswashing a carlawn mowingboy in perilboy dog relationshipbb guncrossing guardboy in dangerbloodthirstylove slaveemotionally unavailable (See All) |
When detective Eric Matthews is called to a crime scene of a victim of Jigsaw, he finds a lead to the place where he is hidden. Once there, he realizes that Jigsaw trapped his son Daniel Matthews with three women and four men in a shelter, and they are inhaling a lethal nerve gas. If they do not use β¦ an antidote within two hours, they will die. Eric follows with increasing desperation the death of each member of the group in monitors, while trying to convince Jigsaw to release his son. (Read More)
Subgenre: | survival horrorsadistic horror |
Themes: | deathmurderkidnappingtorturebrutalitydrug usecancersadismpanicdrug addictionpolice brutality |
Mood: | gorenightmare |
Locations: | bathtubelevator |
Characters: | policefather son relationshippolice officerserial killerdetectiveself mutilation |
Story: | needlessuicide attemptviolencebloodsequelflashbackbare chested malesurprise endingpistolfirecorpseshot to deathblood splattershot in the headslow motion scene β¦vomitingsecond partflashlightdrug dealerthroat slittingimpalementtoiletstabbed in the chestchild in perillatex glovesargumentdrug addictelectrocutionbaseball battrapheroinarsoncorrupt copsyringeburned alivehypodermic needlegothictape recorderlifting someone into the aircrying womanvillainesscrying manbroken legmale underwearsurveillance camerajunkiespecial forcessafebooby trapblood on shirtpolice raidjuvenile delinquentcharacters killed one by onegothneedleshoutingmind gameshot in the eyedripping bloodrazor bladesawcowardcop killerflamepsychological torturespitting bloodman on firesole survivorracial stereotypetrapdoorsevered footcrooked copvcrknife in the chestantidoteevil dollcrematoriumoxygen maskbodily dismembermentbroken fingerlifting a female into the airlifting an adult into the airgame of deathfurnaceboxer briefsflamespig maskviolence against a childtorture deviceplaying godviolent copnerve gasvillain escapesfamous themethroat slit (See All) |
Signing a contract, Jack Torrance, a normal writer and former teacher agrees to take care of a hotel which has a long, violent past that puts everyone in the hotel in a nervous situation. While Jack slowly gets more violent and angry of his life, his son, Danny, tries to use a special talent, the "S β¦hining", to inform the people outside about whatever that is going on in the hotel. (Read More)
Subgenre: | cult filmamerican horrorbritish horrorcult classic |
Themes: | murdersurrealismmarriageghostpsychopathsupernatural powerdysfunctional familyinsanitycannibalismwritingwilderness |
Mood: | nightmareambiguous ending |
Locations: | barhotelhelicoptersnowairplanebathtubairportelevatorkitchen |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipdoctorwriter |
Period: | 1980swinter |
Story: | domestic violencecultbloodfemale nuditybased on novelfemale frontal nuditytwo word titlefemale full frontal nudityphotographtitle spoken by characterchasesurprise endingmirrorslow motion scenebathroom β¦hallucinationgood versus evilaxewomanfemale pubic hairchild abusechild in perilbartenderracial slurcostumepossessionbaseball batskeletonactor shares first name with characterlong takeisolationhauntingtypewriterpsychicchild murdermaniactv newsfalling down stairselectronic music scorelifting someone into the airice creamcookblockbusternew year's evehomereincarnationjob interviewmiami floridabutlerhit on the headabusive fatheraxe murdertelepathyvillain played by lead actorpsychopathic killercartoon on tvmazehomicidal maniacrestroomimaginary friendcoloradopremonitionwriter's blockidentical twinssole black character dies clichefamous scoreoverhead camera shotcaretakerchapter headingsbutcher knifemass murdererfamous linetranceradio broadcastvolkswagen beetleballroom dancinglabyrinthtoy carsnowstormfreezerfrozen bodyextrasensory perceptiontricyclebreaking down a doorghost childtwin sistersfilicidedenver coloradorepetitionable to see the deadbased on the works of stephen kingrocky mountainshorror movie remadehypothermialifting a male into the airpediatricianuxoricidestore roomcanned foodforest rangeralcoholic relapsefreezing to deathpantryshot in sequencemagical negro stereotypehaunted hotelhedge mazehome sweet homebear suitpsychological disintegrationcabin feverfilmed in mirrorwriting backwardsadvice from bartenderescape through a bathroom windowtwo way radio (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
Themes: | revengedeathmurderfeardeceptionpsychopathsurveillanceevilmurder of a police officer |
Mood: | slashergoresatire |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | psychiatristteenage girlteenage boyserial killernursekillersecurity guardvillainslasher killercoroner |
Period: | 2000s |
Story: | violencebloodfemale nuditysequelflashbacktwo word titlefightknifechasesurprise endingfirecell phonecorpseblood splatter β¦fistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | black comedyindependent filmcult filmsupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
Themes: | deathmurdersurrealismdrugsghosttorturepsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia |
Mood: | slashergorerainhigh schoolnightmaredarkness |
Locations: | small townairplaneroad trip |
Characters: | family relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american β¦evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | posterviolencebloodf ratedcharacter name in titlesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in titletitle directed by femaledreamblood splatter β¦rescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation β¦at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)
Subgenre: | independent filmslasher flickamerican horror |
Themes: | deathmurderfriendshipfearescapeevilself sacrifice |
Mood: | slasherdarkness |
Locations: | forestcarbathtubbuspolice stationpolice carrunning in the forest |
Characters: | psychiatristpolicefrienddoctorgirlpolice officerserial killernursevillainuncle niece relationshipslasher killer |
Period: | 1980s20th century |
Story: | violencebloodcharacter name in titlenumber in titlesequeldoggunkissphotographexplosionpartyknifechasesurprise endingcrying β¦mirrorcatfalling from heightmaskrunningsubjective cameragood versus evilhalloweencandleambulancestabbingdeath of friendweaponexploding carchildanimalcoffinchild in perilpolice officer killedattempted murdertreedangercostumescreamingcharacter's point of view camera shotscreambracelethangingautomobilethreatneck breakingtrapratmurderersplatterhateholidayropehuggingheroinelooking at oneself in a mirrorslow motionlifting someone into the airbarnloss of friendhidingmasked manpresumed deaddeath threatpsychotronicscissorsstairsdead manbody countfieldlaughingfifth partsequel to cult favoritekilling spreepumpkinlightsirenmasked killerdead dogreflectionserial murderpetbad guypresentyellingtablereturning character killed offlaundrydead animalold dark househuman monsterdiscoveryclimbingkittenglasslocked doorhanged mancapemasked villainpitchforkscythemass murdererliquidstabbed with scissorssittingemergencydustlight bulbpolice officer knocked unconsciousmichael myerscarrying someonelifting a female into the aircrawlingboogeymanpleadingcrying childjumpsuitunmaskingopening a windowstringcult film referencestrawpink dressserial teen killertrailer narrated by don lafontaineattempted child murderpolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t β¦he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | black comedymartial artssuspenseconspiracydystopiasurvival horrorpolitical conspiracy |
Themes: | exploitationrevengedeathmurderfriendshipkidnappingbetrayalpoliticsfearescapedeceptioncorruptionpsychopathbrutalityparanoia β¦insanitysadismsurveillancehome invasionhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
Mood: | slashergorenight |
Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
Characters: | african americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifleself mutilation |
Period: | near future |
Story: | violencebloodsequelflashbackbare chested malefightphotographexplosionknifechasepistolfirecell phoneshootoutbeating β¦corpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorswordgunfightbrawlshowdownrifleheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf worddecapitationsurvivalflashlightbound and gaggedgangambushaxemassacreambulancedeath of friendmontagestabbed to deathmixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapsevered headman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carritualvanthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeevil manknocked outkicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47chainsawhand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
Subgenre: | black comedyindependent filmcult filmdark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror |
Themes: | deathmurderrapeghostdancesupernatural powersadismevilsupernatural rapebook of evil |
Mood: | slashergoreone night |
Locations: | forestcarwoodssinging in a car |
Characters: | friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism |
Period: | 1980s |
Story: | violencebloodfemale nuditykissthree word titlesurprise endingfireblood splatterremakeshot in the headshotgunwritten by directorshootingbooklow budget film β¦collegedemonriversubjective cameradecapitationaxestabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
The hacker Josh invades the computer of Douglas Ziegler, who is developing a powerful wireless signal, and accidentally releases a mysterious force that takes the will to live of human beings, generating a suicide epidemic and increasing the force. His girlfriend and student of psychology, Mattie, s β¦ees each one of their common friends die and the destruction of the modern world, and together with her new acquaintance Dexter, they try to plan a virus developed by Josh in the network to shutdown the system and save mankind. (Read More)
Subgenre: | suspensesupernaturalteen movieteen horrorpsychological thriller |
Themes: | suicidedeathsurrealismghostfearescapeparanoiaguiltsurveillanceapocalypsetechnologynear death experience |
Mood: | nightmarehorror movie remake |
Locations: | barhelicopterairplanebathtubbuselevatorapartment |
Characters: | psychiatristboyfriend girlfriend relationshipsecurity guardprofessor |
Period: | 2000s |
Story: | posterone word titleflashbacktitle spoken by charactersurprise endingfirecell phoneremakecomputerfalling from heightbeercar crashcollegedemonhallucination β¦subjective camerasurvivaldeath of friendimpalementdinerinternetfalse accusationbathnews reportcoffeelibraryscreamingkeylocker roomfantasy sequencecharacter's point of view camera shotrace against timecollege studentscreamhangingstalkinghandgunpizzaanswering machinevirussecurity camerapsychologyjumping from heightend of the worldinterracial friendshipsocial commentarymechanicalien invasionreverse footagestealing a carpower outageblack bratime lapse photographyairplane crashe maillooking at self in mirrorduct tapealarm clockmedia coveragetext messaginggothdeadvideo surveillancelaundryohioepidemiceyecockroachevil spiritcomputer crackerportaltelevision newsrestroomlaundromatbubble bathcomputer hackerlandladydeath of boyfriendcampusfilmed killingmetal detectormaggotnewscastcollege campusopen endedparasitesome scenes in black and whitecar radiopsychotherapyoverhead camera shottapeexploding airplanepeep hole555 phone numberstairwellvolkswagen beetlecomputer virusdecomposing bodyrunning for your lifeflash drivevideo recordingstartledmass deathhanged by the neckinstructionconquestlaundry roompersonal computeruh 60 blackhawk helicopterinstant messagingdisintegrationlovecraftianbead curtainthe color redremake of japanese filmremake of asian filmcall for helplesionspecterhigh jumpsome scenes in sepiano cell phone signalriding buswashing laundrybounced checkapplying mascaracolor redbook bagdripping faucetlife force sucked outmap of united statespsychology classbehavior changeplead for helptransomwalking alone at night (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | exploitationrevengedeathmurderfearpsychopathbrutalityinsanitysadismevilpolice investigation |
Mood: | slashergorerainnightmarenightdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | policemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | violencebloodsexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingchasesurprise endingpantiesdigit in titleblood splatter β¦dead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Subgenre: | black comedyteen movieteen horror |
Themes: | revengedeathmurderbetrayalfearescapedeceptionparanoiaguiltnear death experience |
Mood: | slashergorenightmare |
Locations: | hospitalbarrestaurantchurchswimming poolhotelhelicoptercemeterysmall townairplaneboatnightclubairportkitchenstorm β¦singing in a car (See All) |
Characters: | father son relationshipteenagerboyfriend girlfriend relationshipdoctorserial killernursemaidfisherman |
Period: | 1990syear 1988 |
Story: | violencebloodsequelflashbackbare chested malefightdancingknifechasesurprise endingpistolshowercorpseshot to deathblood splatter β¦fistfightcar accidentshot in the chestrescuepunched in the facebikinibrawlvomitingshowdownsecond partmarijuanahallucinationislandrevolvercleavagesurvivalambushaxedeath of frienddrug dealerimpalementstabbed to deathstabbed in the chestfalse accusationno opening creditsdream sequencescantily clad femaleroommatebartenderattempted murdercharacter repeating someone else's dialoguestabbed in the backscreamingpay phonevacationrace against timecollege studentlightninggymthreatened with a knifefireplacespearheavy rainlooking at oneself in a mirrorlifting someone into the airkicked in the stomachpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facestabbed in the throatpower outagepunched in the stomachbroken glasskaraoketitle appears in writingstabbed in the headstabbed in the legaccidental killingatticrainstormpierlens flarecharacters killed one by onesequel to cult favoritevoodoofemale in showermannequinengagement ringtombmarijuana jointyellingstabbed in the handconfessionalcomic reliefstonerradio stationhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshophiding under a bedfourth of julyseason in titlefemale bartenderreference to richard nixonstupid victimvillain not really dead clichetoothbrushhookarm slingred herringno endingfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodstabbed in the foothotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerdark and stormy nightfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All) |
On the last day of the first manned mission to Mars, a crew member of Tantalus Base believes he's made an historic discovery; fossilised evidence of bacterial life. Unwilling to let the relief crew claim the glory, he disobeys orders to pack up, and goes out on an unauthorised expedition to collect β¦further samples. But a routine excavation turns to disaster, when the porous ground collapses, and he falls into a deep crevice and near certain death. His devastated colleagues attempt to recover his body. However, when another vanishes, they begin to realise; the life-form they've discovered is highly dangerous to all human life. (Read More)
Subgenre: | black comedyindependent filmsuspensezombie survival |
Themes: | suicidedeathbetrayalfearescapedeceptionparanoiainsanitypaniccannibalismself sacrificespace travel |
Mood: | goreambiguous ending |
Locations: | desertouter spacespacelaboratorytunnelsinging in a carspace station |
Characters: | boyfriend girlfriend relationshipdoctorzombierussiandeath of girlfriend |
Period: | futurenear future |
Story: | infectedbloodflashbackfightcigarette smokingknifechasesurprise endingbeatingcorpseblood splatterfistfightbrawlscientistf word β¦survivalflashlightaxestabbed to deathstabbed in the chestno opening creditsfive word titledangerattackbased on short storymissionrace against timeskeletoninjectiondie hard scenariodirectorial debutprofanityundeadchesscaptainsyringehead butthypodermic needlehelmetmutantdiseasespacecraftdesperationpsychologistskullback from the deadeaten alivefight to the deathstabbed in the throatcannibalpower outagechaosresurrectionhit on the headastronautinfectionaerial shotone dayfemale doctorlens flaremutationcharacters killed one by onelocation in titleextraterrestrialliving deadsuper strengthalarmspace shuttlemercy killingstabbed in the shouldersole black character dies clichemicroscopeenglishmanholemarssole survivorimprovised weaponstupid victimmars the planetoutbreakspacesuitzombie attackspace explorationdecomposing bodyzero gravitypower drilltrapped in spaceloss of girlfriendthick accentsandstormdisobeying ordersbacteriacosmonautblood sampleinsubordinationone day time spanbiohazardexplosive decompressionplanet in titlesinkholecontagiondust stormplanet name in titleclaustrophobicfalling into a holefemale astronautfloating in spacesosdeath of a co workerset in futurealien infectionbinocular microscopereference to buzz aldrinstrapped to a bedverticle take off and landing aircraftlife on marssand stormalien lifeformcable tiemanned missionmars rovernatural bridge (See All) |
Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and β¦ made into a movie. The Blair Witch Project. (Read More)
Subgenre: | black comedyvideoindependent filmcult filmsuspensemockumentarytragedyfound footagefake documentaryghost storysupernatural horrorfamily tragedyfolk horror |
Themes: | fearsupernatural powerpanicwildernessstarvationcamping in the wilderness |
Mood: | student filmdarknessmyth |
Locations: | forest |
Characters: | boyfriend girlfriend relationshipfilmmakercrying babyevil witch |
Period: | 1990syear 1994 |
Story: | obscuritycigarette smokingchasesurprise endingcryingcorpsebookrunninglow budget filmriveralcoholsubjective camerahalloweenflashlightvideo camera β¦four word titlemaplooking at the cameratalking to the cameralatex glovespainlegendscreamingmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriafolklorehikingabandoned housemessageautumnfrightgrassscareno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All) |
Decades after a rock church in communist Romania's Carpathians caved when an expedition caused a landslide and buried everyone, Dr. Nicolai's scientific team exploring the associated Templar Knights monster fighting-legend discovers a deep, flooded cave system and hires the brothers Jack and Tyler's β¦ brilliant divers team to explore it. Another explosion traps them, after finding a mysterious parasite turning all species carnivore, and later an independently evolved predator species. Jack may be infected and turning, but Tyler sticks with him, so the group splits, hunted by the monsters, which also fly. (Read More)
Subgenre: | creature featuremonster movie |
Themes: | monster |
Mood: | darkness |
Locations: | churchhelicoptercavecave in |
Characters: | tattoobrother brother relationshipbabe scientistbiologist |
Period: | 2000s1970s |
Story: | infectedfallbloodtitle spoken by characterexplosionknifesurprise endingfirecorpsefistfightpunched in the facefalling from heightsurvivalflashlightvideo camera β¦impalementunderwater scenetransformationskeletondirectorial debutburned aliveloss of friendskullcrushed to deathbroken legdivinggash in the facemedical examinationinfectionbody countmutationflamethrowerloss of brotherromaniaflarescorpionscuba divingparasiteclawcavernrock climbingdiverswimwearno endingcut armcprboneseelsonarclaustrophobic settinggate crashingrebreather (See All) |
A vigilante homeless man pulls into a new city and finds himself trapped in urban chaos, a city where crime rules and where the city's crime boss reigns. Seeing an urban landscape filled with armed robbers, corrupt cops, abused prostitutes and even a pedophile Santa, the Hobo goes about bringing jus β¦tice to the city the best way he knows how - with a 20-gauge shotgun. Mayhem ensues when he tries to make things better for the future generation. Street justice will indeed prevail. (Read More)
Subgenre: | black comedycult filmb movieabsurdismpunk |
Themes: | revengemurderkidnappingdrugstorturerobberybrutalitysadismhomelessnessmurder of a police officerpolice corruption |
Mood: | gore |
Locations: | hospitaltrainpolice stationschool bus |
Characters: | father son relationshipbrother brother relationshipprostitutebabypimpshooting a police officerbaby killer |
Story: | boom boxviolencebloodfemale nuditycharacter name in titlebare breastsmasturbationcigarette smokingtitle spoken by characterpistoltelephone callcorpsearcade gameshot to deathblood splatter β¦fistfightshot in the chestshot in the headshotgunpunched in the facedead bodyprostitutionalcoholshot in the backdecapitationfoot chasenewspapergangaxemassacrevideo cameraimpalementcocainestabbed in the chestsevered headone man armychild in perilnews reportshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backelectrocutionknocked outkicked in the facedeath of childattempted rapedeath of brotherfishnet stockingsdeath of sonvigilantenewspaper headlinedismembermentcorrupt copchild murderak 47burned alivemacheteshot in the stomachscene during opening creditsspin offmutilationphone boothsevered handcovered in bloodgrindhouseblack humorgenociderapistcrushed to deathmasked manduct tape over mouthrampagepump action shotgunswitchbladesevered fingergash in the facestabbed in the neckpunched in the stomachshot in the faceexploding headpedophiledisembowelmentcanecastrationlens flarebroken armflamethrowershot multiple timeshit with a baseball batblood on camera lensintestinesvideo tapebarbed wiremolotov cocktailgun in mouthhead blown offpolice chiefarcadehanging upside downhead bashed insawed off shotguntentaclestreet fightbased on short filmbumcrushed headski maskhanged manpawnshophomeless personwoman in a bikinifilmingdumpsterdeath of title characterspitting bloodhoboimprovised weaponshot in the crotchshopping cartsevered footimmolationbreaking a bottle over someone's headman with no namerecyclingfratricidecrime lordangry mobdrinking from a bottlecowardicehung upside downsuit of armorflame throwerlawn mowertoastersanta claus suitlawnmowerchild killerwearing sunglasses insidewoman smoking cigarettebody armorfilicidered lighthanged womanmotorcycle ridingvhs tapebumper carhanged by the neckdeath of unclereference to mother teresacandollar billpawn shopelectrocutedfacial cutwhite suithospitalityice skatesmass child killinghack sawattempted kidnappingwearing sunglasses at nightstreet prostitutionfoiled robberypulling haircutting torchsuspended by armsmanhole coverneo 80sweapon in titleemergency surgeryhead crushedstilletoeating glasswelding maskbreaking an armbricklinrobber wearing a ski maskfire in a 55 gallon drumriding a freight train (See All) |