Please wait - finding best movies...
Cleveland Heep, a stuttering apartment superintendent, encounters a girl named Story swimming in the complex's pool. He soon learns that she comes from the Blue World, and has a message for mankind. Will he be able to help her complete her mission?
Subgenre: | fairy taleurban fantasydark fantasy |
Themes: | mythologydeath |
Mood: | one nightrain |
Locations: | swimming poolapartmentwater |
Characters: | mythical creaturelittle girllittle boygirlboy |
Story: | return homeapartment buildingbedtime storyjumping into a pool with clothes oncrossword puzzlepool partymysterious creatureevil creatureapartment managerapartment blockchildren's bookmusic score features choirmonster in mirrorfantasy becomes realitysleight of hand β¦movie criticvoice of godideaboombedtimepurposecreaturesdolly zoomnymphlaundry roompersonsave the worldblock of flatscookbooklifting a female into the airlawn sprinkleropening narrationtalehealerlifting female in airglowing eyespsychotronic filmfilm criticaltered version of studio logostutteringgrasssuper powerswimming underwaterreturneagleweightliftingjournalfortune tellerphiladelphia pennsylvaniaplaybuildinghealingbutterflyfairyanimal attackpuzzlehomepoollifting someone into the airslow motionwritten and directed by cast memberstorytellingkeyprologueauthorunderwater scenecreaturefour word titlebookslow motion scenevoice over narrationshowerviolence (See All) |
In 1944 falangist Spain, a girl, fascinated with fairy-tales, is sent along with her pregnant mother to live with her new stepfather, a ruthless captain of the Spanish army. During the night, she meets a fairy who takes her to an old faun in the center of the labyrinth. He tells her she's a princess β¦, but must prove her royalty by surviving three gruesome tasks. If she fails, she will never prove herself to be the the true princess and will never see her real father, the king, again. (Read More)
Subgenre: | fairy taledark fantasycult filmcoming of agetragedymythologicalcoming of age filmspanish horrormexican horroradult fantasy |
Themes: | deathmurderlovesurrealismpregnancyfeartorturemonstermagicmilitarymemorydeath of fatherbrutalitydeath of motherillness β¦sadismexecutioncrueltydeath of wifecommunismcourageself sacrificehuntingafterlifedeath in childbirthdying in childbirth (See All) |
Mood: | raingore |
Locations: | trainforestsmall townbathtubwoodskitchenwheelchaircavespain |
Characters: | mythical creaturegirlhusband wife relationshipfather son relationshipmother daughter relationshipdoctorsingerfemale protagonistsoldiernursebabypriestmotherfathermayor β¦pregnantmilitary officerstepfather stepdaughter relationshipstepbrother stepsister relationshipdeath of girlpregnant mother (See All) |
Period: | world war two1940syear 1944 |
Story: | fantasy becomes realitypsychotronic filmstutteringfairyhomelifting someone into the airstorytellingkeycreaturefour word titlebookvoice over narrationviolencefemale nuditycharacter name in title β¦bloodguncigarette smokingexplosionsingingknifechasesurprise endingsongfoodhorsemirrorshot in the chestshot in the headrescuepunched in the facebattleshootingvomitinglierifleinterrogationrevolvershot in the backgood versus evilspycookingambushstabbingeatingarmystabbed in the chestweaponchild abuseno opening creditsanti herocoffinkingprincesstransformationpainlimousinegravetreebinocularsliarpoisonumbrellastatuereadingrabbitskeletonfarmerinjectiontragic eventtied upflowerloss of mothergeneralmagical realismsacrificequeenchild murderprincestrong female characterrecord playerdestinyshavingcard gamesabotagespiritsyringefireplacegrenadeburned alivewounddressheroinepropagandarecordingcookcaptivehammerhidingservantrebelfrogstrong female leadburialfull moonpromiseimaginationchild's point of viewbraveryresistanceshot in the faceinsectthunderstormcard playingrosedead childfascismcapturehousekeeperlanternkingdomdaggerwar crimechauffeurdrugged drinkmuddead girlhorseback ridingbandagemazelotteryeuthanasiaportalbreadtween girlno title at beginningmedalfascistwhisperingparamedicbubble bathpocket watchfantasy worlddisciplinemercy killingfemale heroamputationtyrantmilitary uniformeyeballfeverspanish civil waranarchisthiding under a bedimmortalparallel universeinformermonument10 year oldtailorcavalrysecret passagealternate dimensionguerrillafetusgiant animalalice in wonderlandbludgeoningberetanarchismsuspendersphonographknife held to throatlabyrinthtoadcowardicebirthmarkstabbed in the mouthfeastlottery ticketparallel worldsecret doorruthlessnesshand injurywalking stickfire fightyoung girlhourglassleechlugermilking a cowlullabycalligraphytrain wrecknew homechalkechomouthembryoreference to dwight d. eisenhowerlifting a male into the airsecret compartmentmorning sicknessinfiltratorlipsmagical creaturerationingstraight edge razorcult favoritesedationmagic booktrickerymagical stonereference to francocold feetrootantibioticwater millneck wounddead treeopening creditshedge mazefaunmandraketalking to an unborn babychild heroinefig treerabbit huntingration carddead child with eyes openfur stolestitching one's own woundimaginary childpolishing bootsstone carving (See All) |
After winning a custody battle for her daughter, Yoshimi tries to make a new start. The apartment she moves into seems perfect at first. Soon though, strange things begin happening. Huge water stains appear on the ceiling and drip constantly, more liquid oozing into the rooms every day. She calls th β¦e landlord in but he refuses to do anything about it. A child's red bag shows up in odd places and soon the child herself starts appearing. Yoshimi then discovers the origin of the ghost... (Read More)
Subgenre: | asian horror |
Themes: | marriageghostfeardivorcesupernatural powermissing child |
Mood: | rainnightmare |
Locations: | apartmentwatertrainschoolbathtubbustaxielevatorrooftopnew apartment |
Characters: | little girlhusband wife relationshipfather daughter relationshipmother daughter relationshipchildrenteenage girlteacherstudentlawyersister sister relationshipdaughteraunt niece relationshipparent child relationship |
Period: | 2000s |
Story: | apartment buildingapartment managerbuildingslow motionbased on novelflashbackfightcigarette smokingtelephone callcryingcell phonetearsclassroomsubjective cameraflashlight β¦drawingbathdrowningflash forwardscreamingattackumbrellaringdarkclassanswering machinesurveillance cameraschool uniformbrushing teethlandlordposterdead girlschool principalchild custodysurrogate mothersleepwalkinghide and seekfloodingtalking to selffamily abandonmentkindergartenwater towerraincoatcustody battleremadesparklerrepairmanmoving vanhorror movie remadehearing noiseswater tankfootstepsdripping waterstrange noisestainskippinglost and foundhumiditypsychiatric treatmentproofreadingproofreaderschool bagwater stain (See All) |
The Flintstones and the Rubbles are modern stone-age families. Fred and Barney work at Slate and Company, mining rock. Fred gives Barney some money so he and Betty can adopt a baby. When Fred and Barney take a test to determine who should become the new associate vice president, Barney returns the f β¦avor by switching his test answers for Fred's, whose answers aren't very good. Fred gets the executive position, but little does he know that he's being manipulated by his boss to be the fall guy for an embezzlement scheme. (Read More)
Subgenre: | fairy talealternate history |
Themes: | friendshipkidnappingdanceheroguiltgreedadoptionself sacrifice |
Locations: | restaurantcarbusnightclubdesertdance restaurant |
Characters: | little girllittle boyfamily relationshipsfriendsingerbest friendvillainsecretary |
Story: | bedtime storylifting female in airaltered version of studio logohomelifting someone into the airstorytellingbookshowercharacter name in titlesequelkissdancingsingingpartyfire β¦songfoodblonderunninggood versus evilbound and gaggedbasketballhousebirdbased on tv seriesfantasy sequenceproduct placementdebtreadingglasseswitnesstied upsacrificetv newshuggingshavinggameheroineeggenemyvillainessblockbusterdinosaurbarefoothomelessdeath threatballpunchpetjewelryyellingsandwichlaundrymarketpromotionsuitsleepbased on cartoonmother in lawchild kidnappingprehistoric timesapecavemanspoontelevision setanachronismlynchingbitefurquarrystudio logo segues into filmprehistorycatapultfrying panbreaking glassbonesstone agerich snobtailplayinglayoffpleadingwheelplatedrive in theaterevil plotlawn mowingconcreteattempted escapebusboyneanderthaldictaphonedinosaur eggreboot of seriescave womangarbage disposalembezzler1000000 b.c.buyingmodern stone age humorsnow conestudio logo parodykitchen appliancedinosaur and manpay raisedinosaurs humans coexistpet dinosaur (See All) |
Subgenre: | fairy taledark fantasymartial artsblack comedysuspensesupernaturalsword and sorcerysword and fantasybased on fairy tale |
Themes: | deathmurderloverevengesurrealismkidnappingmarriagebetrayalfearescapemonsterherodeceptionmagicanger β¦obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
Locations: | churchforestsnowvillagewoodscastlecampfire |
Characters: | little girllittle boysoldierbabyhostagesister sister relationshipthieftough guywarrioraction hero |
Story: | glowing eyesaltered version of studio logofairyanimal attackprologuecreatureslow motion scenevoice over narrationviolencecharacter name in titlebloodsequelflashbackbare chested malekiss β¦fightexplosionknifechasesurprise endingbeatingcorpsefistfighthorsemirrorshot in the chestface slapshot in the headrescuepunched in the facebattleswordbrawlshowdownhand to hand combatsecond parthallucinationrivercombatsubjective cameragood versus evilorphancandlesword fightambushaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirddisarming someoneone man armychild in perilfictional wardouble crosskingfemme fatalenecklacetransformationon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsmanipulationthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldwolffireplacebow and arrowburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineback from the deadbar fightpresumed deadfemale warriorguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathdual wieldmercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotknife fightdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a mangoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroinechild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathelkmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
Inventor Gepetto creates a wooden marionette called Pinocchio. His wish that Pinocchio be a real boy is unexpectedly granted by a fairy. The fairy assigns Jiminy Cricket to act as Pinocchio's "conscience" and keep him out of trouble. Jiminy is not too successful in this endeavor and most of the film β¦ is spent with Pinocchio deep in trouble. (Read More)
Subgenre: | fairy tale2d animationdisneybased on fairy tale |
Themes: | magic |
Mood: | rainnight |
Locations: | boatseaitaly |
Characters: | boyfather son relationship |
Period: | 19th century1880s |
Story: | altered version of studio logofairypoollifting someone into the airunderwater scenebookcharacter name in titlebased on novelone word titledancingtitle spoken by charactersingingfirecryingmirror β¦catliebeerislandcandlefishchildspankingcigar smokingtransformationpuppetumbrellablockbusterfaked deathcarnivalappleanthropomorphismstarunderage drinkingtitle appears in writingbilliardswishsmokecoinlyingdonkeyforename as titlewhalefoxgoldfishmetamorphosisconscienceunderage smokingfamous scorestarssnoringcarriagehuman becoming an animalyoung boyreading a letterwish fulfillmentmagic wandstudio logo segues into filmmarionettesneezingpadlocknosepuppeteerrotoscopingpinocchiocuckoo clockcricket the insectjackassschool kidsmona lisafishbowlswallowed wholepuppet theaterafipet fishanthropomorphic toycagedevil smilestorybook in opening shotwishing on a starhitting oneselfanthropomorphic insectsplashing water on one's faceblowing one's nosecharacter turns greenwirelessjiminy cricketanthropomorphic foxtalking foxunable to sleep (See All) |
Dahlia Williams and her daughter Cecelia move into a rundown apartment on New York's Roosevelt Island. She is currently in the midst of divorce proceedings and the apartment, though near an excellent school for her daughter, is all she can afford. From the time she arrives, there are mysterious occu β¦rrences and there is a constant drip from the ceiling in the only bedroom. There are also noises coming from the apartment directly above hers, though it would appear to be vacant. Is the apartment haunted or is there a simpler explanation? (Read More)
Subgenre: | suspense |
Themes: | deathghostadulteryfearfuneraldivorcetheatreself sacrifice |
Mood: | rainnightmaremovinghorror movie remake |
Locations: | apartmentwaterhospitalnew york cityschoolbathtubelevatorpolice carrooftopcable carapartment hunting |
Characters: | little girlmother daughter relationshipteacherlawyersingle motherterror |
Period: | 1970s2000syear 1974 |
Story: | apartment buildinglaundry roomlifting someone into the airprologuef ratedbased on novelflashbackdreamcorpseremakeclassroommanhattan new york cityambulancedream sequencechild in peril β¦foreign language adaptationdrowningbased on short storyumbrelladollcinemaloss of motherheavy rainmovie theatretensionplaygroundbackpackjob interviewrainstormdivorceesirenseparationlyingseattle washingtondead girlreal estate agentcartoon on tvapparitionrestroomimaginary friendhearing voicesbubble bathchild custodyshocktenanttramstory telling555 phone numberstairwellevil childfloodingjob seekingart classwater towerhardshipcustody battlestartledsinkseeing dead peoplewater tankdivorced motherremake of japanese filmhello kittyremake of asian filmmaintenance manmonster as victimwater leakmediationmalevolent entitywashing laundrywater tapwaiting in the rainbook bagflooded bathroomroof leakroosevelt island tramwater stain (See All) |
Two teenage Russian boys have their father return home suddenly after being absent for 12 years. The father takes the boys on a holiday to a remote island on a lake in the north of Russia that turns into a test of manhood of almost mythic proportions.
Subgenre: | independent filmcoming of agesuspenseallegorychrist allegorybiblical allegory |
Themes: | deathlovedrinkingfearredemptioncampingwildernessfear of water |
Mood: | rain |
Locations: | beachrestaurantforestboatbuswoodsshiptruckrussiacampfire |
Characters: | boyfamily relationshipsfather son relationshipmother son relationshipteenagerbrother brother relationshipteenage boyphotographerrussian |
Story: | return homereturnjournalhomeunderwater scenebookone word titlebare chested malefightphotographknifechasetelephone callcryingunderwear β¦foodface slapcameradrinkfalling from heighttearsrunningcafeislandreference to jesus christtelephoneswimmingaxemontageeatingchild abusefishingpilotpay phoneon the roadvacationtentdiarytragic eventhateaccidental deathstrangerladderfalling to deathrowboatabsent fatherabusive fathertowerbreadabandonmentfallingsouptravelingmuggingfather son estrangementjumping into waterspeedoverbal abuseboot camptelling a jokeship wreckstickfear of heightsdragging a dead bodychild driving a carhiketarkovskyesquesinking boattarsoaked clotheshitting someonemidnight sunburied boxreturn of father (See All) |
In a castle high on top of a hill lives an inventor's greatest creation - Edward, a near-complete person. The creator died before he could finish Edward's hands; instead, he is left with metal scissors for hands. Since then, he has lived alone, until a kind lady called Peg discovers him and welcomes β¦ him into her home. At first, everyone welcomes him into the community, but soon things begin to take a change for the worse. (Read More)
Subgenre: | fairy talecult filmcoming of ageblack comedydark comedyfish out of waterchrist allegorymodern fairy tale |
Themes: | revengesurrealismchristmasjealousydrunkennessdeceptionlonelinessdysfunctional familyguiltcelebrityunrequited love |
Mood: | satire |
Locations: | snowcastlelaboratory |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boypolice officerbullyteacher student relationship β¦psychiatristself discovery (See All) |
Period: | christmas party |
Story: | music score features choirpersonlifting a female into the airaltered version of studio logohomelifting someone into the airstorytellingcreatureslow motion scenecharacter name in titlebloodflashbackdogfightcigarette smoking β¦photographchasebeatingcorpseblood splatterrescuewatching tvarrestheld at gunpointneighborhandcuffsrevolvermontagedinerstabbed in the chestnonlinear timelinedinnerradiodouble crosstrainingsuburbchristmas treebankscarsadnessgardenmagical realismcult directorgothicegglooking at oneself in a mirrorwoman with glassestold in flashbackhappinesscrucifixmad scientistgossipcompassionhaircutburglaryinventorscissorsframe upatticsnowingbarbecuedead boygeniusflat tiregothhairold dark housespiral staircasefreakbully comeuppancedrunk drivingself defensemisfitelectric shockcookiecrashing through a windowcreationplumberhandfamous scoreorchestral music scorehair salontreehousemetaltalentcut handwrongful arrestsittingbloody body of a childtalk show hostbank vaultcuriosityprosthetic limblemonadeorganistfictional talk showrock paper scissorswaterbedsaleswomanice sculpturelock pickcosmeticsartificial humanlimericksymphonic music scorenon statutory female on male rape attemptshow and telltopiary (See All) |
Peter Pan (Williams) has grown up to be a cut-throat merger and acquisitions lawyer, and is married to Wendy's granddaughter. Captain Hook (Hoffman) kidnaps his children, and Peter returns to Never Land with Tinkerbell (Roberts). With the help of her and the Lost Boys, he must remember how to be Pet β¦er Pan again in order to save his children by battling with Captain Hook once again. (Read More)
Subgenre: | cult filmswashbuckler |
Themes: | revengekidnappingchristmasheromagicdysfunctional familyadoption |
Locations: | snowairplaneboatlondon englandenglandbaseballcity of children |
Characters: | little girllittle boygirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother sister relationshiplawyerself discoverymermaid |
Period: | 1990s20th century |
Story: | lifting female in airplayfairylifting someone into the airslow motionstorytellingviolencecharacter name in titlebased on novelone word titledogtitle spoken by characterbased on playtelephone callcrying β¦cell phonerescuebattleswordtearsbedislandgood versus evilorphansword fightdeath of friendman with glassesno opening creditschilddrawingfictional warold womanduelcostumeuniformhuggingpiratecaptainblockbusteranthropomorphismreverse footagechild's point of viewskateboardingsnowingdead boysword duelvillain played by lead actoryellingbroken windowshoutingadventure herofantasy worldbaseball capbaseball gamechild kidnappingfriends who live togetheracrobatfather son estrangementoutlaw gangvictorychristmas lightsacrobaticshooksurname as titlefood fightstockholm syndromechristmas decorationsminiaturizationbig ben londonchild's drawingdollhouseteenager fighting adultreference to gandhicaught in a netflying manactress playing male rolefear of flyingbaseball glovechild fighting adulthook for handbattle of witstinker bellcaptain hookflying boyturbulencepants falling downgang that lives togethersheepdogslashexposed underwearopen windowexpression taken literallyanthropomorphic flowernever neverlandseashell bikinicrowingflying girlold english sheepdogthrowing a telephone out a window (See All) |
Soon after moving in, Beth, a brainy, beautiful writer damaged from a past relationship encounters Adam, the handsome, but odd, fellow in the downstairs apartment whose awkwardness is perplexing. Beth and Adam's ultimate connection leads to a tricky relationship that exemplifies something universal: β¦ truly reaching another person means bravely stretching into uncomfortable territory and the resulting shake-up can be liberating. (Read More)
Subgenre: | independent film |
Themes: | infidelityjealousyadulterydrinkingfearfuneralextramarital affairdeath of fatherguiltunfaithfulnessadoptionautismradiationgay adoption |
Mood: | moving |
Locations: | apartmentnew york cityrestauranttrainschoolsnowcemeterypolice carcourtroomofficeouter spaceschool director |
Characters: | little girllittle boyhusband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipchildrenteacherpolice officerstudentpolicemanbabywriter β¦lawyersister sister relationshipemployer employee relationshipchineseengineerlesbian mother (See All) |
Story: | apartment buildingchildren's bookpersonlaundry roomplayauthorbookvoice over narrationsexcharacter name in titleone word titlekissfightphotographtitle spoken by character β¦partytelephone callcryingcell phoneunderwearfoodmirrorwatching tvcomputerdrinklietearsbedcafeneighborclassroommanhattan new york citysubjective camerabedroomnew yorkcaliforniaeatingfalse accusationjudgeapologytrialvangraveyardflash forwardparktheatergraveargumentfired from the jobchampagnemassagedollreadingflowerscourtamerican flaglaptopcharacter says i love youflowerloss of motherclassblack americantwenty somethingwaiterhugginganswering machinetealooking at oneself in a mirrorgay parentstrangerclockwatching televisionpromisetelescopestarnew jerseyplaygroundboxer shortsjob interviewanxietyco workertheatre audiencefirst kisslesbian couplerefrigeratorsnowingnotelooking at self in mirrorbenchflagaccountantpresentshynessface maskloss of jobclosetlaundrytestimonycentral park manhattan new york citylast will and testamentreading aloudfencebroken mirrortheatre productionmessageastronomyforeplayquarreluniversereference to albert einsteintour guidepark benchreference to john f. kennedywashing machinegalaxylunchcalendarraccoonbreaking a mirrorinterracial adoptionspacesuitbroomcourthousequeens new york citysexual arousalreference to harry potterfired from a jobsolar systemfreezerasperger's syndromepadlocktelling a jokejoke tellingcartobservatoryastronomerlooking for a jobroutineschoolyardpre schoolcuddlinggrand central station manhattan new york cityreference to thomas jeffersonreference to mozartgrocerieslooking for workreference to wolfgang amadeus mozartbig bangjob applicationplanetariumtoy makerbreakfast cerealbig bang theorycentral parkreference to f. scott fitzgeraldreference to julia robertsreading to a childsaturn the planettv dinnerpicture booklonely man29 year oldcracked mirroroff broadwaychildren's authorsitting on stepsjail sentencesuspected paedophiledestroying a roommen's clothing storesurrogate unclewestchester new yorkreference to samuel beckettwatching a playkicking a canmacaronireference to clarence darrowwashing a windowfrozen foodsweeping a floorvoice recognitionpeople watchingreference to the little princetoy designer (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | fairy taledark fantasycult filmblack comedysupernaturalslapstick comedy |
Themes: | mythologydeathmurderrevengesurrealismkidnappingmoneybetrayalghostprisondrinkingfeartorturedrunkennessescape β¦monsterdeceptionmagicmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemissing childunlikely hero (See All) |
Mood: | rainnightmare |
Locations: | churchforestsnowcemeterysmall townvillagewoodscastlecavegermany |
Characters: | girlboymother son relationshipfather daughter relationshipfriendbrother brother relationshipprostitutesoldierdanceractorpriesthostagesister sister relationshiplove trianglewarrior β¦witchmayorfrench soldier (See All) |
Period: | 19th century1810s |
Story: | creatureslifting someone into the airstorytellingprologuecreaturebookviolencecharacter name in titlebloodflashbackdoggunkissfightdancing β¦title spoken by characterexplosionknifethree word titlepistolfirecorpseunderwearfoodhorsemirrorshot in the chestshot in the headrescuecatdrinkbattleswordarrestfalling from heightriflerunningbedinterrogationhallucinationshot in the backdecapitationbound and gaggedwinecandleold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakesevered headman with glassestrialanti heroanimaldrawingchild in perildouble crossritualkingfemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backpossessionrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagehatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
In 1902, in London, the spinster Beatrix Potter lives with her bourgeois parents. Her snobbish mother, Helen Potter, had introduced several bachelors to Beatrix until she was twenty years old, but she had turned them all down. Beatrix Potter has been drawing animals and making up stories about them β¦since she was a child, but her parents have never recognized her as an artist. One day, Miss Potter offers her stories to a print house, and a rookie publisher, Norman Warne, who is delighted with her tales, publishes her first children's book. This success leads Norman to publish two other books, and Miss Potter meanwhile becomes the best friend of his single sister Millie Warne. Soon Beatrix and Norman fall in love with each other, but Helen does not accept that her daughter would marry a "trader". However, Beatrix's father Rupert Potter proposes that his daughter spend the summer with his wife and him in their country house in Lake District, and if she is still interested in Norman after the summertime, he would bless their marriage. When Miss Potter stops receiving letters from Norman, she is disappointed. Then one day she receives a letter from Millie explaining what had happened to Norman. (Read More)
Subgenre: | live action and animation |
Themes: | deathfriendshipmarriagechristmasmoneygriefillnesswealthwritingfirst love |
Mood: | rain |
Locations: | trainlondon englandrural settingwheelchairfarmenglandlaketrain station |
Characters: | little girllittle boygirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensingerbrother brother relationshipbrother sister relationship β¦female protagonistdancerwriterlawyerartistmaidsecretaryfiance fiancee relationshipyounger version of characterlove letter (See All) |
Period: | summer1910s1900schristmas party |
Story: | bedtime storychildren's bookstorytellingauthorbookvoice over narrationcharacter name in titleflashbacktwo word titlekissdancingsingingpartycryingsong β¦letterpaintingtearsbritishmansionpainteranimaldrawingold womanmarriage proposalparkdollrabbitchristmas treefarmerdeath of brothercountrysidepiggardenclass differenceshuggingteafireplacewhat happened to epiloguedresshatmouselossservantfrogpart animationart galleryimaginationanthropomorphic animalfirst kissenglishthirty somethingvoice over lettersnowinghousekeeperduckhorse and carriagedeath of loved onechildhood memorynannyauctionengagement ringpresentchristmas presentpublisherestatefriendship between womenconservationfarmhousefantasy worldcreativityupper classbereavementcountry housemarriage engagementmusic boxwriting a letterhorse and wagonbanquetsingle womanhousemaidfemale writerends with biographical notesends with textletter writingcity parksailor suitgovernesshedgehogturn of the centurychild's drawingfemale artistdollhousestorytellerspiked drinkgrandfather clockprinting presssnobberycorrespondenceillustratorbadgersolicitoredwardian erawatercolorbookshoppaintbrushbarristercovered in mudstraw hatnaturalistchaperonedeath of fiancesuffragetteadult living with parentsbook publisherbrushlake districtbook publishingentomologyportfolioconservationistunmarried womanchildren's authorpet mousedrawing comes to lifewindow displayyear 1902butterfly collectionreference to prince charmingunmarriedpavillionsecret engagementsharpening a pencillawn croquetfarm auctionreference to vlad the impaler (See All) |
This is the tale of Harry Potter, an ordinary 11-year-old boy serving as a sort of slave for his aunt and uncle who learns that he is actually a wizard and has been invited to attend the Hogwarts School for Witchcraft and Wizardry. Harry is snatched away from his mundane existence by Hagrid, the gro β¦unds keeper for Hogwarts, and quickly thrown into a world completely foreign to both him and the viewer. Famous for an incident that happened at his birth, Harry makes friends easily at his new school. He soon finds, however, that the wizarding world is far more dangerous for him than he would have imagined, and he quickly learns that not all wizards are ones to be trusted. (Read More)
Subgenre: | fairy taledark fantasycult filmepic |
Themes: | friendshipchristmasmoneyghostmonsterheromagicsupernatural powerdysfunctional familycelebrity |
Mood: | night |
Locations: | trainforesttrain stationschool of magic |
Characters: | little girlgirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfriendbest friendbullyteacher student relationshipprofessorwitchuncle nephew relationshipaunt nephew relationship |
Period: | 1990syear 1991year 1992 |
Story: | talestutteringlifting someone into the airkeycreatureslow motion scenecharacter name in titlebased on noveldogtitle spoken by charactersurprise endingmirrorrescueswordletter β¦birthdaygood versus evilhalloweenorphansnakechild abuseno opening creditschild in periltransformationuniformfirst of seriesmissiondragontough girlbankscarschoolgirlratfirst partpowerstrong female characterchesseyeglassesoccultdestinygametalking animalhatwitchcraftblockbusterfrogstrong female leadbreakfastdwarfreverse footagebraverycrossbowzoowizardimmortalityboarding schoolstadiumfamily secretowlelfspellinvisibilitylevitationparalysissorcererfantasy worldpotiontrollidentical twinsorchestral music scoresorcerytrapdoorschool lifeunicornbroomhuman becoming an animalcult figuremagic wandwoman in uniformmysticchild herofemale ghostgiant creaturegrandfather clockbased on young adult novelinfirmarycloaknew homelifting a male into the airmagical mirrorcentaursteam locomotivemirror does not reflect realityevil wizardflying broombrick wallelitismhereditary gift of witchcraftpoetry recitationinvisibility cloakmagical bookattempted child strangulationforced perspectivebad parentsmagical broomstickfictitious sportbad parentingbildungsromanescher stairwayhobgoblinpet as giftquidditchportrait comes to lifetrain platformmagical cloak11th birthdayfaerie talehuman chessboardsnowy owltripping while fleeing (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | fairy taledark fantasycoming of agetragedyslapstick comedyfish out of waterdisneybased on fairy tale |
Themes: | mythologyloverevengesurrealismkidnappingjealousyfearescapedancemonsterdeceptionmagicobsessionsupernatural powerdeath of mother β¦blackmailredemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
Mood: | poetic justice |
Locations: | barforestsnowparis francebathtubvillagewoodsfrancelakecastlerooftop |
Characters: | little boygirlfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglemaidwitch β¦grandmother grandson relationshipsingle fatherex soldier (See All) |
Story: | altered version of studio logoanimal attackprologuecreaturefour word titleslow motion scenevoice over narrationcharacter name in titleflashbackdogbare chested malekissfightdancingphotograph β¦title spoken by characterexplosionsingingpartychasesurprise endingpistolfirebeatingcorpsehorsemirrorshot in the chestremakerescuepunched in the facebattleswordkissingbrawlfalling from heightpaintingshowdownrifleheld at gunpointbedpianoshot in the backbedroomcandlesword fightmountaindisguisewomanmontagebridgemapfalse accusationno opening creditsbirddrawingcontroversykingtransformationbartenderflash forwardattempted murderlibrarycursedangerwidowerrace against timeknocked outlightningmanipulationwigtied upgardencabinloss of motherlove interestreference to william shakespearequeenprincesingle parentchesswerewolficeropefalling down stairswolffireplacedressheroineheavy raintalking animalhunterloss of wifeblockbustereccentriccomposerservantjumping from heightculture clashstrong female leadcgitorchcompassionclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptballensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownfolklorehuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyopera singervanitystar crossed loverswindmillfamous scoremusketclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
Bastian is a young boy who lives a dreary life being tormented by school bullies. On one such occasion he escapes into a book shop where the old proprieter reveals an ancient story-book to him, which he is warned can be dangerous. Shortly after, he "borrows" the book and begins to read it in the sch β¦ool attic where he is drawn into the mythical land of Fantasia, which desperately needs a hero to save it from destruction. (Read More)
Subgenre: | fairy talecult filmtragedysword and sorcerystop motion animationhigh fantasy |
Themes: | mythologymonsterheromagicangerillnesshope |
Mood: | darknessbreaking the fourth wall |
Locations: | schoolkitchencity |
Characters: | girlboyfather son relationshipwarriorbullysingle fatherself confidence |
Period: | 1980s |
Story: | fantasy becomes realitykeycreaturebookbased on novelfighttitle spoken by characterexplosionchasethree word titlehorserescuebattlescientistgood versus evil β¦foreign language adaptationjourneydangermissiondragonreadinglightningsadnessfirst partloss of motherwerewolfwolfdestructionflyingtalking animalquestdiseaseloss of friendhidinggiantdesperationvisitbreakfastrealityanthropomorphismimaginationwindthundersandbackpackchild protagonistdespairswampfrustrationbookstoredaydreamatticturtleopening a doorwishlightweathershamemudbathorseback ridinghappy endingconfusionalleysandwichgatetowerpictureadviceelementary schoolbeastfantasy worldmale protagonistwarningfriends who live togetherluckfamous scoremeteortitle same as bookalter egofather son estrangementcureallergyhiding placedumpsterlunchrescue from drowningdeath by drowningsnailyoung boywish fulfillmentgnomeempowermentmysticchild herowhite horsedeath of petexhaustionbased on young adult noveloraclefamous songsneezeempresssphinxpleadingechominiature persontravellingpostmodernismloss of petvoidbook sellermagic booklaser visionstory within the storyencouragementlatenessbook storesurvivor guiltmagical bookpretty girlvibrationlate for schoolboy horse relationshipdeath rayunderaged protagonistfissuregiant batself beliefyellnamingtalking rockdark versus lightskipping classwindstorm (See All) |
A television reporter and her cameraman are assigned to spend the night shift with a Los Angeles Fire Station. After a routine 911 call takes them to a small apartment building, they find police officers already on the scene in response to blood curdling screams coming from one of the apartment unit β¦s. They soon learn that a woman living in the building has been infected by something unknown. After a few of the residents are viciously attacked, they try to escape with the news crew in tow, only to find that the CDC has quarantined the building. Phones, internet, televisions and cell phone access have been cut-off, and officials are not relaying information to those locked inside. When the quarantine is finally lifted, the only evidence of what took place is the news crew's videotape. (Read More)
Subgenre: | mockumentaryfound footagesurvival horrordisaster film |
Themes: | deathdrunkennessescapevoyeurismparanoiapaniccannibalismmurder of a police officer |
Mood: | one night |
Locations: | apartmenthelicopterlos angeles californiaelevatorfire truckfire station |
Characters: | husband wife relationshippolicezombiesniperkiller dog |
Story: | apartment buildingapartment managerbuildingshowerviolencebloodone word titleinterviewdogbare chested malepistolcorpseshot to deathblood splattershot in the chest β¦remakepunched in the facefalling from heightheld at gunpointtelevisionreportersubjective camerafoot chasebasketballimmigrantold womantalking to the camerashot in the foreheadbeaten to deathcharacter's point of view camera shotkicked in the faceactor shares first name with characterinjectiontragic eventneck breakingratfirst partexperimentfalling down stairssyringekilling an animalragevirusloss of loved onecrushed to deathback from the deadbroken legeaten alivegas masktrappeddeath of protagonistjumping through a windowinfectionblood on shirthandheld camerashot multiple timesfirefighterdead dogfiremanblood on camera lenssuffocationneedlehit in the faceveterinarianepidemicalarmnight visiontv reportercameramanhead bashed inbitten in the neckfeverkiller childquarantinesick childtenantspitting bloodhit with a hammerzombie violencesledgehammerdog attackbreaking through a doorbludgeoningstairwellthroat rippingmedia manipulationzombie childemaciationtelevision broadcasthandballaudio tapenight shiftzombificationdalmatianhandcuffed to a pipebitten in the facedrill in the headfire departmentmaulingchief of policeinfectious diseaseteacher student romancevideo voyeurismrabiesvetcontamination suitaudio begins before videoshot in sequencesick dograbid dogremake of spanish filmladder truck (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | urban fantasydark fantasyindependent filmcult filmsupernatural |
Themes: | deathmurderrevengesurrealismkidnappingbetrayalpregnancyfearescapedeceptionextramarital affairangerbrutalitysupernatural powerdeath of mother β¦paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
Mood: | gorenightdarkness |
Locations: | swimming poolapartmenttrainairplanebathtubelevatorurban settingtruckrooftoprussiatunnelyachtfire escape |
Characters: | little boyfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorsoldierpolice officerhostagetough guyvampirewarrioraction herosingle motherwitchrussian β¦pregnant womanself mutilation (See All) |
Period: | 1990s2000s20th century21st centuryyear 1992 |
Story: | glowing eyespsychotronic filmlifting someone into the airprologueslow motion scenevoice over narrationviolencefemale nuditybased on novelbloodflashbackdogtwo word titlebare chested malefemale rear nudity β¦fightphotographtitle spoken by characterexplosionknifechasesurprise endingcell phonebeatingcorpseblood splatterhorserescuepunched in the facebattleswordarrestbrawlbare buttshowdownsunglassesneighborsubjective cameradecapitationgood versus evilfoot chaseflashlightsword fightambushconcertaxebridgearmyimpalementstabbed to deathstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backscreamingcharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencesingle parentdestinydestructionrevelationlooking at oneself in a mirrorhelmetexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingimprovised weaponlifting person in airgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendwoman in a bathtubprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
Two young girls, Satsuki and her younger sister Mei, move into a house in the country with their father to be closer to their hospitalized mother. Satsuki and Mei discover that the nearby forest is inhabited by magical creatures called Totoros (pronounced toe-toe-ro). They soon befriend these Totoro β¦s, and have several magical adventures. (Read More)
Subgenre: | fairy talecult film2d animation |
Themes: | supernatural power |
Mood: | rainanime |
Locations: | hospitalschoolforestbusbicyclevillagewoodsrural settingjapanfarm |
Characters: | little girlgirlfather daughter relationshipmother daughter relationshipchildrenfemale protagonistsister sister relationshipjapanesemotherfather |
Period: | 1950ssummer |
Story: | creaturespsychotronic filmsuper powerhomef ratedcharacter name in titlethree word titlecatneighborbathtreemini skirtumbrellamissing personuniversity β¦magical realismsisterspiritflyingwindchild protagonistlostthunderstormhappy endingwellbus stopjapanese schoolgirlshort skirtfamous scorebechdel test passedtuberculosissecret passagecountry lifealternate versionmultiple english dubsnew neighborsick motherstar died before releasesibling relationshipnew hometwo sistersrice fieldmagical creatureacornill motherspritewalking in the woodsgirl wearing a miniskirtolder sisterleaveforest spiritlost girlgrovesootshorthaired girl (See All) |
Gloria (Anne Hathaway) is an out-of-work girl who, after getting kicked out of her apartment by her boyfriend, is forced to leave her life in New York and move back to her hometown. When news reports surface that a giant creature is destroying Seoul, South Korea, Gloria gradually comes to the realiz β¦ation that she is somehow connected to this far-off phenomenon. As events begin to spin out of control, Gloria must determine why her seemingly insignificant existence has such a colossal effect on the fate of the world. (Read More)
Subgenre: | independent filmblack comedyparanormal phenomenacreature featuremonster movie |
Themes: | deathfriendshiprevengesurrealismjealousyfeardrunkennessescapemonsterangersupernatural powerparanoiaredemptionguiltinsanity β¦abusehome invasionalcoholismpanicunemployment (See All) |
Mood: | ambiguous ending |
Locations: | swimming poolapartmentnew york citybarhotelhelicoptersmall townairplanetaxiairportpolice cargas stationschool bus |
Characters: | girlfemale protagonistsoldierwriterbullywaitressalcoholicamerican abroadex boyfriend ex girlfriend relationshipchildhood friend |
Period: | 2010s |
Story: | jumping into a pool with clothes onprologuecreatureslow motion sceneviolencebloodone word titleflashbackkissfightdancingphotographexplosionchasesurprise ending β¦firecell phonefistfightface slappunched in the facewatching tvwritten by directorbattlebrawlshowdownbeerrobotf wordambulancewomanmontagearmydinermapno opening creditschild in perilnews reportbartenderflash forwardparktreestalkerhotel roomdangerproduct placementrace against timeknocked outlightningmanipulationscarstalkinglaptoppremarital sexfireworkslove interestnewspaper headlinesubtitled scenepickup truckdisasterdestructionmass murderbeer drinkingbeardyoutubejumping from heightmind controlrampageplaygroundfight to the deathgash in the facedeath threatevacuationkicked in the crotchthunderstormjumping through a windowaerial shotblack eyeexploding helicoptertelekinesispsychoticmoral dilemmamedia coveragememory lossenglishman abroadgiant robotmagic tricklevitationfinal showdownhomagehuman monstergiant monsterblackoutabandoned housebully comeuppanceyoung version of characterman punching a womanfinal battlewoman fights a mancamera phonefemale bartenderwoman slaps a manlifting person in airfirecrackerhostage situationloss of memorywoman punching a manhit with a chairabusive relationshipwoman punches a mankaijutv setstruck by lightninggiant creatureaction figureemotional abusegooglebar ownerplaying cardthrown from heightseoulfilm with ambiguous titlequirkytoy robotmanifestationman woman fightair mattressdumped by boyfriendwoman with a black eyeseoul south korearobot monster battle (See All) |
A baby girl is discovered in a river by Ranon and Mims, the children of Willow Ufgood, a dwarf farmer and magician and the baby girl is taken into the care of Willow's family. But when a terrifying dog-like creature attacks Willow's village, whilst tracking down the baby. Willow consults the village β¦ council and the wizard The High Aldwin. The High Aldwin gives Willow a task and Willow leaves the village and embarks on the task to give the baby girl to a responsible person. But Willow soon learns the baby is Elora Danan, the baby girl destined to bring about the downfall of the evil sorceress Queen Bavmorda. Joined by his allies: swordsman Madmartigan, sorceress Fin Raziel and the Brownies Franjean and Rool, Willow takes it upon himself to protect Elora from Queen Bavmorda, who intends to kill Elora and prevent Elora from fulfilling her destiny. And Willow and his allies are pursued by Queen Bavmorda's daughter Sorsha and the evil commander of Queen Bavmorda's army General Kael, whom are searching for Elora and bring her back to Queen Bavmorda's castle, where Queen Bavmorda bids to kill Elora in a ritual and prevent the prophecy of her downfall. (Read More)
Subgenre: | fairy taledark fantasymartial artscult filmsword and sorcerysword and fantasychrist allegory |
Themes: | friendshiprevengesurrealismkidnappingbetrayaladulteryescapemonsterheromagicredemptionsadismcourageforgivenessbook of magic |
Mood: | rainpoetic justice |
Locations: | forestsnowboatvillagefarmlakecastlecampfireroad movie |
Characters: | little girllittle boygirlfamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendchildrensoldierbabywarriorbest friendvillain β¦witchself discoverycrying babybaby girl (See All) |
Story: | personfairyanimal attacklifting someone into the aircreaturebookcharacter name in titlebloodone word titledogkissfightdancingtitle spoken by characterknife β¦chasecryinghorsepunched in the facecatbattleswordfalling from heightmaskshowdownhand to hand combatislandrivercombatsubjective cameragood versus evilsword fightmountaindisguisedeath of friendthroat slittingimpalementprisoneranti herofictional warritualjourneyold womanprincesstransformationcursemissiondragontentkicked in the facelightningskeletonfarmerbodyguardpigwaterfallcross dressingqueentrustredheadhuggingdestinyloyaltyspearheroineheavy raintalking animalcagequestcatfightloss of friendhidingvillainessgoatapplefemale warrioradventurerdwarfshieldwizardprophecyrowboatexiledungeontigerpassionate kisskingdomblack magicwilhelm screamsmokedaggercrowhorseback ridingspellfemale soldieradulterous wifehandshakeswordsmanmagic tricklevitationkilling a dograftfortresssorcerertavernreluctant herotyrantchild kidnappingkindnesspotiontrollnewborn babyorchestral music scorehiding placesick childsorceresstrapdoorhorse and wagonaltardog attackstaffvillagerapprenticegender disguisemagic spelldovevillain turns goodwagonbarmaidman dressed as womanbirthmarkdustsledhuman becoming an animalmagical powermagic wandsnowballostrichtyrannymidwifehead scarfcatapultturned to stonemagic showcarrying someoneconfidenceexhaustionbraided haircouncilcaged humanfire breathing dragonbattering ramchased by a dogcrossroadsevil queenlock of hairfalling down a hilllifting a male into the airlove potionanimal biteacornattempted strangulationfrozen alivestepping in shitkilled by a dogbird poopchopping down a treemoattwo headed creatureheld at sword pointlove spellingratitudewhite magicnursemaidmagical dustmythical kingdompart stop motion animationpretending to cryprefectbrownie the creaturefairy dustpunched in the throatmuskratturned into a bird (See All) |
Subgenre: | dark fantasymartial artscoming of ageblack comedysupernaturalsword and sorcerysword and fantasychrist allegoryrevisionist history |
Themes: | mythologydeathmurderfriendshiprevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneralmonster β¦deceptionmagicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrifice (See All) |
Mood: | rainnightmaredarkness |
Locations: | waterforestboatlondon englandvillagewoodsenglandlakeshipcastlecavebrothelsewer |
Characters: | little boyhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guywarrioraction hero β¦maidwitchuncle nephew relationshipmermaidself doubt (See All) |
Story: | glowing eyesaltered version of studio logoanimal attackpoolunderwater scenecreatureslow motion sceneviolencecharacter name in titlebloodflashbackdogbare chested malefighttitle spoken by character β¦explosionknifechasesurprise endingfirebased on bookbeatingcorpseshot to deathblood splatterfistfighthorseshot in the chestshot in the headrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownhand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatshot in the backsubjective cameradecapitationgood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti herodisarming someoneone man armychild in perilfictional warritualkingfemme fataleshot in the legtransformationon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outopening action sceneshot in the shouldermanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantfight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalhawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
Extraordinary teen John Smith (Pettyfer) is a fugitive on the run from ruthless enemies sent to destroy him. Changing his identity, moving from town to town with his guardian Henri (Olyphant), John is always the new kid with no ties to his past. In the small Ohio town he now calls home, John encount β¦ers unexpected, life-changing events-his first love (Agron), powerful new abilities and a connection to the others who share his incredible destiny. (Read More)
Subgenre: | martial arts |
Themes: | deathmurderfriendshipmonstersupernatural powerunrequited love |
Mood: | high school |
Locations: | small townwoodsafricajunglebeach party |
Characters: | father son relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyalienphotographerwarriorbullysheriffaustralian |
Story: | super poweranimal attackhomelifting someone into the airprologueunderwater scenecreatureslow motion scenevoice over narrationshowercharacter name in titlebased on novelnumber in titledogbare chested male β¦fightphotographtitle spoken by characterexplosionpartyknifechasecell phoneshootoutshot to deathfistfightshot in the chestshot in the headshotgunpunched in the faceswordbrawlheld at gunpointshot in the backsubjective cameragood versus evilfoot chaseorphansword fightimpalementstabbed to deathstabbed in the chestinternetno opening creditsanti heronecklacetransformationon the runcharacter repeating someone else's dialoguedangerstabbed in the backfugitivecharacter's point of view camera shottough girlscarhigh school studentexploding bodylaptopwaterfallsubtitled scenestrong female characterpickup trucknerdclaim in titlesupermarketkilling an animalcomic bookmutantfloridajumping from heightfemale warrioralien invasionfight to the deathpower outagestabbed in the legbody landing on a carstabbed in the eyefamily dinnerboxstadiumsevered legsecret identitylighttelekinesisteleportationlaser guntelepathynarrated by characterohioold dark housewebsitefake identitylizardnight visionbully comeuppancereference to youtubeguardiancamcorderopen endedexploding housefirst person titlefairanti heroineteenage herogas explosionearth viewed from spacetitle spoken by narratorjet skiwoman in bikinifalling off a roofcanteenfunfairhuman alienjumping off a cliffconspiracy theoristlifted by the throataliasbased on young adult novelnumber in character's nameridesteel millflorida keyshouse explosionphoto labnecklace yanked offdeath of mentordusterparticle beam weapon (See All) |
Sarah Morton is a famous British mystery author. Tired of London and seeking inspiration for her new novel, she accepts an offer from her publisher John Bosload to stay at his home in Luberon, in the South of France. It is the off-season, and Sarah finds that the beautiful country locale and unhurri β¦ed pace is just the tonic for her--until late one night, when John's indolent and insouciant French daughter Julie unexpectedly arrives. Sarah's prim and steely English reserve is jarred by Julie's reckless, sexually charged lifestyle. Their interactions set off an increasingly unsettling series of events, as Sarah's creative process and a possible real-life murder begin to blend dangerously together. (Read More)
Subgenre: | erotic fantasyerotic thriller |
Themes: | deathmurdersurrealisminfidelitydrugsmoneyjealousydrinkingdanceseductionobsessiondeath of mothersexualitycrueltydying β¦falling in lovewritingpolice investigation (See All) |
Mood: | rainnightambiguous ending |
Locations: | swimming poolwaterrestaurantmotorcyclebathtublondon englandairportvillagecastlesex in a swimming poolsex in pool |
Characters: | policefather daughter relationshipmother daughter relationshippolicemanwriterlustolder man younger woman relationshipself discoverycheating girlfriend |
Story: | fantasy becomes realityhomepoolauthorbookfemale nuditybloodmale nudityfemale frontal nudityflashbackmasturbationmale rear nudity β¦two word titlesex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplesknifesurprise endingerectionpantiestelephone callfondlingwoman on topunderwearsex on couchfoodblondecomputerdrinkbikinisecretsunglasseslingeriebeddead bodycafemarijuanabathroomvoyeurswimmingcleavagebedroombraaxefemale pubic hairsubwayscantily clad femalefemme fatalecigar smokingskinny dippingpublic nuditystrippingmini skirtpassionvacationmoaningcover updiarysensualityscarcountrysidelaptopsleepingpubsexual fantasywaiterteen angstdesirecrucifixtowelmale underwearwatching televisiondwarfshovelnovelistblack eyesexy womandark pastcasual sexmidlife crisisexhibitionismsunbathingwoman in bathtubnude swimmingbisexualitycannabispromiscuous womanpublisherskirteditorrepressiongardenervillaforeignerexhibitionistwriter's blocknymphomaniacsurrogate mothereating disordercaressdigging a graveenigmaspeedoclothes rippingbilinguallawn mowernude sunbathingwheelbarrowenglishwomanmysterious pastrebellious daughterambiguityfrenchwomansidewalk cafedrunken sexhit on the head with a rockpool cleanerdangerous friendlifting up dressgownburning evidencewet suitbistrospeaking frenchmystery writercrime writerdestroying evidenceinhibitionswim suitearplugreference to the marquis de sadeluberon (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Subgenre: | cult filmconspiracytragedyasian horror |
Themes: | deathlovefriendshipsurrealismsuicidebetrayalghostjealousypoliticsmemorybrutalityobsessionparanoiacancerredemption β¦guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
Mood: | rainnightmaredownward spiral |
Locations: | small townbuselevatorvillagewheelchairrooftop |
Characters: | boychildrenfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship |
Story: | return hometalereturnhomeviolencef ratednumber in titlebloodinterviewflashbackfightcigarette smokingphotographsurprise endingpunctuation in title β¦cryinghorsemirrorremakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontagehouseaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicionhaunted housecult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydead childdeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
In Los Alamos, New Mexico, the twelve year-old Owen is a lonely and outcast boy bullied in school by Kenny and two other classmates; at home, Owen dreams of avenging himself against the trio of bullies. He befriends his twelve-year-old next door neighbor, Abby, who only appears during the night in t β¦he playground of their building. Meanwhile, Abby's father is a wanted serial-killer who drains the blood of his victims to supply Abby, who is actually an ancient vampire. Abby advises Owen to fight Kenny; however, soon he discovers that she is a vampire, and he feels fear and love for the girl. Meanwhile a police officer is investigating the murder cases, believing that it is a satanic cult. (Read More)
Subgenre: | dark fantasyindependent filmcoming of age |
Themes: | friendshipreligiondivorcelonelinesssupernatural powerbullyingfalling in loveboy girl friendship |
Mood: | nighthorror movie remake |
Locations: | schoolsnownew mexico |
Characters: | girlboyfriendchildrenteachervampirebullyamericanvampire girlreligious mother |
Period: | 1980swinteryear 1983 |
Story: | swimming underwaterweightliftingbuildinghomebookfemale nuditybased on novelbloodkisscigarette smokingknifethree word titlefireremake β¦rescuewritten by directorprayerswimmingambulancestabbingchild in periltransformationlocker roomperson on firelong takethreatened with a knifesingle parentchainsawiceeavesdroppingaddictiontelescopechild's point of viewchild protagonistyoung lovemurder of a childdead boy12 year oldface masksuper strengthtween girlfemale vampirehugbare chested boymercy killingkiller childstar crossed loverslighting a cigarettetragic lovereference to ronald reaganin medias resjunior high schoolpre teenmiddle schoolsaying gracejoggerbitingyoung boyblood drinkingrubik's cuberailroad crossinggym teachermorse codevampire human loveswimming lessonthinnessspying on someoneattempted drowninghanged bodydangerous friendwedgieacid burningtwenty dollar billchild vampiretweentouching breastbreaking into a carclimbing up a buildingfootprintstriple child murderbarefoot girlneck woundolder manlos alamosswimming bathspre adolescentchild heroinepicture of jesusbarefoot childstrength trainingbarefoot boyremake of swedish film (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | urban fantasyindependent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horror |
Themes: | deathmurderfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism β¦eviltrauma (See All) |
Mood: | gorenightmareslasher |
Locations: | swimming poolwaterhospitalchurchcarmotorcyclecar on firedeath in a car accident |
Characters: | little girllittle boygirlboyfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorfemale protagonistserial killer β¦nursebabyartistreference to godsingle motherwaitresskilleralcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | lifting a female into the airpsychotronic filmlifting someone into the airunderwater sceneslow motion sceneshowerviolencesexfemale nudityf ratednuditybloodbare breastssequelflashback β¦bare chested malegunfemale rear nudityphotographpartyknifechasesurprise endingpistoltelephone calltopless female nuditycryingdreamblood splatterfoodcar accidentwatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a cartransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic bookmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someoneplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
Subgenre: | martial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbucklersword and fantasychrist allegory |
Themes: | deathmurderfriendshiprevengesurrealismkidnappingbetrayalfearescapeherodeceptionmagicfaithhopecourage β¦near death experience (See All) |
Locations: | forestboatlondon englandwoodsshipouter spacecavecampfirecable car |
Characters: | boymother son relationshipchildrenbabyhostagewarriornative americanamerican abroadmermaidship captaincrying boyboy crying |
Period: | world war two1940s1930s |
Story: | altered version of studio logofairyanimal attackkeyprologueunderwater scenecreatureslow motion scenevoice over narrationviolencecharacter name in titlebased on novelone word titlegunfight β¦title spoken by characterexplosionknifechasesurprise endingpistolfirefistfightface slaprescuepunched in the facebattleswordbrawlfalling from heightlettershowdownheld at gunpointhand to hand combatbombrivercombatsubjective cameragood versus evilorphanflashlightsword fightambushaxemountainmixed martial artsmapnunno opening creditschild in perilfictional warsearchjourneyprincesson the runtrainingflash forwardattempted murdertreecharacter repeating someone else's dialogueattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropepiratedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroinesocial commentarybald manslavecannoneaten alivefemale warriorguardvisionexplosivechild's point of viewbraverydual wieldanimated sequencechild protagonist3 dimensionalfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomsword duelcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyhumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanegiant animalpirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All) |
An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.
Subgenre: | coming of age2d animationdisneyswashbuckler |
Themes: | mythologyfriendshipsurrealismkidnappingjealousyheromagicangerchildhood |
Locations: | boatlondon englandseaenglandcavejunglecity of children |
Characters: | little girllittle boygirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipbrother sister relationshipnative americanmermaid |
Period: | 1900s |
Story: | altered version of studio logofairylifting someone into the aircharacter name in titlebased on noveldogfighttitle spoken by characterbased on playdreamrescueswordbedislandgood versus evil β¦orphansword fightmapjourneycigar smokingprincessduelattempted murderumbrellarabbitfirst partwaterfallbearmonkeypiratecaptainflyingwoundblockbusterimpersonationteddy bearclockexplosivechild protagonistshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullcloudfantasy worldfriends who live togetherskyoutlaw gangracial stereotyperaccoonhookpirate shiprhinocerosbig ben londonskunkhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All) |
In Tokyo, the reckless single mother Keiko moves to a small apartment with her twelve years old son Akira Fukushima and hidden in the luggage, his siblings Shigeru and Yuki. Kyoko, another sibling arrives later by train. The children have different fathers and do not have schooling, but they have a β¦happy life with their mother. When Keiko finds a new boyfriend, she leaves the children alone, giving some money to Akira and assigning him to take care of his siblings. When the money runs out, Akira manages to find means to survive with the youngsters without power supply, gas or water at home, and with the landlord asking for the rent. (Read More)
Themes: | lovechristmasmoneylonelinesschildhood |
Mood: | moving |
Locations: | apartmentwatertrainairplaneairportjapan |
Characters: | little girllittle boygirlboymother son relationshipmother daughter relationshipchildrenbrother sister relationshipsingle motherjapanesemotherparent child relationship |
Story: | homebased on true storywatching tvfalling from heightfalse accusationpay phonedeath of childinjuryloss of loved onesanta clausburialtokyo japanshopliftingplaygroundlandlord β¦coin12 year oldoutsiderbaseball gameresponsibilitytenantchild abandonmentluggagenail polishhome alonevideo arcadeneglectmalnutritionsibling relationshipcrayonreference to pubic hairnoodlesmonorailseasonirresponsible parentchild living alonetoy pianobody in a suitcaseenjo kosai (See All) |
The film serves as Garrone's English-language debut and will interweave three separate story strands bookended by brief bits in which Italians Alba Rohrwacher and Massimo Ceccherini will play a street circus family. In one tale Salma Hayek will play a jealous queen who forfeits her husband's life. I β¦n another, Vincent Cassel plays a king whose passion is stoked by two mysterious sisters. (Read More)
Subgenre: | fairy talesword and sorceryadult fantasy |
Themes: | deathmurderlovepregnancyunrequited love |
Mood: | gore |
Locations: | forestlakecastlecavesea monstercanyon |
Characters: | girlmother son relationshipfather daughter relationshipsister sister relationshipmotherwitchdaughtermysterious girlin love |
Period: | 17th century |
Story: | taleplayfairyviolencesexfemale nuditynuditybloodmale nuditybare breastsbare chested malesex scenesinginglesbian kiss β¦topless female nuditywoman on topsex in bedmenage a troisaxesevered headkinganthologytransformationflash forwardpublic nuditytreevirginbased on short storydragonhorse ridingneck breakingbeartwinqueencircusapplausespearnipples visible through clothingtwinsfemale singercovered in bloodtorcharranged marriageheartbeheadingwoman cryingwoodfall from heightscuba divinggraphic violencemagnifying glassthroat cutbaroquefuneral processionfingerogreplaying acoustic guitarskinwoman in laboralbinoskinned alivewild boarspying on couple having sexfire eaterspying on someonefleasouthern italythrown out a windowtwins separated at birthsedan chairpost punkbeating heartclimbing over a wallconjugal rapecutting a ropehorse drawn wagonwooden boxbreast feeding an adultimmaculate conceptiongold chainhigh wirewater springyouth restoreditalian literature (See All) |
Zahra's shoes are gone; her older brother Ali lost them. They are poor, there are no shoes for Zahra until they come up with an idea: they will share one pair of shoes, Ali's. School awaits. Will the plan succeed?
Themes: | lovefriendshipreligionpovertyillness |
Mood: | rain |
Locations: | waterschoolbicycleurban settinglakestormbicycle accident |
Characters: | little girllittle boygirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendchildrenbrother sister relationshipstudentphotographer β¦babyteacher student relationship (See All) |
Story: | ideaslow motionunderwater scenedogcryingwatching tvcamerasecretlietearsrunninglow budget filmneighborclassroomriver β¦competitionsoccervideo camerabridgesearchliarlightningbrotherclassracingtrusttearacehonorstreet lifeiranpromiseshoeschild's point of viewintriguelostblind mantrophylandlordceremonygardeninglaundrysneakerssubtitlesbicyclinggardenerprizegoldfishprincipalshoeiranianblackboardbakerymosqueschoolteacherjumpingsaltvictorypotatocommitmentpencilwinnersugarhijabtehran iranbubblesocksschoolyardperseverancesibling relationshipbullhornneorealismgarbage collectorrugolder brotherfoot racegrocerblisterlistening to the radioshoemakerlatenesscouponfingernailrelay racebrake failurelong distance runnerballpoint penlate for schoollost shoeslippersoaking feetgutterpair of shoestime watchkoi pondholiday campcobbler the shoemakerschool recessdistance runninglong distance race (See All) |
When a green ogre named Shrek discovers his swamp has been 'swamped' with all sorts of fairytale creatures by the scheming Lord Farquaad, Shrek sets out with a very loud donkey by his side to 'persuade' Farquaad to give Shrek his swamp back. Instead, a deal is made. Farquaad, who wants to become the β¦ King, sends Shrek to rescue Princess Fiona, who is awaiting her true love in a tower guarded by a fire-breathing dragon. But once they head back with Fiona, it starts to become apparent that not only does Shrek, an ugly ogre, begin to fall in love with the lovely princess, but Fiona is also hiding a huge secret. (Read More)
Subgenre: | fairy talecult filmsword and sorceryepiccomputer animationcgi animationgross out comedyfairy tale parody |
Themes: | deathfriendshiptortureweddingheromagiccorruptionwrestlingredemptioncannibalismvengeancecourageunlikely hero |
Mood: | satire |
Locations: | forestcastle |
Characters: | friendsoldierwarrior |
Story: | creatureslifting female in airaltered version of studio logofairyanimal attacklifting someone into the airslow motioncharacter name in titlemale nuditykisstitle spoken by characterchasesurprise endingfirebased on book β¦title directed by femalefistfightmirrorrescuebattleswordbrawlbeercombatsubjective cameraanti herocoffinprincesstransformationduelcursebeaten to deathdragonskeletonisolationpigfirst partbeardismembermentdestinywolfloyaltyspeartalking animalquestmutilationmousehunterblockbustergiantflatulenceknighthonoreaten alivedwarfshieldcrossbowfight to the deathhit in the crotchswamparmordisfigurementkingdomsevered legalienationcrude humordaggerchallengesurprise after end creditsblindbullet timespellsidekickdonkeysunsettoweraccordionshot with an arrowreluctant herocartoon violencesunrisebishopwindmillpitchforkanachronismbased on children's bookarm ripped offleadershiplordogregnomestained glass windowinterrupted weddingfire breathing dragonouthousecgi filmrope bridgejudgmentbelchmagical mirroronionethnic cleansinggingerbread mandark agesactor voicing multiple charactersawkward silencecandlestickinterspecies romanceflying dragonshreksword throwingbluebirdwinged dragondrawing in sandhybrid animaltrampled to deathexploding animalstorybook in opening shotrotisseriesarcasm taken literallydecree (See All) |
The impressionistic story of a Texas family in the 1950s. The film follows the life journey of the eldest son, Jack, through the innocence of childhood to his disillusioned adult years as he tries to reconcile a complicated relationship with his father ('Brad Pitt' (qv)). Jack (played as an adult by β¦ 'Sean Penn (I)' (qv)) finds himself a lost soul in the modern world, seeking answers to the origins and meaning of life while questioning the existence of faith. (Read More)
Subgenre: | independent filmcoming of ageepic |
Themes: | deathmarriagereligionjealousypregnancyfearmemorytheftdysfunctional familyguiltgriefbullyingeducationphotographyhope β¦crueltychildhoodinheritanceafterliferegret (See All) |
Mood: | rainavant gardemoving |
Locations: | swimming poolbeachrestaurantschoolchurchforestcemeterysmall townairplanebathtubdesertbicycleelevatorwoodsurban setting β¦police carseacourtroombaseballouter spaceoceanchinatexasstormrunning into water (See All) |
Characters: | little boyboyfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipafrican americanchildrenbrother brother relationshippolicemanmusicianbabypriestthief β¦christianreference to godbullywaitresschristianitycatholicchinesegrandmother grandson relationshipengineeryounger version of characterpregnant wifecrying babydeath of boydeath wish (See All) |
Period: | 1950s |
Story: | lawn sprinklergrassswimming underwaterbutterflystorytellingunderwater scenebookslow motion scenevoice over narrationflashbackdogbare chested malekissfightdancing β¦explosiontelephone callfirecryingcell phonefoodmirrorface slapcatarrestpaintinglietearsrunninglingeriedead bodycafepianoclassroomprayerguitarriverswimminghalloweensurvivalnewspaperflashlightcandlebridgeeatinghousesnakefishnonlinear timelinechild abuseapologyman with glassescoffinbathsearchjourneygraveyarddrowningpaingunshotflash forwardtreeclownsuburbfired from the jobliarreadingbaseball batflowerscourtdeath of brotherchildbirthdeath of songardenwaterfallflowerclasssleepingtrustkillingredheadhateblack americanrecord playermachismoeyeglassesdestinybreaking and enteringlooking at oneself in a mirrorlistening to musicfaintingrecordingvandalismguitariststealingplanetswimsuitsharkladderbirthfollowing someoneend of the worldambitiondinosaurpromisewindsufferingthundermourningloss of sonchild protagonistkickinginsectcigarette lighterbible quotecard playingsibling rivalrysunvolcanoatticshadowchoirswingbarbecueexistentialismgrowing upmarital problemloss of brotherchildhood memoryfast motion sceneshamebeing followedpiano playersermonspittinggiving birthhandshake12 year oldgardeningnotebookbaptismhomecomingreading aloudstairwayescalatorlooking out a windowabandoned houselizardvery little dialogueskyscrapernaivetyseagullwhisperingenvylavabubble bathstrokebare chested boyelectric shocktrain tracksuniversebreaking a windowguitar playernewborn babyclimbing a treefailuremeteorprehistoric timestelegramreading a newspaperstarscar radiotreehousedistrustdeath by drowningtoy gunsilhouettefetuswaveplant in titleexpectant motherdomineering fatheroverhead shotsaying gracecourthousedare19 year oldkneelingexpectant fatherwater hosewashing dishesice cubehand kissingplanet earthsnoopinghoselooking in a windowjigsaw puzzlejumping on a bedorganiststeamheartbeatstained glass windowtrashcanloss of innocencelaundry drying on clothes linecar repairpower plantschoolyardsparklercosmosplayingelectric fanthree brotherswind chimeembryochild as main charactersunflowerancestrylearning to readblessinglighting a candlebig bangblowing bubblessomersaultdeath in familybad newsplainplaying catchtarkovskyesquebb guncrossing oneselfwading in waterwalking on a beachstrict fatherdaily lifedestroying propertyholding head underwaterpatentpipe organwatering cantime capsulewanting to dieartificial respirationhand clapping gamebegins with a quoteresentment toward fatherlimping manreference to johannes brahmsschool bellstreetlightrolling down a hilltree swingplanting a treebegins with a quotationreference to jobhanging out washingtolling bellorigins of lifeveinair rifleelectrical shockfloating in the airglass elevatorhairbrushglass coffinpraying handswaco texaseye maskfertilizationkicking a canpineconeddtdirgejumping from a treepantheismreference to arturo toscaninisurvival of the fittestdeath notificationbirth of sonhit with a boardice traylearning to walkparents arguing (See All) |
In this update of Disney's masterpiece film mixture of animation and music, new interpretations of great works of music are presented. It begins with an abstract battle of light and darkness set to the music of Beethoveen's Fifth Symphony. Then we see the adventures of a Humpback Whale calf and his β¦pod set to "The Pines of Rome." Next is the humourous story of several lives in 1930's New York City, scored with "Rhapsody in Blue." Following is a musical telling of the fairy tale, "The Steadfast Tin Soldier" set to Dmitri Shostakovich's Piano Concerto No. 2. Then a goofy Flamingo causes havoc in his flock with his yo-yo to the tune of the finale of "Carnival of the Animals." This is followed by the classic sequence from the original film, "The Sorcerer's Apprentice" starring Mickey Mouse and followed by "Pomp and Circumstance" starring Donald Duck as a harried assistant to Noah on his Ark. Finally, we see the awesome tale of the life, death and renewal of a forest in a sequence featuring the composition, "The Firebird." (Read More)
Subgenre: | fairy taledisneybiblical |
Themes: | deathsurrealismjealousyfearartmagicnatureangertheftunrequited lovehopeunemploymentfreedombook of magic |
Mood: | rainarchive footagepoetic justice |
Locations: | swimming poolapartmentwaternew york citytrainforesthotelcarsnowboatnightclubdesertbicycletaxielevator β¦woodslakeshiptruckrooftopcaveoceansewerforest fire (See All) |
Characters: | little girlfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteacherpolice officerdancermusicianactorartistbullywaitresscomedianfisherman |
Period: | 1930swinter |
Story: | taleeaglebutterflyfairybooknumber in titlesequeldogkissdancingknifechasefirecryinghorse β¦mirrorremakerescuecatfalling from heighttearsrunningcafepianoriversubjective cameranewspaperaxemountainsubwaysnakefishdream sequencedrawingfishingsearchanthologycoffeepaintreeportraitumbrelladragondollrabbitlightningscreampianistsadnessratunderwaterbearnewspaper headlinemonkeyjazzicewolffireplacedestructionfaintingperformanceelephantmagicianmousetoyoverallsclassical musicfrogtennisrailway stationpart animationviolinmilkorchestragoatclockembarrassmentapplepresumed deadanthropomorphismfloodtrappedthunderhypocrisymisunderstandingpet doganthropomorphic animalrejectionhungerdespairdrummerballlaughterlionice skatingvolcanodaydreamshadowspyingdeerturtlecliffduckboxhorse and carriageflightweathercoinbatjoycamelspellimaxhandshakenew jobmagic trickclosetconstruction workerfountainwhalefoxadvertisementpaintdoubtremorsebottlestonechoreographyescalatorwoodtemptationbeeperformerpopcornfalling into waterseagulllavaquitting a jobjacketsorcerercloudhostgreat depressionballerinadisappointmentimmaturityalligatorasheshammockcrabmeteorpart computer animationrainbowhonestymistakeapepart live actiondrillpolar bearclumsinessconductorgymnasticskangaroowindowmiseryspringabstractcourtshipdoormanapprenticelocketgiraffenoiseblanketdoverebirthunicornrevolving doordance lessonregenerationstreet vendorice rinkbroombaldnesspaperdance classfaunacity parkconformityflorasheet musicsignextinctionnetsubway trainbucketbubblecoatphonograph recordvasehornrhinoceroswheelbarrowabstract artmovementfloatingostrichchestzebrajazz clubfigure skatinghard hatleashvolcanic eruptioncartcollisionnoseorganisticebergskunksunlightcarrying someonehippopotamusimpressionismimitationbeaverdoughnutsnobberybowling ballyo yonight shifttoy comes to lifecraneindividualitysoundtrackperseveranceillustratorhigh risegrand central station manhattan new york cityjack in the boxlunchboxoxygen tankbad singingneon lightbowldisney animated sequelone legged manswimming lessonflamingopet storeelkiciclemarqueenoah's arkmilkmanfatiguehopscotchmusic lessonscubalife jacketramppuddlestooltripping and fallingashcauldronjazz combotubewhirlpoolarkcentral parkdizzinesssupernovaspellcastingbillporcupinespritetunicoversleepingfreight elevatorwoodpeckerbreathsleeping in a chairbrushcartoon reality crossoverswallowed wholetoy boatimpatiencesinging lessonelevator operatorleakpeanutchain reactionflower petalhenpecked husbandpantaloonwalnutlinebranchteardropflipperglowing eyestepping on someone's footdevastated landscapedramatic ironygriffinchorinefirebirdflooded roomtrampleddog bonetimingfruit cartlily padmagical hatseeing starscelebrity caricatureclub the weapontin soldierblowingbuilding blockpunch clocktennis lessoncushiondrumstickgesturegymnastic ringssquirting waterflotation devicegratehornbill (See All) |
John Constantine is approached by Det. Angela Dodson who needs his help to prove that her twin sister Isabel's death was not a suicide. The dead woman was a devout Catholic and Angela refuses to accept she would have taken her own life. She's asked Constantine for help because he has a reputation fo β¦r dealing with the mystical. In fact, he is a demon hunter whose sole purpose on Earth is to send demons back to the nether regions. John himself has been to Hell and knows that he is destined to return there on his death - but hopes his good deeds may find him a place in Heaven. As he looks into Isabel's death, he realizes demons are trying to break through to the human world, and his battles lead him into a direct conflict with Satan. (Read More)
Subgenre: | cult filmsuspensesuperherosupernaturalchrist allegorychristian horror |
Themes: | deathmurdersurrealismsuicidereligiondrunkennessinvestigationdeceptionsupernatural powercancerredemptionself sacrificedevilnear death experienceunlikely hero β¦the devilreligious faith (See All) |
Mood: | nightmaredarkness |
Locations: | swimming poolapartmentwaterhospitalbarcarlos angeles californiabathtubbusnightclubtaximexicotaxi drivercatholic church |
Characters: | police officerdetectivepriestsister sister relationshiptough guywarriorreference to godchristianitypolice detectivebiblecatholicself mutilation |
Period: | 2000s |
Story: | jumping into a pool with clothes onpurposepsychotronic filmreturnstorytellingbookslow motion scenebloodone word titleflashbackbare chested maleguncigarette smokingtitle spoken by characterknife β¦chasesurprise endingpistolcorpseshot to deathmirrorshot in the chestshotgunpunched in the facecatfalling from heightbased on comicshowdownheld at gunpointdead bodydemonhallucinationshot in the backgood versus evilflashlightbased on comic bookcaliforniaambulancedinerweaponanti heroone man armyhit by a carvandrowningconfessionsmokingcharacter repeating someone else's dialoguebeaten to deathelectrocutionpossessionangelcrossexploding bodyautomobilebasementpolicewomanratdirectorial debuthandgunobscene finger gesturetwinbased on filmsacrificepsychicsubtitled scenestrong female characterterminal illnessprivate detectivesisteroccultgoldspearnipples visible through clothinggothiccomic booksurvivortied to a bedcrucifixmorguewristwatchclubback from the deadstealing a carlandscapecrossbowfight to the deathpower outagebroken glasstitle appears in writingreference to satanheavenscene after end creditsdark heroraised middle fingerdemonic possessionasylumdc comicsexorcismfemale detectiveprivate investigatorsurprise after end creditsdrugged drinkalleycartoon on tvstabbed in the handmysticismhead blown offsuit and tiedual rolebroken mirrorburnt facehearing voicesfilm starts with textbowling alleywrist slittingburnt bodylighting a cigarettefemale police officerdumpsterblack catspitting bloodtwin sistercoughing bloodnight timebreaking through a doorelectric chairshot through a doorcut handelevator shaftholy waterzippo lightersurname as titlethrown from a carescaped mental patientbegins with textluciferdecomposing bodycrushed by a carelectroshock therapylifted by the throatbrass knuckleshand through chesttwin sisterslung cancersevered faceboiler roomvoodoo dollwoman in a bathtubfallen angelactress playing male rolepsychiatric wardlucid dreammiddle fingernazi flagsplit lipindoor swimming poolhare krishnathrown through a wallmelting facehalf breedjumping off a roofsprinkler systemdrinking watersplit headglass shardreality vs fantasychain smokinghead held underwaterdemon huntergood deedasking for helpfire sprinklerlast ritesleg blown offstopped timeguessing gameblowing smoke in someone's faceholding one's breath underwatervertigo comicsdripping waterelectroconvulsive therapyangel wingsone actress for twin sisterscrushed carfemale police detectivelighting someone's cigarettedeserted townshock therapyfalling into a poolfalling through a glass roofjammed guninsect attackfalling glassfloating in the airinsect swarmmotor carwhistling kettlemortal sinoccult detectivewalking on the ceilingcough medicinereflection in a rearview mirrorspear of destinyarchangel gabrielface blown offin bathtub with clothes onreligious womandropping deadfalling into poolheaven vs hellmelting womansetting off a sprinkler systemfriend killedid braceletwinged demon (See All) |
Living in India, Mary Lennox, a young, privileged girl, is left orphaned when her parents are killed in an earthquake. She is sent back to England where she goes to live on her uncle's estate. It is a fairly isolated existence and she has to find things to keep herself occupied. She finds a sickly y β¦oung boy...and a secret garden. (Read More)
Subgenre: | costume drama |
Themes: | friendshipmagicnaturelonelinessdeath of fatherdeath of motherredemptiongriefhopecrueltychildhoodwealth |
Locations: | bathtubrural settingwheelchairindia |
Characters: | little girllittle boygirlboyfamily relationshipsfather son relationshipfriendmaidcousin cousin relationshipemployer employee relationshipuncle niece relationshipself discovery |
Period: | 19th century |
Story: | lifting someone into the airkeyvoice over narrationfemale nudityf ratedbased on noveldogphotographtitle spoken by characterfirecryingtitle directed by femaledreamunderwearhorse β¦face slapcamerasecretneighbororphanmansiondream sequenceportraitpuppetwidowergardenstrong female charactericeelephantloss of wifeservantstrong female leadtorchearthquakereconciliationchild's point of viewtime lapse photographyrosefrustrationyoung loveswinghousekeeperhorse and carriagebonfirepigeonunclehorseback ridingvictorian eratriple f ratedparalysismedical maskweedestatestaircasediscoverygardenerhideoutbellmusic boxhiding under a bedsick childcarriagetantrumpuppet showliverpoolsecret passagewaymanor househidden doormaster servant relationshipoil lampjigsaw puzzlesunlightwhite horseseedneglecttemperorphan girljigsawchild as main characterneglected childcomfortspiritual healingivorystrange noisebluebellsrobintapestryemotional healingshut inwidowed fatheryorkshire englandinner strengthchange of seasonswater lilymaharajaenglish gardenwoman slaps a girllearning to walk (See All) |
It's a hot summer on Amity Island, a small community whose main business is its beaches. When new Sheriff Martin Brody discovers the remains of a shark attack victim, his first inclination is to close the beaches to swimmers. This doesn't sit well with Mayor Larry Vaughn and several of the local bus β¦inessmen. Brody backs down to his regret as that weekend a young boy is killed by the predator. The dead boy's mother puts out a bounty on the shark and Amity is soon swamped with amateur hunters and fisherman hoping to cash in on the reward. A local fisherman with much experience hunting sharks, Quint, offers to hunt down the creature for a hefty fee. Soon Quint, Brody and Matt Hooper from the Oceanographic Institute are at sea hunting the Great White shark. As Brody succinctly surmises after their first encounter with the creature, they're going to need a bigger boat. (Read More)
Subgenre: | cult filmsuspensecreature featurecult classic |
Themes: | deathmarriagefearmonstergreedpanicfear of water |
Mood: | gore |
Locations: | waterhospitalbeachhelicoptersmall townboatseashipoceanfishing boatboat accident |
Characters: | little boyboyhusband wife relationshipfather son relationshipmother son relationshiptattoopolicemanmayorfisherman |
Period: | 1970s |
Story: | dolly zoomanimal attacklifting someone into the airunderwater scenecreatureslow motion sceneviolencefemale nuditybased on novelbloodone word titledogfemale rear nuditynipplesexplosion β¦singingsurprise endingfirebased on bookface slapshowdownriflemarijuanaislandsubjective cameraswimmingnew yorksevered headman with glassesfishingchild in perilskinny dippingdangerfirst of seriescharacter's point of view camera shotprankscarfirst partunderwatercult directorclass differencesgraffitimale bondingcaucasianblockbusterpart of trilogysharkeaten aliveloss of sonautopsysevered legcharacters killed one by onefinal showdownkilling a dogpolice chiefsailboatraftbillboardresponsibilityscuba divingshockfamous scoreorchestral music scorefourth of julywoman slaps a mantelevision reporterbarrelnude bathinganimal killingfamous lineshark attackworld war two veteranmarinascreenplay adapted by authorferry boatship wreckreference to jack the ripperimitationnight swimmingkiller sharkauthor cameotrailer narrated by percy rodriguezoxygen tankcoastal townlicense plategreat white sharkrepairship sinkingfamous opening themefemale slaps maletown meetingswimchild eatensolitairenorth atlanticcontemporary settinglimerickmartha's vineyardshark featureman versus naturehuman versus sharkhigh conceptvertigo shotinflatable raftpredatorial horrorscientist heroday for nightchild killed by an animalfingernails on chalkboardgiant sharkchumshark cagewoman killed by a sharkeaten by shark (See All) |
Holding a mysterious leather suitcase in his hand, Newt Scamander, a young activist wizard from England, visits New York while he is on his way to Arizona. Inside his expanding suitcase hides a wide array of diverse, magical creatures that exist among us, ranging from tiny, twig-like ones, to majest β¦ic and humongous ones. It is the middle of the 20s and times are troubled since the already fragile equilibrium of secrecy between the unseen world of wizards and the ordinary or "No-Maj" people that the MACUSA Congress struggles to maintain, is at risk of being unsettled. In the meantime, the voices against wizardry keep growing with daily protests led by Mary Lou Barebone and fuelled by the increasing disasters ascribed to a dark wizard, Gellert Grindelwald. At the same time, by a twist of fate, Newt's precious suitcase will be switched with the identical one of an aspiring No-Maj baker, Jacob Kowalski, while demoted Auror, Tina Goldstein, arrests Newt for being an unregistered wizard. To make matters worse, with the suitcase in the wrong hands, several creatures manage to escape to unknown directions. Before long, this situation will catch Senior Auror Percival Graves' attention who will target both Tina and Newt amid panic caused by an invisible, devastating and utterly unpredictable menace that still wreaks havoc in New York's 5th Avenue. Is there a hidden agenda behind Graves' intentions and ultimately, what will happen to the remaining magical creatures still loose in the stβ¦ (Read More)
Subgenre: | urban fantasydark fantasyslapstick comedyfish out of watersteampunkperiod film |
Themes: | deathlovefriendshiprevengesurrealismchristmasbetrayalfeardrunkennessescapegangsterdeceptionmagicrobberyanger β¦supernatural powerparanoiaunrequited loveexecutionpanicprison escapeunlikely hero (See All) |
Mood: | rain |
Locations: | apartmentnew york citybartrainsnownightclubdeserturban settingpolice carjunglecar fire |
Characters: | little girlfather son relationshippolicesingerbrother brother relationshipphotographerwritersister sister relationshipwitchbaker |
Period: | 1920s |
Story: | creaturesglowing eyesaltered version of studio logoeagleanimal attackauthorcreatureslow motion sceneshowerf ratedbased on novelkissfightphotographtitle spoken by character β¦explosionchasesurprise endingfirebased on bookcorpsecar accidentshotgunrescuepunched in the facebattlearrestbrawlshowdownheld at gunpointinterrogationhandcuffsrevolvermanhattan new york cityreportersubjective cameragood versus evilorphandisguisemontagebridgesubwayfalse accusationtrialno opening creditsbirdanimaldouble crossnecklacebartenderon the runcursedangerprotestfactoryfugitivepoisonumbrellacharacter's point of view camera shotmissionrace against timesuitcasecover upevil manchristmas treebaseball batbankmanipulationdeath of brotherpresidentexploding bodyautomobiledeath of sonwitnessrattypewriternewspaper headlinemonkeyicegolddestructionrevelationbreaking and enteringheavy rainegghelmetspin offmagicianexploding buildingwitchcraftfraudblockbustereccentricwristwatchpress conferenceculture clashbrooklyn new york citymind controlorphanagefalse identitybar fightclockrampagevisionitalian americanimpostorpower outage3 dimensionalchaoszooinsectlove at first sightwizardblack and white scenesenator3dlionice skatingaerial shotdungeonraidlong titlepolice raidmutationsecret identityblack magicferryprequelteleportationmedia coveragetelepathyspellenglishman abroadinvisibilityinvestigatorlevitationalleyfinal showdownwhalebureaucracycentral park manhattan new york citysubway stationfake identityevil spiritportalabandoned housebrooklyn bridgecomic reliefsecret societymegalomaniacskyscraperhanging upside downdepartment storesorcererlandladyadopted sonbakerypremonitionfactory workerstatue of liberty new york citychandelierpotionrallydomestic abusegoblinfinal battlefamous scorecollectorcamouflageoverturning carrighteous rageshape shiftercorrupt officialsorceryadopted daughterjailbreakmind readingpentagramwanted posterwrongful arrestforce fieldgiant animaltrenchcoatmagic spellprohibitionrainforestrevolving doorabusive motherjewelry storetragic villaincustomsgold coinbubblegrand canyonhands tiednewspaper editorbank vaultrhinocerosmagic wandbritish actor playing american charactercriminal mastermindbank managergiant creatureorbcouncilfragments of glasshippopotamussanctuaryanti villaincryptozoologylobotomybirdcageministryevil sorcererkleptomaniacnewsstanderased memorysecret revealedworld war one veteranabusive parentflipping carsea lionteapotshape shiftingwandspeakeasytrue identity revealedmagical objectmagical creaturemisadventurewhimsicalgiant birdtime reversalyear 1926gas lampadopted sisterhome repairextremist groupgifted childcryptozoologistgolden eaglederelict houseabuse victimrotary clubdestroyed buildingplatypusstrudelneck bitefemale investigatorrockefeller center (See All) |
Scotty Smalls moves to a new neighborhood with his mom and stepdad, and wants to learn to play baseball. Rodriguez, the neighborhood baseball guru, takes Smalls under his wing - soon he becomes part of the local baseball buddies. They fall into adventures involving baseball, treehouse sleep-ins, the β¦ desirous lifeguard at the local pool, the snooty rival ball team, and the travelling fair. Beyond the fence at the back of the sandlot menaces a legendary ball-eating dog called The Beast, and the kids inevitably must deal with him. (Read More)
Subgenre: | cult filmcoming of age |
Themes: | friendshipchildhood |
Locations: | swimming poolbaseball |
Characters: | boyfamily relationshipschildrenself narrationboy girl kiss |
Period: | 1960ssummeryear 1962 |
Story: | playpoollifting someone into the airunderwater sceneslow motion scenevoice over narrationdogtwo word titlekisstitle spoken by characterexplosionchasevomitingcandledream sequence β¦profanityfireworkswhat happened to epiloguecakescene during opening creditsgroup of friendstwinscarnivaldivingteamblack and white sceneblack eyefriendship between boysblind manspittingjunkyardsports teamfencetelling someone to shut upname callingvacuum cleanerboy with glassesbeastkidkiss on the lipsbaseball capbaseball gameutahjumping into watertreehousefourth of julyunwanted kissbaseball fieldmale vomitingstory tellingchild swearingfunfaircatapultcalling someone an idiotsteakbaseball moviemouth to mouth resuscitationdiving boardchased by a dogbaseball glovesummertimebaseball fanhomerunclimbing over a fencedoghouseplaying catchjumping into a swimming poolbaseball cap worn backwardsreference to babe ruthgroup of childrenwavingchewing tobaccoreference to the new york yankeesreference to playboyhome runthumbs up gesturereference to herculesjumping into a poolmastiffhit with a baseballcampoutplaying baseballyankees baseball capdiving into waterfemale lifeguardjuly 4thunable to swimpretending to drownautographed baseballcannonball divehit in face with a ballreference to lou gehrigreference to the world serieschild vomittingfairground rideredheaded childsandlot baseballsteak on black eye (See All) |
The medical Dr. Owen leads a three-men SWAT team inside the sealed off building to get blood sample from the girl Medeiros to develop an antidote. They are attacked by the zombie-like creatures and Dr. Owen locks a zombie inside a room using a crucifix. He discloses that the patient zero was possess β¦ed by the evil and the Vatican sent him to save mankind. Further, they will only leave the building under his voice command. Meanwhile, three teenagers follow a fireman and a man that breaks into the building through the sewage system to rescue his colleague and daughter respectively and they are trapped inside. They are lured and release the evil creature that was locked by Dr. Owen in a room. Out of the blue, the lead team meets the journalist Angela Vidal hidden inside the building. (Read More)
Subgenre: | medicalfound footagevideochristian horror |
Themes: | deceptionsupernatural power |
Mood: | gore |
Locations: | apartment |
Characters: | girlbrother sister relationshipsniper |
Story: | apartment buildingevil creaturecreaturesbuildingcreaturesurprise endingshot to deathshot in the chestshot in the headheld at gunpointf worddeath of childchild murderoccultswat team β¦gas maskteamshot in the facefalling to deathexploding headassault rifleaccidental killingdemonic possessionshot through a windowgun in mouthhead blown offnight visionaccidental shootinghead bashed inshot through the mouthflesh eating zombiegraphic violenceopen endedhit with a hammerpolice officer shot in the headstabbed in the mouthfreezerbitten on the armblood sampleshot in the earchild shot in the headmurdered priestmedical officer (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
Subgenre: | cult filmparanormal investigation |
Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
Mood: | moving |
Locations: | swimming poolcemeterykitchen |
Characters: | little girllittle boygirlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipteenage girlphotographersister sister relationshipemployer employee relationship β¦blonde girl (See All) |
Period: | 1980s |
Story: | lifting a female into the airhomelifting someone into the airone word titleinterviewpantiescorpsemirrorblondewatching tvcameralingeriemarijuananeighborhallucination β¦voyeurtelevisiongood versus evilcleavagevideo camerahousewhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingfirst parthaunted houseobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recordertoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieversource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
Subgenre: | supernaturaltragedymedicalparanormalteen movieteen horrorpsychological thrillerpsychological horror |
Themes: | deathfriendshiprevengesurrealismfeardrunkennessescapeobsessionsupernatural powerparanoiaredemptionguiltbullyingpanicchildhood β¦near death experienceafterliferegret (See All) |
Mood: | nightmarehorror movie remake |
Locations: | swimming poolapartmentwaterhospitalbarsnowmotorcyclebathtubbusnightclubelevatorrooftopyacht |
Characters: | mother daughter relationshipafrican americandoctornursesecurity guardprofessorcrying baby |
Period: | 2000s2010s |
Story: | psychotronic filmprologueunderwater sceneslow motion sceneshowerone word titleflashbackbare chested malekissinterracial sexknifesurprise endingcell phonedreamcorpse β¦car accidentremakerescuefalling from heightsunglassescar crashpianohallucinationreference to jesus christsubjective cameraswimmingflashlightdeath of friendmontagebridgeapologyvoice overflash forwardlibrarydangerfantasy sequencecharacter's point of view camera shotrace against timecover updeath of childinjectiontragic eventbasementlaptoppremarital sextwenty somethingsyringeelectronic music scorehypodermic needleloss of friendmorguecaucasianaccidental deathwristwatchparking garageback from the deadhaunted by the pastpower outageresurrectionfalling to deathdeath of sisteraerial shotalternate realitydark pastlightmoral dilemmabullet timetext messagingmale objectificationstabbed in the handscene before opening creditsold flamebroken mirrordomineering motherhearing voicesmedical studentraveloss of sisterexperiment gone wronghigh techtragic pastcamera phonetaking off clothesmedical doctorbulldozercar rolloverhedonismscience runs amokwhite coatjellyfishflickering lightmedical experimentbritish actor playing american characterrubik's cubepagerwalking stickhouseboatscientific experimentguilty consciencedefibrillationdefibrillatorout of body experienceyear 2017inside the mindseeing dead peoplevirtualitybrain scancompetitivenessparanormal phenomenonreference to jesusside effectcyberbullyingremake of cult favoritemedical sciencemedical scannercar falling off a bridge (See All) |
Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t β¦rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)
Subgenre: | independent filmblack comedyconspiracysupernaturalparanormal phenomena |
Themes: | deathmurderrevengesurrealismkidnappingghostfearescapeheroinvestigationdeceptionmemorysupernatural powerterrorismparanoia β¦redemptionsurveillancehome invasionpanicpolice brutalitynear death experienceafterlifeunlikely hero (See All) |
Mood: | neo noirnightmaredarknesspoetic justice |
Locations: | swimming poolapartmenthospitalrestaurantchurchsmall townbathtubdesertwheelchairpolice carmotelsinging in a carcar bombdesert town |
Characters: | husband wife relationshippolicemother daughter relationshipboyfriend girlfriend relationshipdoctortattooprostitutepolice officernursepolicemanhostagetough guywarriorsingle motherwaitress β¦security guardsheriffpolice shootoutdeath of girlfriend (See All) |
Period: | seeing the future |
Story: | pool partyfortune tellerbutterflyanimal attackslow motioncreatureslow motion scenevoice over narrationviolencecharacter name in titlebased on novelbloodflashbackdogtwo word title β¦kissfightcigarette smokingphotographtitle spoken by characterexplosionpartyknifechasesurprise endingpistolfirecell phoneshootoutbeatingdreamcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headrescuepunched in the facecomputerwritten by directorarrestgunfightbrawlsecretshowdownheld at gunpointbombcar crashdemonhandcuffsrevolvershot in the backgood versus evilfoot chasebound and gaggedcaliforniaterroristmassacremontagedinerexploding carfalse accusationsevered headcultno opening creditsbirddisarming someoneone man armychild in perilhit by a cardouble crosspolice officer killedvanattempted murderlimousinecursedangerscreamingperson on fireuniformproduct placementrace against timecover upknocked outbaseball batopening action sceneshot in the shouldermanipulationexploding bodymanagercharacter says i love yousevered armshot in the armlas vegas nevadasilencerpsychiccorrupt copfreeze framesingle parenttwenty somethingprivate detectiveeavesdroppingburned aliverevelationeggsociopathice creamcooksecurity cameraloss of loved onespiderskullcarnivalfatepicnicmasked mancrime scenedamsel in distressstealing a carvisionexplosivesevered fingershot in the faceshopping mallm 16police officer shotescape attemptframe uptime lapse photographyassault riflewisecrack humorblood on shirtbulletproof vestrefrigeratorbarbecuedemonic possessionterrorist plotkilling spreedeath of loved oneburned to deathowlnewspaper clippingframed for murdershot multiple timesprivate investigatorbullet timehit with a baseball batshot through a windownarrated by characterinvisibilitymysterious manterrorist grouppickpockettimebombfountainold dark housecockroachevil spiritpolice chiefportaldisposing of a dead bodyyoung version of charactermalltrailer homescootercheering crowdhearing voiceselvis presleyflybody in a trunkhit by a truckdeputybowling alleypremonitionman kills a womanoffscreen killingshot point blankbullet woundmeteorbomberpart computer animationtragic lovehiding under a bedexploding housewoman in a bikinitragic endingcarouselanimal killingvillain not really dead clichelocketinnocent person killedclairvoyantgas explosionpoltergeistwater fountainpancaketoothmusic storetime bombice cream conefingerdecomposing bodyrunning for your liferescue attemptchild killerloss of girlfriendjumping from a carcamel toerottweilersatanic culttiredevil worshipgas chamberblowing a kissclairvoyancestartledable to see the deadbirdcagechased by a dogdomestic terrorismfictional townmilkshakesatanicseeing dead peoplewalking on waterdead body in a bathtubice cream parlorstorm drainpushed into a swimming poolexploding trailerhouse explosioncoitus interruptuscontemporary settingbarbecue grillsevered toesweethearthomemade explosiveseeing ghostscamera shot of a woman's legshotwiringshort order cookabandoned prisonice packwoman wearing a little black dressbody in a car trunkbreak door incar truck crashbluetoothdevil worshiperfalling into swimming poolvehicular accidentchurch towerdriver shotdriving licensevan explosionreloading a gunfortune telling machinehorse rideshot in facetruck car collisionabandoned restaurantsupernatural ability (See All) |
United Press International journalist Will Bloom and his French freelance photojournalist wife Josephine Bloom, who is pregnant with their first child, leave their Paris base to return to Will's hometown of Ashton, Alabama on the news that his father, Edward Bloom, stricken with cancer, will soon di β¦e, he being taken off chemotherapy treatment. Although connected indirectly through Will's mother/Edward's wife, Sandra Bloom, Will has been estranged from his father for three years since his and Josephine's wedding. Will's issue with his father is the fanciful tales Edward has told of his life all his life, not only to Will but the whole world. As a child when Edward was largely absent as a traveling salesman, Will believed those stories, but now realizes that he does not know his father, who, as he continues to tell these stories, he will never get to know unless Edward comes clean with the truth before he dies. On the brink of his own family life beginning, Will does not want to be the kind of father Edward has been to him. One of those stories from Edward's childhood - that he saw his own death in the glass eye of a witch - led to him embracing life since he would not have to fear death knowing when and how it would eventually come. The question is whether Will will be able to reconcile Edward's stories against his real life, either directly from Edward before he dies and/or from other sources, and thus allow Will to come to a new understanding of himself and his life, past, pβ¦ (Read More)
Subgenre: | fairy tale |
Themes: | deathlovesurrealisminfidelityreligionmoneyadulterypregnancyescapeweddingfuneralmonsterherorobberyextramarital affair β¦lonelinesstheftdeath of fatherunfaithfulnessillnessdyingfalling in loveutopia (See All) |
Mood: | raindarkness |
Locations: | swimming poolwaterhospitalchurchforestcarmotorcyclecemeterysmall townairplaneboatbathtubwoodsrural settingwheelchair β¦lakebaseballrussiacavejunglecampfiretexasstorm (See All) |
Characters: | girlboyfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipdoctorsingerteenage boyteachernursestudentdancerphotographerbaby β¦writerthiefwitchfrenchself discoverymermaidpregnant wifeu.s. soldierolder man younger man relationshipmother in law daughter in law relationship (See All) |
Period: | 1980s1970s1960s1940s2000s1950s1930s |
Story: | swimming underwaterreturnstorytellingkeyunderwater sceneslow motion scenevoice over narrationfemale nuditybased on novelnuditybloodflashbackdoggunkiss β¦female rear nuditydancingphotographtitle spoken by charactersingingpartychasepistolcryingbeatingdreamfistfightcomputercatbare buttsecretlettershootinglierifletearsanimal in titlebedpianoclassroomrevolverrivercriminalreporterswimmingbandbasketballarmyfootballhousesnakefishjokechildcoffinfishingjourneygraveyardpainflash forwardtreelegendkarateclownliaron the roadtentringpursuitchildbirthautomobiledeath of husbandloss of fatherbank robberyflowermagical realismclasspoettwinsacrificeheart attackcircuswerewolfpoemgoldwolfspiderbuttocksaccidental deatheccentricgiantmobstrangersheepparadecarnivalembarrassmentambitionpresumed deadbarefootgypsyshoesu.s. armyhungerco workerimmortalitymiami floridaoillostswampthunderstormfat manparachutecubashadowsalesmanwedding ringcaneeye patchgrowing uploss of husbandwedding receptioncrowpiano playernude swimmingstage performancemetaphortv commercialbeerear nudityyoung version of characterbank robberbeastsororitystrokemoroccounsubtitled foreign languagemarching bandbankruptcyhearsealabamaidentical twinsmarriage engagementromantic rivalrytelegramfather son estrangementestrangementfather son reunionsecret missionhouse firemob violenceold housebonenight vision gogglesfamily feudfamily historykorean warvulturespotlightchemotherapyrocking chairfather in law daughter in law relationshipleaving homecongofootball gamebanjobrief female nudityventriloquistbutt nakedstudio logo segues into filmarmy lifeone eyed mannaked buttwoman's bare buttstorytellerparatroopericebergleechlifting an adult into the airdictionaryquicksandpower plantsiamese twinsspider webtraveling salesmanglass eyecircus performerterminal cancermultiple narratorslycanthropymilitary draftkorean war veteranbare butt womanlifting a male into the airfly the insectfire eatermilkmantrailer housesideburnssorority housecatfishreference to bob hopeconjoined twinsscience fairfalling off a ladderrefusing to eattall taleanimate treewichita kansassearch for truthwoolly mammothunreliable flashbackringmasterroses are red poemunreliable narrationbuickforced perspectivecarnydaffodilamazing grace the hymnlandscaperparallel montagechicken poxgold ringmechanical handskywritingnewsweek magazinewhite picket fencecongenital heart defecthuman cannonballcar in a treecircus wagonpoet laureateshrinerwork in progress (See All) |
Apartment concierge Cesar (Luis Tosar) is a miserable person who believes he was born without the ability to be happy. As a result, he decides his mission is to make life hell for everyone around him. A majority of the tenants are easy to agitate, but Clara (Marta Etura) proves to be harder than the β¦ most. So Cesar goes to creepy extremes to make this young woman mentally break down. Things get even more complicated in this twisted relationship when her boyfriend, Marcos (Alberto San Juan), shows up. (Read More)
Themes: | murderpregnancyblackmailhome invasioncruelty |
Locations: | apartmentspain |
Characters: | little girlgirlboyfriend girlfriend relationshipbabyneighbor neighbor relationship |
Story: | apartment buildingpersonbuildingshowernudityblooddogtwo word titletitle spoken by charactercell phoneletterbathroomneighborwomanfired from the job β¦stalkingsleepingmaniacsyringehidingspanishinsectbrushing teethchloroformcockroachdeath of boyfriendhiding under a bedhitchcockiancaretakerbarcelona spaindisturbed individualevil childkeysconciergepeepholemurder disguised as suicidehiding in a bathroomintrusion (See All) |
Marnie Edgar is a habitual liar and a thief who gets jobs as a secretary and after a few months robs the firms in question, usually of several thousand dollars. When she gets a job at Rutland's, she also catches the eye of the handsome owner, Mark Rutland. He prevents her from stealing and running o β¦ff, as is her usual pattern, but also forces her to marry him. Their honeymoon is a disaster and she cannot stand to have a man touch her and on their return home, Mark has a private detective look into her past. When he has the details of what happened in her childhood to make her what she is, he arranges a confrontation with her mother realizing that reliving the terrible events that occurred in her childhood and bringing out those repressed memories is the only way to save her. (Read More)
Subgenre: | melodramapsycho thrillerpsychological thriller |
Themes: | deathmurdermarriagerapemoneymemoryrobberytheftdeath of fatherparanoiablackmailfashiontraumaamnesiachildhood trauma β¦murder of fathersecond marriagefear of sex (See All) |
Mood: | rainnightmare |
Locations: | trainboatshipstorm |
Characters: | husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipprostitutethiefsecretaryemployer employee relationshipbrother in law sister in law relationship |
Story: | return homedolly zoomreturnphiladelphia pennsylvaniahomepoolkeysexcharacter name in titlebased on novelone word titleflashbackbare chested malegunhorse β¦revolverdisguisewomansuicide attemptbrunetteconfessionbinocularswidowerliarcover uplightningdeath of husbandhorse ridinghandguntypewriterpsychologycamera shot of feetpillsthunderattempted suicidepastthunderstormsafeblood on shirtsailorfemale stockinged feetforename as titledirector cameorobberpublisherchild molestationhorse racingrepressionhoneymoonvirginiacleaning ladypsychoanalysisredhorse racenewlywedbaltimore marylandenigmaangstphobiaclerkrace trackpanic attackbrother in lawcustomreference to sigmund freudcoercionbad dreamhandicapped personlootsister in lawaliasinkfake idclose up of mouthocean linertoilet stallatlantic city new jerseyblonddriving in the raindeliberate crueltymarital rapekleptomaniacsecond wifecompulsionfrigiditykleptomaniakilling a horsehorse ranchcompulsive liardeaf womanthe color redpacking a suitcasedying hairshooting a horsetypistriding barebacklightning boltlightning stormforged documentfox huntladies roomthunderboltpill boxcompulsive behaviorhorse trailerpillboxdeviousnessmopping floorred jacketwant adschrysanthemumcolor redbetting on a horsehorse jumping a fenceocean cruiseoffice safe (See All) |
A couple lose their young son when he falls out of a window while they are having sex in another room. The mother's grief consigns her to hospital, but her therapist husband brings her home intent on treating her depression himself. To confront her fears they go to stay at their remote cabin in the β¦woods, "Eden", where something untold happened the previous summer. Told in four chapters with a prologue and epilogue, the film details acts of lustful cruelty as the man and woman unfold the darker side of nature outside and within. (Read More)
Subgenre: | cult filmexperimental film |
Themes: | mythologydeathmurderlovesurrealismfeartorturefuneralnaturebrutalityobsessiondepressionguiltinsanitygrief β¦mental illnessevilcrueltypanictraumawritingmadness (See All) |
Mood: | raingoreavant gardeambiguous ending |
Locations: | waterhospitaltrainforestsnowwoodssex outside |
Characters: | little boyhusband wife relationshipfather son relationshipmother son relationshipwriterlustself mutilationcrying babyself cannibalism |
Story: | grasshomeprologuebookslow motion sceneshowerviolencefemale nuditynuditybloodmale nudityone word titlefemale frontal nudityflashbackmasturbation β¦sex scenekissfightfemale full frontal nudityfingeringejaculationphotographknifeleg spreadingerectionpantiescryingwoman on topdreamunderwearpenetrationface slapbare buttpaintingtearsrunningbathroomhallucinationstrangulationvagina spreadingstabbingbridgeclitorisbirdcontroversypainstabbed in the backknocked outdeath of childfull frontal female nudityflowersdeath of sonsadnesscharacter says i love youcabinsleepingtherapytalking animalfaintinghappinesswitchcrafttherapistaccidental deathpart of trilogyteddy bearladders&mwindpillssufferingresearchbackpackloss of sonhit in the crotchironydark humorfalling to deathanxietyshoveldespairhypnosisscissorsmedicationsculpturereference to satanblack and white scenehit on the headautopsyatticdeersnowinglanternunsimulated sexdead woman with eyes openmisogynygendersymbolismcrowman cryingmotherhooddementiahysterianotebookminimal castcremationfoxwoman cryinghikingvery little dialoguepolaroiddiggingmasochismx rayspreadeaglecabin in the woodsnihilismloss of childepiloguehearsehit with a shovelbattle of the sexespsychotherapysorrowwashing machinechapter headingsdead birdfilm starts with sexstrangled to deathangstsex in natureclose up of eyetheologyantichristpsychosisextreme close upleg woundpanic attackstabbed with scissorsreference to sigmund freuduncircumcised peniswrenchgenital mutilationbitingfuneral processiongrievingblack and white segues into coloronanismbiblical referencewoman strangled to deathcaught in the rainfalling out a windowbad motherworshipfemale star appears nudethesiscuttingburned at the stakemedical examinerheavy breathingman carrying a womannameless characterpsycho sexualdeath by strangulationpiggy back ridestuffed animal toyanxiety attacktwo in a showertoilet bowlmad womanfemale genital mutilationfoot injuryhuman naturescissoringfalling treeskylightuxoricidechaptersgrieving motherisolated houseirrational behavioropera ariaambiguous titletoolboxinjured animaltarkovskyesqueacornantssymbol in titletwo handerinsane womanstatuettedragging someoneedenkilling a birdwanting to dieburning a dead bodyspilled drinkvoice over readingwomen's studiesgrieving fatherfuneral cortegerag dollfinal solutionman strangles womanoaksleeping on the groundfoot bridgepipe wrenchwater faucetdead treefawnabusive wifeexcisionwrapped in a blanketflushing drugs down a toilethand drillsex wearing a condomtremblingblack and white prologuefear of abandonmentgrieving parentcrawling on the groundsurviving griefbottomless womanclimbing up a hillthe color greencutting someonegrief therapygrindstoneburrowclitoridectomyfemale masturbation outdoorslaying on grassself genital mutilationsexual hysteriatalking fox (See All) |
A war has been raging between the Vampires and Lycan for centuries, Selene (Beckinsale) is a death dealer, assigned to hunt down and eradicate the last of the Lycan. When she comes across Michael Corvin (Speedman) who holds the key to end the war she must decide where her allegiances will lie.
Subgenre: | cult film |
Themes: | deathmurderlovekidnappingbetrayaldeceptionmemorysupernatural powerrivalryphotography |
Mood: | raingorenight |
Locations: | hospitaltrain |
Characters: | female protagonistvampirewarriortalking to oneself in a mirror |
Story: | apartment buildinghealingkeyunderwater sceneslow motion scenevoice over narrationbloodflashbackbare chested malecigarette smokingexplosionpartyknifesurprise endingpistol β¦corpseshot to deathblood splattermachine gunshot in the chestface slapshotgunpunched in the facecamerabattleswordfalling from heightrifleheld at gunpointcar crashshot in the backsubjective cameradecapitationfoot chaseambushmansionimpalementsubwayhit by a cartransformationshot in the foreheadbeaten to deathfirst of seriesevil manshot in the shoulderexploding bodyneck breakingcharacter says i love youfirst partshot in the armwhippingdismembermentstrong female characterwerewolftraitorundergroundsyringegrenadeburned alivehypodermic needlegothiclooking at oneself in a mirrorladderstrong female leadforbidden loveaction heroinebroken legslavefemale warriorfull moontarget practicewhipgash in the faceimmortalityfeudstabbed in the legjumping through a windowlatexbroken armmutationlaptop computertorso cut in halftombneedleshot in the necksubway stationstabbed in the armfemale vampirebitten in the neckman punching a womanmedical studentstabbed in the shoulderstar crossed loversopen endedbladein medias resshot through a doorfemale gunfighterkicking in a doorregenerationcamera focus on female buttvampire slayerfalling through the floorsubway trainwoman punching a manthrowing stararsenalbudapest hungarydark heroineshurikenlifted by the throatshot through a wallfangsawakeningdowntownhybridvampire bitecovenhead cut in halfchased by a doglycanthropymurder of a pregnant womanvampire human lovethrown through a wallsilver bulletclimbing over a fencebreaking through a wallcamera shot from inside human bodyultraviolet lightdeath of pregnant womaneyes different colorsexy female vampirelatex catsuiturban gothicskin torn offtrain depotwerewolf bitedeath of expectant mothermedical internnocturnalvampire versus werewolffather murders daughterhuman allyripped necksubway chaseancient vampirepass out from blood lossvampire driving car (See All) |
Hank, stranded on a deserted island and about to kill himself, notices a corpse washed up on the beach. He befriends it, naming it Manny, only to discover that his new friend can talk and has a myriad of supernatural abilities...which may help him get home.
Themes: | friendshipsurrealismjealousyfeardrunkennessmemorylonelinessfalling in lovefear of death |
Mood: | rain |
Locations: | beachforestbuswoodscavecampfiresinging on a bus |
Characters: | little girlhusband wife relationshipfather son relationshipmother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipsingerpolicemanreference to godcoronerconsidering suicide |
Story: | swimming underwaterhomeprologueunderwater scenebookslow motion sceneshowersexflashbackmasturbationfightphotographexplosionsinging β¦partychasethree word titleerectionfirecell phonesongcorpsefoodurinationface slapbare buttfalling from heightsunglassesbirthdaydead bodyhallucinationhandcuffsislandreference to jesus christf wordsurvivalambulancemontagebridgeeatingsuicide attemptfishapologyflash forwardmicrophonefantasy sequencemistaken identityskeletonhangingpursuitwigbearsleepingtrustkilling an animalfriendship between menlistening to musicscene during opening creditssurvivormagazineflatulencecrying manembarrassmentnicknamelostlaughterhomoeroticismmale male kissdead motherfast motion scenevodkatext messagingearphoneslevitationdefecationwebsitename callingtrashtv reporterpopcornfalling into waterbearded manhearing voicesnoosebody baggurneybelt11 year oldsleeplessnessman on firefade to blackraccoonleg woundstory tellingthirstman in dragjet skicowardicecrutchlooking in a windowhead bandagelullabyhumminggrappling hookgaggingtwo directorsbear attackcarrying a dead body40 year oldtalking about masturbationkilling a birdcall for helpshadow playbrought back to lifereference to the internettv cameramanberriespunched in the mouthbotched suicidereference to halloweendeserted islandcorkdead body on beachdecompositionreference to netflixtalking to a dead bodyflashback montagecrawling on the groundcrawling on hands and kneesreference to vaginatalking corpse (See All) |