Please wait - finding best movies...
Every camper’s worst nightmare came true at Lake Bodom in 1960 when four teenagers were stabbed to death while sleeping in their tent. As the years passed and the case grew cold, the unsolved mystery turned into an urban legend, a creepy campfire story passed from generation to generation. Now, a …group of teenagers arrives at the same campsite, hoping to solve the murder by reconstructing it minute by minute. As night falls, it turns out that not all of them are there to play. Tonight… it’s girls against boys. Let the killing games begin. (Read More)
Themes: | campingwritingfearjealousydrugsrevengemurderdeath |
Mood: | slashernightnightmarehigh schoolgore |
Locations: | school studentcampfirelakeforest |
Characters: | serial killerkillertough guyteenager |
Story: | body counturban legendstabbed with a knifegeneration nowsleeping bagcampfire storylake bodom murdersstabbed to deathdrop of bloodhorror filmunsolved mysteryunderwater sequencetrue lifein productionminute …group of teenagersproduction designunsolved crimecampsitescream queencaseurbanteenage angststabbednumbercountvolvocreepyinspired by true eventscampergenerationcoldbodylyingplaymass murdergroup of friendskillingsleepinghigh school studenttentlegendswimmingbased on true storyknifeviolenceblood (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
Themes: | fearrevengedeathmurderfriendshipsurrealismkidnappingescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic …self sacrificenear death experience (See All) |
Mood: | slasherhigh schoolsatirespoofparodyambiguous ending |
Locations: | foresthospitalwoodssinging in a car |
Characters: | serial killerkillerteenagerhomosexualmother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlnursehostagemotherex boyfriend ex girlfriend relationship …parent child relationshipslasher killerself referentialparty girl (See All) |
Period: | 1980syear 1986year 1987 |
Story: | body counturban legendstabbed to deathhorror filmscream queencountbodyhigh school studentknifeviolenceflashbacktwo word titlebare chested malecigarette smokingdancing …explosionchasethree word titlesurprise endingpantiesfirecell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurf worddecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditssummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetavolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wrongmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | drugsmurderdeathrapetortureincestpsychopathbrutalityinsanityevilexploitationmurder of family |
Mood: | slashergore |
Locations: | chicago illinois |
Characters: | serial killerkillerbrother sister relationshipprostitutevillainterrorslasher killermysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | body countstabbed to deathkillingbloodviolencefemale nuditycharacter name in titlenuditybare breastsgunsurprise endingshot to deathblood splattershot in the chest …low budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro …fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)
Subgenre: | slasher flickteen movieteen horror |
Themes: | deathmurderrevengepsychopath |
Mood: | slashergoreraincar chase |
Locations: | swimming poolgas stationsinging in a car |
Characters: | serial killerkillerteenagerfriendfemale protagonistsecurity guardprofessormysterious killer |
Story: | urban legendurbanlegendbloodviolenceflashbackgunsex scenesingingpartychasesurprise endingpistolcorpseblood splatter …computerfalling from heightvomitingcollegetelephonedecapitationjournalistbound and gaggedcandlestrangulationaxedeath of friendbridgeimpalementradioroommateproduct placementlightninghangingsuspicionfirst partgothicheavy rainlifting someone into the airtied to a bedstabbed in the stomachvillainessjournalismparking garagefemale killerjanitorrear entry sexthunderstormrainstormaxe murdercharacters killed one by onecar troublescene before opening creditsfemale psychopathradio stationspreadeaglefraternitybody in a trunkscalpelcampusdisc jockeycollege campusorchestral music scoregoth girloff screen murdervillain not really dead clichered herringmicrowave ovenpoodledorm roomfall to deathfemale serial killermicrowavepepsitalk radiodead teenagerradio hosthanged boyconvicted felondark and stormy nightchat roomsource musicyelling for helproommate issueslifting a male into the airdead body in a car trunkradio talk showshot with a guncollege roommatecry for helpcall for helploss of best friendcrying for helpbody in a car trunksinging along with radiostuck during sexwest highland white terrierkilled in a carradio call in showfalse scareradio callerthrown through windshieldannoying roommate (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
Themes: | murderdeathprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
Mood: | slashergorecar chasedarknessbreaking the fourth wall |
Locations: | lakeforestcemeterysmall townboatwoodsamerica |
Characters: | serial killerkillerteenagerpolicezombievillainsheriffterrorslasher killerserial murderer |
Period: | 1980s |
Story: | body countstabbed to deathmass murderkillingviolencesexcharacter name in titlenumber in titlesequelflashbacksurprise endingblood splattermasknumbered sequeldemon …decapitationflashlightmassacreambulancestabbingsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentundeadblood spattersplattermaniacgothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is …the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
Subgenre: | psycho thrillerslasher flickaustralian horrorteen horror |
Themes: | campingmurderdeathtorturefuneralbrutalityyouthabuseghost town |
Mood: | slashernightgorehorror movie remake |
Locations: | campfireforestchurchsmall townroad trip |
Characters: | serial killertough guyboyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshippriestinterracial relationshipvillainsheriffslasher killer |
Story: | body countstabbed to deathgroup of friendstentknifeviolencebloodmale nuditymale rear nuditybare chested malefighttitle spoken by characterchasethree word titlesurprise ending …pantiesfirecryingcell phonecorpseshot in the chesturinationface slapshot in the headshotgunundressingbare buttvomitinglingeriedecapitationgood versus evilbravideo cameradeath of friendimpalementstabbed in the chestchild abusesevered headscantily clad femalebeaten to deathstripteaseperson on firekicked in the facebaseball batinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowlifting someone into the airloss of friendamerican footballhidingfloridarednecksevered fingercrossbowgash in the facestabbed in the necktitle appears in writingscissorsstabbed in the legred pantiescharacters killed one by onetank topcar troublegroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingsdeformitywrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
Subgenre: | independent filmcult filmsuspenseslasher flickaustralian horrorsadistic horror |
Themes: | feardeathmurderkidnappingrapedrinkingtorturedrunkennessescapepsychopathbrutalityinsanitysadismevilabduction …exploitationcruelty (See All) |
Mood: | slashernightnightmaregorecar chasedarknessblood and gore |
Locations: | campfirebarbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationroad movie …australian outbackcar on fireshed (See All) |
Characters: | serial killerkillerhusband wife relationshipdoctorsingerhostagevillainaustralianterrorself mutilationslasher killermysterious villainserial murderermysterious killer |
Period: | year 1999 |
Story: | body countcampfire storystabbed to deathcamperkillingtentswimmingbased on true storyknifeviolenceblooddogtwo word titlegunkiss …cigarette smokingphotographtitle spoken by characterexplosionsingingpartychasesongcorpseshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordgay slurflashlightbound and gaggedmassacrevideo camerastabbingimpalementfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufogaragemaniacpickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womanrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
Subgenre: | cult filmsuspenseb horrorpsycho thrilleramerican horrorindependent horror |
Themes: | feardeathmurderpsychopathbrutalityinsanityevilexploitation |
Mood: | slashergoredarkness |
Locations: | campfirelakewoodswheelchairpolice carbackwoodsrunning through the woodschase in the woods |
Characters: | serial killerkillerteenagerboyfriend girlfriend relationshipvillainterrorslasher killermysterious villainserial murderermysterious killer |
Period: | 1980ssummeryear 1984 |
Story: | body countcampfire storymass murderkillingswimmingviolencebloodsexfemale nuditynumber in titlesequelfemale frontal nudityflashbackkiss …fightnipplessurprise endingpantiestelephone callcorpsedigit in titleblood splatterblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelsubjective cameradecapitationbrastrangulationmassacrethroat slittingimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotevil manopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexsplatterchessmaniacchainsawfireplacespearnipples visible through clothinggothicmachetelifting someone into the airragemutilationvillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorlens flarecharacters killed one by onekilling spreepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killerbad guycar troublemadmanmysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violencehomicidal maniacslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickgruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen movieteen horroramerican horrorholiday horror |
Themes: | feardeathmurdercorruptionpsychopathparanoiaevilmurder of family |
Mood: | slashernighthigh school |
Locations: | carsmall towncar theftkitchen knife |
Characters: | serial killerkillerteenagerhusband wife relationshipboyteenage girlteenage boyfemale protagonistgirllittle girllittle boyvillainpsychiatristterrordoctor patient relationship …slasher killerserial murderer (See All) |
Period: | 1970s1960syear 1963year 1978 |
Story: | body countstabbed to deathstabbedcreepykillingknifeviolencefemale nuditynudityone word titledogguncigarette smokingtitle spoken by charactersurprise ending …shot to deathblood splattershot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonesubjective cameragood versus evilhalloweenstrangulationstabbingthroat slittingchildgunshotattempted murderprologuesuburbfirst of seriespay phonecharacter's point of view camera shotevil manhalloween costumelong takestalkingmurdererfirst parthandgunmaniacpot smokingteen angstbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbusterpsychogrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the enddead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerpsycho killerdead doggothserial murderpsychopathic killerbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefencehomicidal maniac17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknife murderknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessmurder spreevillain not really dead clichegrindhouse filmescaped mental patientno endingpayphonelight bulbpsycho terrormidwestghost costumeweirdowoman smoking cigarettesmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
Subgenre: | black comedysupernaturalpsycho thrilleramerican horror |
Themes: | deathpsychopathsupernatural powerevil |
Mood: | slashergoreraincar chase |
Locations: | chicago illinoisschool buswater gun |
Characters: | serial killerkillerhusband wife relationshippoliceboyteachervillainterrorslasher killerserial murderernew student |
Period: | 1990s |
Story: | body countstabbed to deathcountbodyplaybloodsequelcigarette smokingsingingpunctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from height …held at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancethroat slittingstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandbasementneck breakingmurdererthreatened with a knifeobscene finger gesturemaniacfalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedpsychosevered handblack humorbutchershovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderpsycho killerpsychopathic killersuffocationbad guymadmanhiding in a closetevil spirithomicidal maniacclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clichebutcheryliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homepsycho terrormidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof |
Themes: | fearmurderdeathrevengelovebetrayaldrunkennessescapeinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism …theatremurder of a police officernear death experience (See All) |
Mood: | slashergoresatire |
Locations: | hospitalbicyclepolice stationpolice carfire truck |
Characters: | serial killerkillerteenagerpoliceboyfriend girlfriend relationshipfemale protagonistpolice officerdetectivehostagepolice detectiveex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | body countstabbed to deathcountbodyplaygroup of friendskillingknifebloodviolencef ratednumber in titlesequelinterviewbare chested male …kisscigarette smokingsingingpartychasesurprise endingpistolcell phonebeatingcorpsedigit in titleshot to deathblood splattercar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegehallucinationvoyeurtelevisiontelephonef wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo cameraambulancestabbingdeath of friendthroat slittingimpalementstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reportercharacters killed one by oneethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
Nursery teacher Jenny and her boyfriend Steve, escape for a romantic weekend away. Steve, planning to propose, has found an idyllic setting: a remote lake enclosed by woodlands and seemingly deserted. The couple's peace is shattered when a gang of obnoxious kids encircles their campsite. Reveling in … provoking the adults, the gang steals the couple's belongings and vandalizes their car leaving them completely stranded. When Steve confronts them, tempers flare and he suffers a shocking and violent attack. Fleeing for help, Jenny is subject to a brutal and relentless game of cat-and-mouse as she desperately tries to evade her young pursuers and find her way out of the woods. (Read More)
Subgenre: | british horrorsadistic horror |
Themes: | campingfeardeathmurderrevengemarriagetorturepsychopathguiltinsanitysadismbullyingvengeancecamping in the wilderness |
Mood: | gore |
Locations: | lakeforestbarbeachbicyclesex in a bathroomschool teacher |
Characters: | teenagerhusband wife relationshipboyfriend girlfriend relationshipbrother brother relationshipbullywriter director |
Story: | stabbed to deathcampsitetentswimmingknifebloodviolencemale nuditydogtwo word titlebare chested maletitle spoken by characterpartychasecell phone …face slapbikinivomitingsunglassescar crashsex standing upbathroomsubjective camerasurvivalstabbingimpalementstabbed in the chesthit by a carbeaten to deathperson on firecover upknocked outkicked in the faceringtragic eventthreatened with a knifeburned alivekilling an animalelectronic music scorejeepinjuryloss of loved onehidingrampagestealing a carunderage drinkingstabbed in the necktitle appears in writingstabbed in the legdeath of protagonistdead childmurder of a childgasolineburned to deathsunbathingflat tireengagement ringdead dogbarbed wireremorseclimbing through a windowgang violencenihilismglassscuba divingbleeding to deathkiller childfilmed killingmatchcamera phonecocaine snortingjuvenile delinquencyviolent deathstupid victimtrespassingstraight razorbloody body of a childwoman in bikiniblond boyfoot pursuitgpsstabbed in the mouthcut armcamping tripdelinquentrottweilerdeath of a childchild murders a childloud musicspikefirst aidmatcheslost in woodsbox cutterwoman murders a manstabbed with glassdirt roadnihilistsnorkelteenage killerchanging a tireringleaderfoot woundchild burningdriving off roadkiller instinctthroat woundchild as villainpeek a boo (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j …ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | independent filmcult filmslasher flicksurvival horrorsadistic horror |
Themes: | murderkidnappingmarriageinfidelitytortureescapeextramarital affairpsychopathcancerinsanityhome invasionclaustrophobiaself harm |
Mood: | slashergorecar chase |
Locations: | hospitalhotelurban setting |
Characters: | serial killerkillerhusband wife relationshippolicefather daughter relationshipdoctordetectivephotographerhostagepolice detectiveself mutilation |
Story: | body countstabbed to deathbodyviolenceone word titleflashbackgunsurprise endingpistolcorpseshotguncamerasecretbathroomrevolver …bound and gaggedthroat slittingtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | feardeathmurderfriendshipsurrealismkidnappingrapetorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | slashernightnightmaregorecar chasedarknessblood and gore |
Locations: | foresthospitalbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | serial killerkillerfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagoniststudent …best friendvillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | body countmass murderkillingsleepingknifeviolencebloodfemale nudityf ratedbare breastsfemale frontal nudityflashbackmasturbation …dogguncigarette smokingphotographlesbian kisschasesurprise endingshowertelephone calldreamcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderereuropeblood spattersplatterchild murdermaniacchainsawfireplacekilling an animallistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
Subgenre: | cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | fearrevengemurderdeathfriendshipsurrealismkidnappingghostescapemonstervoyeurismpsychopathbrutalitysupernatural powerparanoia …sadismevilpanicmysterious deathshower murder (See All) |
Mood: | slashernightmarehigh schoolgoreraindarknesspoetic justice |
Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | serial killerkillerteenagerfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girl …teenage boyteachergirlstudentpolicemanlittle girlvillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | body counturban legendstabbed to deathmass murderhigh school studentlegendknifebloodviolencecharacter name in titlenuditynumber in titlemale nuditysequelmale rear nudity …bondagedogbare chested malefightcigarette smokingpartychasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditystabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror |
Themes: | fearmurderdeathrevengevoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
Mood: | slashernightgoredarknessblood and gore |
Locations: | lakecarmotorcycleboatwaterwoodsrural settingpolice cartruck |
Characters: | serial killerkillerteenagerpolicefriendteenage boypolice officerpolicemanartistmothervillainsheriffterrortruck driverslasher killer …mysterious villainserial murderer (See All) |
Period: | 1970s1950ssummer |
Story: | body countcampfire storystabbed to deathkillingviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditybare chested malekissfemale rear nuditynipples …three word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manaxemassacrestabbingwomanthroat slittingdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorgruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | murderdeathghostfuneralmonsterpsychopathsupernatural powerinsanitysadismevil |
Mood: | slashernightmaregore |
Locations: | barchurchcemeteryschool boy |
Characters: | serial killerkillertough guyteenagerfather daughter relationshipmother daughter relationshipdoctornurselittle girlsingle mothervillainterrorself mutilationslasher killeralcoholic father …serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | body countstabbed to deathgroup of teenagerscasecreepykillingviolencefemale nuditynumber in titlesequelbondagebare chested malecigarette smokingsurprise ending …firedreamcorpsedigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyecharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropehospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
Themes: | deathmurdertorturepsychopathbrutalitysupernatural powerinsanitysadismevil |
Mood: | slashergorebreaking the fourth wallblood and gore |
Locations: | hospitalsex in showersex in a bathroom |
Characters: | serial killerkillerbrother sister relationshipteenage girlteenage boyvillainterrorslasher killermysterious villainserial murderermysterious killer |
Period: | 1980s |
Story: | body countstabbed to deathstabbedkillingviolencebloodsexfemale nuditynumber in titlemale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudity …female rear nuditysurprise endingpantiescorpseunderwearblood splattermasklow budget filmsubjective cameradecapitationstrangulationimpalementsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturemaniacsexual attractionlifting someone into the airragemutilationmorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carcharacters killed one by onekilling spreemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
Themes: | fearrevengemurderdeathsuicidekidnappingghosttorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of motherinsanity …evilabductiontraumafear of water (See All) |
Mood: | slashernightmarehigh schoolgorerainbreaking the fourth wallblood and gore |
Locations: | lakeforestcemeterysmall townpolice stationschool nurse |
Characters: | serial killerkillerfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombielittle girlvillainsheriffterrorslasher killermysterious villain …serial murderer (See All) |
Period: | 2000s |
Story: | body countmass murderkillinghigh school studentviolencebloodcharacter name in titlesequelflashbackphotographexplosionpartysurprise endingpistolshower …firevoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskcar crashdemondecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentundeadsplatterchild murdermaniacburned aliveheroinemachetelifting someone into the aircomaragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
Themes: | fearrevengedeathmurderdeceptionpsychopathsurveillanceevilmurder of a police officer |
Mood: | slashergoresatire |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | serial killerkillerteenage girlteenage boynursesecurity guardvillainpsychiatristslasher killercoroner |
Period: | 2000s |
Story: | body countstabbed to deathkillingknifebloodviolencefemale nuditysequelflashbacktwo word titlefightchasesurprise endingfire …cell phonecorpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturemaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Death stalks the dreams of several young adults to claim its revenge on the killing of Freddy Kruger. Chased and chastised by this finger-bladed demon, it is the awakening of old memories and the denials of a past of retribution that spurns this hellish vision of a dreamlike state and turns death in …to a nightmare reality. (Read More)
Subgenre: | slasher flick |
Themes: | deathrevengemurdersurrealismrapetorturefuneralparanoia |
Mood: | nightmarehigh schoolgorehorror movie remake |
Locations: | hospitalswimming poolsnowcemeterybathtub |
Characters: | killerteenagerfather son relationshipmother daughter relationshipboyfriend girlfriend relationshipwaitressterrorself mutilationyounger version of character |
Story: | stabbed to deathkillinghigh school studentswimmingbloodflashbackdogbare chested malephotographsurprise endingcell phonedreamcorpseblood splattercar accident …remakeslow motion scenearrestsecretplace name in titlecar crashjailhallucinationambulancedeath of friendthroat slittingimpalementdinerstabbed in the chestdrawingbathnecklacestabbed in the backperson on firecover upevil manattempted rapesyringeburned alivekilling an animallooking at oneself in a mirrorlifting someone into the airsecurity camerasevered handcovered in bloodrapistjanitorstabbed in the throatstabbed in the headstabbed in the legpedophilebookstoreblood on shirtperversioneye gougingdisfigurementstabbed in the eyedark pastsexual assaultcharacters killed one by oneteleportationphoto albumpervertvillain played by lead actormolotov cocktailhiding in a closetpedophiliaohiovigilantismhuman monsterchild molestationclimbing through a windowhanging upside downvideo blogburnt facebody bagdeath of boyfriendburnt bodyopen endedclawchild molesterswimmerpool of bloodwrongful imprisonmentmolestationchild rapecut handvillain not really dead clicheplant in titledepravitystabbed with scissorsbloody body of a childfalling through the floorserial rapistsexual predatorbad dreamcut armhand cut offfalling asleeprepressed memorygrave side ceremonyhigh school principalhand through chestsex offendersickstreet in titleboiler roomboogeymanpre schooldream worldfictional townlucid dreamadrenalinesickosleep deprivationindoor swimming poolprescription drugswoman in bathburn scarshared dreamfreddy kruegernightmare becomes realitystabbed with glassreboot of serieshand through headchild sexual abuseremake of cult favoritealarm systemswimming coachdream sequence within a dream sequenceclass photographelm streetgardnerspringwood ohiosexual child abusecar cigarette lighterstabbed with a needlefalling asleep in classpaper cutterswimming teamdream imagerykilling of child molestertrying to stay awakeawakened by a phone (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
Subgenre: | psycho thrillerslasher flick |
Themes: | revengemurderdeathtorturedrunkennesspsychopathbrutalitydeath of motherevilmurder of a police officer |
Mood: | slashergoredarknesshorror movie remake |
Locations: | campfirelakeforestmotorcycleboatbathtubbicyclewaterwoodspolice cartunnelschool busbackwoodssex in a tent |
Characters: | killerafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
Period: | 1980s |
Story: | body countsleeping bagcampfire storystabbed to deathtentlegendswimmingbloodviolencefemale nuditynuditynumber in titlebare breastsfemale frontal nuditymasturbation …dogbare chested malesex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topcorpsedigit in titleblood splatterurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholdecapitationflashlightbracandlestrangulationtoplessaxemassacrevideo camerastabbingdeath of friendthroat slittingimpalementstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningmissing personevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscamppsychocovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyeaxe murdersevered legcharacters killed one by onearrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisesmissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | fearmurderrevengedeathpsychopathbrutalityinsanitysadismevilexploitationpolice investigation |
Mood: | slashernightnightmaregoreraindarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | serial killerkillerteenagerpolicemother son relationshipbrother brother relationshipvillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | body countkillingbloodviolencesexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingchasesurprise endingpanties …digit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyeaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Subgenre: | tragedypsycho thrillerslasher flickamerican horror |
Themes: | murderdeathsuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismevilhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
Mood: | slashernightgoredarknessblood and gore |
Locations: | small townstrip club |
Characters: | serial killerkillerteenagerafrican americanboyfriend girlfriend relationshipboyhostagevillainpsychiatristsheriffterrorslasher killerserial murderer |
Period: | 1970s |
Story: | body countstabbed to deathcreepymass murderkillingknifebloodviolencesexfemale nuditymale nudityfemale frontal nudityfemale rear nudityfemale full frontal nudityphotograph …title spoken by characterchasepistolwoman on topbeatingcorpseblood splatterremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanityteenage sexblood spattersplattermaniackilling an animalelectronic music scorelifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdomichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | black comedysuspensesuperherotragedypsycho thrillersurvival horrorteen horrorpsychological thrilleramerican horror |
Themes: | campingfearmurderdeathfriendshipsurrealismkidnappingrapebetrayalescapefuneralmonsterdeceptionvoyeurismpsychopath …death of fatherbrutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | slashergoreneo noir |
Locations: | foresttraintaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | serial killerkillerteenagerfather daughter relationshipafrican americandoctorteenage girlpolice officerhostagesecurity guardvillainpsychiatristterroruncle niece relationshipslasher killer …serial murdererpolice dog (See All) |
Period: | 2010s |
Story: | body countkillinghigh school studenttentknifebloodviolenceone word titlesequelflashbackdogbare chested maledancingtitle spoken by characterparty …chasesurprise endingpantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing personevil manknocked outbaseball batflowersscarinjectiontragic eventstalkingbasementlaptoploss of fathersuspicionmurderermaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | independent filmcult filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
Themes: | drugsdeathmurdersurrealismghosttorturepsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia |
Mood: | slashernightmarehigh schoolgoreraindarkness |
Locations: | small townairplaneroad trip |
Characters: | serial killerkillerteenagerfamily relationshipsfather son relationshipfather daughter relationshipteachervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american …evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | body countcreepykillingknifeviolencebloodf ratedcharacter name in titlesequelflashbackbare chested maletitle spoken by characterfirepunctuation in titletitle directed by female …dreamblood splatterrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | cult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof |
Themes: | fearrevengemurderdeathfriendshipinfidelitybetrayaldrunkennessescapeinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother …paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | slasherhigh schoolgoresatiredarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | serial killerkillerteenagerfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyfemale protagonistvillain …sheriffsingle fatherslasher killerself referential (See All) |
Period: | 1990s |
Story: | stabbed to deathgroup of friendshigh school studentknifebloodviolencef ratedone word titlebare chested malecigarette smokingtitle spoken by characterpartychasesurprise endingpistol …firecell phonecorpseshot to deathblood splattercar accidentshot in the chestblondeface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chaseflashlightbound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flagstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airkicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
Subgenre: | independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie |
Themes: | fearrevengedeathmurderkidnappingrapetorturevoyeurismseductionangerpsychopathbrutalityhumiliationsadismevil …exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
Mood: | slashergore |
Locations: | lakeforestnew york citychurchcarsmall townbathtubbicyclewatergas stationcountry |
Characters: | serial killerkillerfemale protagonistgirlwriterlustvillainserial murdererself justicesex with a stranger |
Period: | 1970s |
Story: | body countnumbercreepykillingknifebloodviolencefemale nuditymale nuditybare breastsfemale frontal nuditymale frontal nuditybare chested malegun …female rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmvoyeurmale pubic hairriveralcoholtelephonecleavagenewspapergangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurderercabinhandgunvigilanterecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragemutilationdesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationaxe murderbruisecharacters killed one by onekilling spreemisogynypsycho killerwoman in bathtubpervertserial murderpsychopathic killerkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismsexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was … gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)
Subgenre: | coming of agesuspenseslasher flickteen movieteen horror |
Themes: | murderdeathfriendshipdrunkennessdancepsychopathobsessionrivalryhome invasionmurder of a police officermurder of family |
Mood: | slashernightnightmarehigh schoolhorror movie remake |
Locations: | hotelelevatorpolice stationfire truck |
Characters: | killerteenagerhusband wife relationshippolicefriendboyfriend girlfriend relationshipteenage girlteacherdetectivepolice detectiveuncle niece relationshipaunt niece relationshipdeath of girlfriend |
Story: | stabbed to deathhigh school studentknifebloodviolencemale nudityflashbackmasturbationdancingtitle spoken by characterpartychasepistolshowercell phone …corpseshot to deathblood splattermirrorshot in the chestremakeslow motion scenehallucinationsurvivalorphanstrangulationaxedisguiseambulancedeath of friendthroat slittingbridgestabbed in the chestjokedream sequencepolice officer killednews reportlimousinestalkervirginclownrace against timekicked in the facedeath of childstalkingthreatened with a knifeloss of loved oneswat teampsychologistrapistbarefootcrime scenehaunted by the pastfloodunderage drinkingevacuationpedophileblood on shirtmurder of a childone daycharacters killed one by oneuncleengagement ringparentsdjpervertauntgraduationfire extinguisherhiding in a closethigh school teacherpedophiliacomic relieftrashflaskescaped convictbody in a trunkmtvpromdeath of boyfriendgarbagemugshothiding under a beddeath of familychild molesterstupid victimbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderclicheflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
Subgenre: | independent filmcult filmdark comedyslasher flickcreature featuresadistic horror |
Themes: | fearjealousymurderdeathsurrealismkidnappingrapetorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness …sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | slashernightmaregorerain |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | serial killerfamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | urban legendstabbed to deathmass murderlegendknifeviolencebloodnumber in titleflashbackbare chested maledancingphotographchasesurprise endingpistol …firebeatingdreamcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesmissing personevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundtape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark househuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
Themes: | revengemurderdeathmonsterpsychopathsupernatural powerevildrug addictionmurder of a police officer |
Mood: | slasherhigh schoolgorerain |
Locations: | new york cityboatwoodsseacityamericasewer |
Characters: | serial killerkillerteenage girlteenage boyzombiepolice officervillainteacher student relationshipterrorslasher killermysterious villainserial murderer |
Period: | 1980s |
Story: | body countstabbed to deathbloodviolencefemale nuditycharacter name in titlenumber in titlesequelbare chested maleexplosionpantiesblood splattermirrornumbered sequeldemon …hallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationaxevideo camerastabbingthroat slittingimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | writingfearmurderdeathkidnappingrapetorturetheftpsychopathinsanitysadismevilphotographymurder of a police officerrape and murder |
Mood: | slashergoreneo noir |
Locations: | barhelicopterdesertroad tripmotelgas stationtexasroad moviesex in a car |
Characters: | killerpoliceboyfriend girlfriend relationshipwriterhostagewaitressvillainterrorslasher killerchinese foodserial murderershooting a police officer |
Story: | body countstabbed to deathkillingviolencebloodsexfemale nuditynuditymale nudityone word titlemale rear nuditybare chested malegunfightcigarette smoking …photographtitle spoken by characterpistolshot to deathblood splattercar accidentshot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upgay slurjournalistcalifornianarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilemurdererarsonmaniactape recorderragemutilationstabbed in the stomachpsychovictimrape victimrapistmale underwearrampagerednecktensionstabbed in the throatgash in the facedark humorbutcherblack brabilliardsperversionrainstormsexual assaultkilling spreepsychoticblack bra and pantiesphysical abusepervertserial murderpsychopathic killerbad guymadmankillpistol whiphuman monsterpolice officer shot in the chestsexual violencehomicidal maniacknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countrybloody violenceabusive boyfriendlunaticsadistic psychopathmass murdererbreaking a bottle over someone's headbutcherycrime spreepittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistpsycho terrorexposed breastdisturbingparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanpsycho filmheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the …y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)
Subgenre: | independent filmcult filmparanormalcreature featureamerican horror |
Themes: | fearrevengedeathmurderghostescapemonstersupernatural powerevil |
Mood: | darkness |
Locations: | campfirebarbeachchurchsmall townwaterrural settingseashipfishing boatghost ship |
Characters: | mother son relationshipchildrenboyzombiepriestsingle motherlittle boyvillainsheriffterroremployer employee relationshipcatholic priestmysterious villain |
Period: | 1980s1970syear 1979 |
Story: | campfire storystabbed to deathcreepymass murderkillingknifebloodviolencetwo word titlechasesurprise endingcorpsesworddead bodydemon …decapitationcaliforniastabbingwomanimpalementchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorundeadrecord playerpirategoldelectronic music scoregothictape recorderlifting someone into the airmutilationstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagebutcherpsychotronicautopsyfogeye gougingslaughterpierdark pastkilling spreelighthousedjbad guymysterious manliving deadspiral staircasejournalevil spiritblackoutslashingradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulbutcherygrindhouse filmhookradio broadcasttragic villainmistphonograph recorddocksdisturbingmusic score composed by directorstained glass windowdemonicremadedrive in classicbayhorror movie remadefemale hitchhikerhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All) |
After an accident on a winding road, four teens make the fatal mistake of dumping their victim's body into the sea. But exactly one year later, the dead man returns from his watery grave and he's looking for more than an apology.
Subgenre: | cult filmslasher flickteen movieteen horror |
Themes: | revengemurderdrunkennesspsychopathblackmailguilt |
Mood: | slasherhigh school |
Locations: | hospitalbeachboat |
Characters: | serial killerteenagermother daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boysister sister relationshipfishermanslasher killer |
Period: | 1990s |
Story: | urban legendstabbed to deathbodybloodbased on novelbare chested malephotographtitle spoken by characterchasesurprise endingcorpseblondepunched in the facebikinisecret …falling from heightlettercollegecleavagedeath of friendstabbed in the chestscantily clad femalehit by a carunderwater scenepolice officer killedcharacter repeating someone else's dialoguelocker roomfirst of seriescharacter's point of view camera shotstorytellingcover updeath of brotherreunionsuspicioncharacter says i love youfirst partclaim in titleoverallsblockbustersevered handparadefestivalhaircutunderage drinkingtitle appears in writingdeath of sistercharacters killed one by onefemale in showerreckless drivingmale in showerstorehiding in a closetdisposing of a dead bodybeauty pageantwhodunitbody in a trunknorth carolinacrabfourth of julyseason in titlestupid victimbreaking a mirrorhookmanslaughterman wearing towelno endingbeauty contestaliasdead teenagertiarareference to mother teresastabbed through the chinwriting on mirror (See All) |
Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own …life. (Read More)
Subgenre: | paranormal phenomenasupernatural horror |
Themes: | fearrevengemurderdeathsurrealismsuicideghostfuneralinvestigationvoyeurismsupernatural powerphotographyadoptiondyingmysterious death |
Mood: | nightmarerainhorror movie remake |
Locations: | bathtubwaterelevatorwheelchaircity |
Characters: | serial killerfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlstudent …writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All) |
Story: | urban legendurbanlegendbloodf ratedbased on novelflashbackcigarette smokingphotographtitle spoken by charactersurprise endingpantiesshowertelephone callcell phone …dreamhorsemirrorblondeface slapremakewatching tvcomputercamerafalling from heighthallucinationvoyeurislandclassroomtelephonereportergood versus evilcleavagenewspaperjournalistaxewomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationunderwater scenetreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secretwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All) |
Subgenre: | independent filmcult filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | feardeathmurderrevengefriendshipkidnappingtortureescapepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism …couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | slashergore |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | body countstabbed to deathgroup of friendsknifebloodviolencesexcigarette smokingexplosionchasesurprise endingpistolfire …cryingcell phonebeatingcorpseshot to deathblood splattercar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightbound and gaggedambushaxemountaindeath of friendtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutanttied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolineaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
In 1986, in the province of Gyunggi, in South Korea, a second young and beautiful woman is found dead, raped and tied and gagged with her underwear. Detective Park Doo-Man and Detective Cho Yong-koo, two brutal and stupid local detectives without any technique, investigate the murder using brutality … and torturing the suspects, without any practical result. The Detective Seo Tae-Yoon from Seoul comes to the country to help the investigations and is convinced that a serial-killer is killing the women. When a third woman is found dead in the same "modus-operandi", the detectives find leads of the assassin. (Read More)
Subgenre: | black comedydark comedypolice procedural |
Themes: | feardeathmurderrapetortureinvestigationcorruptionbrutalitysurveillancemurder investigationpolice investigationmysterious death |
Mood: | rainneo noir |
Locations: | tunneltrain tunnel |
Characters: | serial killerkillerpolicedetectivepolicemanpolice detectiveserial murdererpolice violencemysterious killerpolice surveillance |
Period: | 1980syear 1986 |
Story: | unsolved crimekillingbased on true storyviolencefightchasebased on playsongshootingvomitingrevolvercriminalassassinfalse accusationanti hero …radioparkproduct placementdarkmurderercorrupt copred dressdemonstrationvictimfemale tied upblack humorthugseriesdark humorsuspectbarefoot femalehogtiedserial murderset uptrue crimepolice chiefmental retardationrumoryoung womansouth koreamurder suspectrainingcluefemale police officertied up while barefootfemale victimcriminal investigationwrongful arrestcountry lifefootprinthit by a trainnight clubrainy nightpolitical scandalforensic evidencehands tied behind backfemale bare footreference to pubic hairfalse evidenceforced confessiontask forcedna testkilled by a trainmultiple suspectsserial rapefaked evidencewebbed fingerskorean historycountry vs city cultures (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
Subgenre: | independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror |
Themes: | revengemurdersurrealismfuneralpsychopathsupernatural powerevil |
Mood: | slashernightmarehigh schoolgoreavant garde |
Locations: | cemeterybathtubpolice station |
Characters: | serial killerkillerhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlalcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain …serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | body countviolencebloodbare chested malecigarette smokingsurprise endingdreamcorpseblood splattermirrorface slapslow motion scenearrestfalling from heightbed …demonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on firefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
In a red light district, newswoman Karen White is bugged by the police, investigating serial killer Eddie Quist, who has been molesting her through phone calls. After police officers find them in a peep-show cabin and shoot Eddie, Karen becomes emotionally disturbed and loses her memory. Hoping to c …onquer her inner demons, she heads for the Colony, a secluded retreat where the creepy residents are rather too eager to make her feel at home. There also seems to be a bizarre connection between Eddie Quist and this supposedly safe haven. And when, after nights of being tormented by unearthly cries, Karen ventures into the forest and makes a terrifying discovery. (Read More)
Subgenre: | independent filmcult filmstop motionstop motion animationcreature featuresurvival horror |
Themes: | jealousydeathmurderlovefriendshipmarriageinfidelityrapeadulterymonsterdeceptioncorruptionsupernatural powerunfaithfulnessfalling in love …amnesiaself sacrificehuntingmurder of brother (See All) |
Mood: | nightgore |
Locations: | campfireforestbarbeachlos angeles californiawoodsrural settingofficegas station |
Characters: | serial killerkillerbrother sister relationshipfemale protagonistpolicemanlustpsychiatristsheriffolder man younger woman relationship |
Period: | 1980s |
Story: | campfire storycreepyfemale nuditybased on novelnuditymale nudityfemale frontal nuditytwo word titlesex scenekissfemale full frontal nuditynipplessurprise endingfire …fondlingcorpseshot to deathmirrorblondecamerabare buttriflevoyeurold mancaliforniaaxefemale pubic hairexploding carbrunettedream sequencedrawingtransformationdangerscreamingfirst of seriespay phonesensualitystalkingcabinarsoncorrupt copwerewolftv newsburned alivedesiredressgothictape recordermorguephone boothdesperationsevered handgrindhouseforbidden lovehomiciderampagewoman in jeopardyreverse footagebookstorefogperversionvegetarianbarbecueattractionlens flaresurprise after end creditsbushcartoon on tvbandagesexual perversionacidrestroomsecret societycattlegroup therapyjacketsuicidalmetamorphosisflameorchestral music scoreshape shifterclawshapeshiftingpleasurecolonymurder victimregenerationfangsnews anchorawakeninghowlingwearing a sound wirehuman preyporn looplycanthropysilver bulletfemale werewolfgrowlingwildfirecovelycanthropeadult bookstorewerewolf transformationwerewolf bitebloody scratchwerewolf packwerewolf family (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
Subgenre: | independent filmmartial artscult filmblack comedysuspensesupernaturalparanormalamerican horror |
Themes: | murderrevengefuneralpsychopathsupernatural powerevil |
Mood: | slashernightmarehigh schoolgorerain |
Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
Characters: | serial killerkillertough guyteenagerfather son relationshipfather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshiplittle girlwaitressvillainterrorslasher killerserial murderer |
Period: | 1980s |
Story: | stabbed to deathkillingsleepingbloodnumber in titlesequelfemale frontal nuditydogbare chested malecigarette smokingphotographsurprise endingfiredreamcorpse …digit in titleblood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armundeadpizzamaniacsurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreepsycho killerserial murdervillain played by lead actorpsychopathic killerbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spirithomicidal maniacbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath …ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
Subgenre: | cult filmtragedypsycho thrilleramerican horror |
Themes: | jealousyrevengedeathmurderrapereligiontortureinvestigationangerpsychopathinsanityevilgreedmurder investigation |
Mood: | slashergorerainneo noir |
Locations: | hospitalbarhelicopternightclubdeserttaxiurban settingapartmentpolice stationrooftopbrothel |
Characters: | serial killerkillerhusband wife relationshippoliceprostituteteacherdetectivephotographerlawyerinterracial relationshiplustsecurity guardpolice detectivevillainbible …terrorpolice shootoutpimppregnant womanself mutilationslasher killercoronerserial murderersuicide by cop (See All) |
Story: | body countcreepykillingbloodviolencenumber in titleone word titleinterviewdogbare chested malephotographtitle spoken by characterchasesurprise endingpanties …pistolshootoutcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunarrestheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminaldecapitationfoot chasegay slurflashlightambulancedinersubwaywhite pantiessevered headscantily clad femalehit by a carnews reportshot in the foreheadattempted murderlibraryevil mansadnessmurderertied uptypewriterfreeze framegirl in pantiesmaniactv newscard gamepokergothictape recordersociopathmutilationtied to a bedfbi agentcrucifixloss of wifeblockbusterswat teampsychosevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingboxkilling spreeage differencedead dogserial murderpsychopathic killerbad guymadmanalleycartoon on tvkillhuman monsterspiral staircasecockroachhomicidal maniacinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturesadistic psychopathspaghettimurder spreebarbershopmass murdererinnocent person killedcrime spreestairwellpolice partnerjumping from a rooftopwriting in bloodel trainpsycho terrorswatpolice protagonistbreaking down a doorsleeping pillsreference to ernest hemingwaydisturbingfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencevictim invited to dinnercredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All) |
A POV, found footage horror film from the perspective of America's top genre filmmakers. A group of misfits are hired by an unknown third party to burglarize a desolate house in the countryside and acquire a rare tape. Upon searching the house, the guys are confronted with a dead body, a hub of old …televisions and an endless supply of cryptic footage, each video stranger than the last. (Read More)
Subgenre: | supernaturalfound footage |
Themes: | deathmurderghostdrunkennessdeceptionsupernatural powerevilhome invasionreligious cult |
Mood: | goredarknessone night |
Locations: | lakeforestbarroad tripmotel |
Characters: | killerhusband wife relationshipzombiealienghost in mirror |
Period: | year 1998 |
Story: | stabbed to deathhorror filmbodyknifebloodviolencefemale nuditymale nudityfemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nudity …female full frontal nuditytitle spoken by charactermale full frontal nuditylesbian kisstopless female nuditycorpserescuedemontelevisionsubjective cameradecapitationhalloweenflashlightgangvideo camerathroat slittingimpalementcocainesevered headritualanthologylooking at the cameratalking to the cameraskinny dippingcharacter repeating someone else's dialoguepossessionhalloween costumepranksplit screendeath of husbandbasementtrapcharacter says i love youhaunted houserevelationbreaking and enteringvandalismvideotapecovered in bloodmasked maneaten aliveswitchbladeburglarystabbed in the throatstabbed in the headdisembowelmenthandheld cameraone daytitle at the endknife throwingcastrationlooking at self in mirrorlens flareabbreviation in titlecharacters killed one by onefortune tellermarijuana jointblood on camera lenswoman cryingwebcamvhspotfilmed killingsmoking marijuanavcrman slaps a womanbitten handsuccubusbroken handslash in titleghost childsevered penisvhs tapemasked womanpassed out drunkstabbed in the foreheadvideo chatwatching someone sleepcar hit by a trainnude man murderedhalloween maskpenis ripped offthroat slitnanny cam (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | independent filmcult filmblack comedysuspenseb movieabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | campingfeardeathmurderrevengefriendshipdrinkingdrunkennessescapebrutalityparanoiaguiltinsanityillnessunrequited love …home invasionexploitationpanicpolice brutalityhunting (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | campfirelakeforesthospitalbathtubbicyclewaterwoodsfarmtruckcavegas stationbackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | campfire storystabbed to deathbodygroup of friendsswimmingknifeviolencebloodfemale nudityfemale frontal nudityflashbackmasturbationdogbare chested malesex scene …female rear nuditycigarette smokingfingeringphotographpartychasesurprise endingpantiespistolshowerfirecell phonewoman on topbeatingcorpseshot to deathblood splatterhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf worddecapitationcleavagesurvivalfoot chasegay slurambushaxemassacreambulancedeath of friendimpalementstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingmarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
Subgenre: | independent filmcult filmpsycho thrillerslasher flickteen horroramerican horror |
Themes: | drugsmurderdeathpsychopathparanoiainsanityevilabductionalcoholism |
Mood: | slashernightmarehigh school |
Locations: | schoolsmall townelevatorkitchentruck |
Characters: | serial killerteenagerfamily relationshipspolicemother son relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirlnursepolicemansecurity guardalcoholicvillain …secretaryterrorslasher killermysterious villain (See All) |
Period: | 1990syear 1998 |
Story: | body countstabbed to deathknifeviolencebloodnumber in titlesequelchasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighbor …hallucinationtelephonesubjective cameradecapitationgood versus evilhalloweenflashlightwinecandlecaliforniaaxeambulancestabbingdeath of friendthroat slittingtoiletstabbed in the chestweaponsevered headattempted murderstalkerstabbed in the backprologuekeyuniformcharacter's point of view camera shotmistaken identityevil manactor shares first name with characterstalkingreunionflowersplattermaniacbreaking and enteringheroinesurvivorlifting someone into the airrageloss of friendhidingpsychovictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murdercharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeypsycho killerreflectionstolen carserial murderpsychopathic killeranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatehomicidal maniacslashingbody baggraphic violencestabbed in the facehiding placemasked villainknife murderbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevillain not really dead clichesittingseventh partpsycho terrormichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chestcult favoritehead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Stranded on a lonely road, a schoolbus full of high school basketball players, their coaches, and cheerleaders must defend themselves from the Creeper - a flesh-eating ancient beast that resurfaces on the earth every 23 years to feed. Meanwhile, a farmer and his son set out on a personal mission to …hunt the Creeper down. (Read More)
Themes: | feardeathrevengebetrayalracismrivalryself sacrifice |
Mood: | nightmarehigh schoolgore |
Locations: | rural settingwheelchairfarmschool busschool bus driver |
Characters: | serial killerteenagerhomosexualfather son relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipself mutilation |
Period: | near future |
Story: | body counthigh school studentknifebloodviolencecharacter name in titlesequelflashbackdogbare chested malecigarette smokingchasecorpseshot in the chesturination …slow motion scenecar crashdemondecapitationgay slurflashlightjournalistimpalementstabbed in the chestsevered headno opening creditsdream sequencechild in perilnews reportshot in the foreheadracial slurdeath of childfarmerscardeath of brotherdisappearancecheerleaderdeath of sonthreatened with a knifesevered armpsychicnerdspearbarndesperationbroken legreverse footageblood on facegash in the facedeath threatstabbed in the headmurder of a childeye gougingbody landing on a carknife throwingraised middle fingerhomoeroticismstabbed in the eyedead boysevered legflat tirecrowshot through a windowhead woundstabbed in the armno title at beginningdouble barreled shotgunflarehanging upside downcornfieldshot in the eyeexploding truckrhyme in titlebloody body of childscarecrowjockunderage smokingdisembodied headstabbed in the shoulderdisfigured faceoverturning carflare gunbonevillain not really dead clichechild abductionclairvoyanthead ripped offthrown from a carbloody body of a childtoothchild killedcut armthrowing starshurikenhomophobeexterminatorharpoonbreaking a car windowthrown through a windshieldbasketball teambroken windshieldstabbed in the heartno cellphone signalboy killedhigh school basketballracist remarkchild knocked unconsciousbasketball coachdecomposed bodyman eating monstercropheadless corpsecb radioreflection in car mirrorbelly buttonindestructibilityspear through chestwingimpaled through the headsevere tire damageimpaled through eyestate championshipbroken down bussunspotbat wings (See All) |
Young newlyweds Paul and Bea travel to remote lake country for their honeymoon. Shortly after arriving, Paul finds Bea wandering and disoriented in the middle of the night. As she becomes more distant and her behavior increasingly peculiar, Paul begins to suspect something more sinister than sleepwa …lking took place in the woods. (Read More)
Subgenre: | body horror |
Themes: | lovemarriagemental illnessabortion |
Mood: | night |
Locations: | campfirelakeforestrestaurantwoodsbackwoods |
Characters: | husband wife relationshipalienchildhood friendtalking to oneself in a mirror |
Story: | horror filmplaytentviolencefemale nudityf ratedmale nudityflashbackbare chested malefemale rear nuditytitle directed by femaleshotgunundressinglie …male pubic hairf wordhouseapologydrowningtransformationtalking to the camerareunioncabinstrong female charactercouplenipples visible through clothingtied to a bedmagazinebarefoot maletensionmale full rear nuditytied feetfemale directorbruisewedding receptionmemory losswifeset uprepeated scenedoubtreading aloudhoneymoonfemale psychopathmessagecabin in the woodsbaseball capmotorboatfemale villainsexual frustrationparasitemurderessmysterious womanestrangementwatching a videodeath by drowningundressing someoneimplied sexwet clothessleepwalkingslimefemale antagonistpancakenightgowntalking to oneselfhysterical womannewlywedssecretly observingwoman hits a manmissing womanshared showerrope bondagetwo in a showerwatching someone sleepmysterious eventwoman directorpost coital scenefishing rodmurder by drowningdice gamenaked outdoorsearthwormmissing wifewedding videobite marksleeping shirtlessbody snatchingfemale filmmakerpretending to sleepjust marriedskin diseasewoman wrapped in a towelreference to freddy kruegersuspicious husbandhuman behaviornewlywed couplerestauranteuranthilllightstied handsfrench toasthusband wife fightvaginal examfemale bondagelife preserverwoman tied to a bedblood pooltied mansurveillance videovacation gone wrongvaginal bleeding (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | independent filmcult filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror |
Themes: | fearmurderdeathfriendshipkidnappingtortureescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | slasheravant gardedarknessambiguous ending |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | serial killerkillerteenagerfamily relationshipsboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostagevillainterrorself mutilationtruck driverslasher killer …serial murdererself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | body counturban legendscream queencreepygroup of friendskillingknifeviolencebloodphotographchasesurprise endingvoice over narrationbeatingcorpse …blood splatterurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark housescene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdobanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiayelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
When a videographer answers an advert of the website Craigslist for a one-day job in a remote mountain town to video the last messages of a dying man. The job takes a strange turn when the last messages get darker and darker. The videographer continues to see the job through, but when it is time to …leave he is unable to find his keys, and when he receives a strange phone call he finds his client is not at all what he initially seemed to be. (Read More)
Subgenre: | independent filmfound footage |
Themes: | murderfilmmakingdeceptionpsychopathobsessionhome invasionwilderness |
Mood: | nightmare |
Locations: | lakeforestcarbathtubwoodsapartmenttown |
Characters: | serial killerkilleractor director writer |
Period: | year 2012 |
Story: | stabbed to deathlyingsleepingknifeone word titlebare chested malesurprise endingtelephone callcell phonewritten by directormaskpaintinglielow budget filmsubjective camera …axemountainvideo cameradinerapologyno opening creditsbathnecklacetalking to the cameraconfessionparkstalkerwritten and directed by cast memberstalkingautomobilethreatcabinsubtitled scenefreeze framehuggingwolfvideotapemasked manwhiskeyshovelstabbed in the headdeath of protagonisthandheld cameratitle at the endintruderaxe murderbenchwritten by stardrugged drinkserial murdervideo tapeminimal caststuffed animaldying mancabin in the woodsvideo footagemale in bathtubdisturbed individuallocketpackagevideo diaryaxe in the headcar keysdigital videostuffed toylock of hairtwo directorswatching someone sleeplake housejump scaregarbage baglooking for workvideo messagementally unstabletwo handersitting on a benchanimal maskcalling the policesecret filmingman in bathtubreference to craigslistantagonist as protagonistunpunished antagonistdisturbed personhonda civicopening creditshouse in the woodsmentally unstable manwolf costumewritten by actorlocket with photographmountain townrape confessiontape recorded confession (See All) |
In order to avoid a ghostly figure in the road, high school senior Brent Mitchell wraps his car around a tree, killing his father. Constantly confronted by his mother's emotional collapse after the accident, Brent escapes into a marijuana fueled world of loud metal music to block the pain and guilt. … Dejected and out of sorts, he has a shot at happiness with his girlfriend Holly, a grounded, caring girl with drop dead good looks, a dream date for the high school prom. But his plans are thwarted by a disturbing series of events that take place under a mirrored disco ball, involving pink satin, glitter, syringes, nails, power drills and a secret admirer. Brent has become the prom king at a macabre, sadistic event where he is the entertainment. (Read More)
Themes: | fearjealousydrugsmurderrevengedeathfriendshipkidnappingtortureescapeincestpsychopathdeath of fatherbrutalityobsession …dysfunctional familyinsanityhumiliationsadismunrequited lovecrueltycannibalismvengeancemadness (See All) |
Mood: | nighthigh schoolgoreone night |
Locations: | small townaustraliapolice carsex in caroral sex in a car |
Characters: | teenagerfamily relationshipspolicemother son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipteenage girlteenage boyhostageterrorself mutilationself justice |
Story: | stabbed to deathkillinghigh school studentknifebloodviolencesexfemale nuditynumber in titledogbare chested malegunpartypunctuation in title …cryingcell phoneblood splattercondomundressingrunningcar crashfightingsurvivalflashlightstabbingdrawinghit by a carfemme fatalemissing personscreamloss of fathertied upcharacter says i love youteenage sexpot smokingteen angstballoonragecaptiveloss of loved onehammerdesperationvictimdead womanfemale killerconfrontationhatredmercilessnessgash in the facerejectionstabbed in the necktaking a pictureescape attemptheartdead manfamily dinnerdead motherphysical abuseparentspsychopathic killerstrugglerunning awaykilling a dogdead fatherlockerfemale psychopathdegradationmaking outinfatuationteenage daughterheld captiveobsessive loverazor bladepromatrocitycrazinesskiller childvolkswagenfatal attractionteenage crushmatricidesalthopelessnessrock climbingspoiled bratstabbed in the footforkhostilityenduranceemaciationhigh school dancerosesmale tied uprun over by a carhigh school prommad womandrill in the headsavagerycuttertoolboxstruggle for survivalwill to liveprom queenself defencevictim invited to dinnerelectric drillprom dressmaking out in a cartroubled teenage girlfemale in brahole in the headprom kingbleeding footfemale jealousypsycho girl (See All) |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh …ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modern |
Themes: | jealousyrevengedeathmurderlovebetrayaldrunkennessescapeinvestigationdeceptionpsychopathdeath of mothersurveillancehome invasiongreed …murder of a police officer (See All) |
Mood: | slasherhigh schoolgoresatire |
Locations: | hospitalsmall townelevatorpolice station |
Characters: | serial killerteenagerhusband wife relationshippolicefemale protagonistsheriffcousin cousin relationshipex boyfriend ex girlfriend relationshipself mutilationaunt niece relationshipself referentialshooting a police officer |
Period: | 2010s |
Story: | stabbed to deathgroup of friendshigh school studentknifebloodviolencenumber in titlesequelpartychasesurprise endingpistolcell phonecorpsedigit in title …shot to deathblood splattershot in the chestrescuepunched in the facefalling from heightmaskbookheld at gunpointnumbered sequelf wordreporterfoot chaseflashlightbound and gaggedvideo cameradisguiseambulancedeath of friendthroat slittingstabbed in the chesttied to a chairno opening creditspolice officer killedfemme fatalenews reportshot in the foreheadauthorcharacter repeating someone else's dialoguevirginstabbed in the backfired from the jobelectrocutionknocked outfilm within a filmpolicewomansuspicionthreatened with a knifevigilantestrong female characteranswering machinefalling down stairsrevelationsociopathfamered dressbarnsecurity camerawalkie talkiestabbed in the stomachkicked in the stomachfourth partimpersonationpress conferencestrong female leadparking garagefemale killerduct tape over mouthcrime scenetensionunderage drinkingstabbed in the throatstabbed in the neckpunched in the stomachdeath threatstabbed in the legdisembowelmentbookstorebody landing on a carlens flarecharacters killed one by onedead woman with eyes opensequel to cult favoritemasked killermedia coveragelaptop computerintestinesstabbed in the handhiding in a closetreference to facebookwebcamstabbed in the armclimbing through a windowwhodunitfacebookdeputystabbed in the shouldersole black character dies clichefilmed killingcamcorderreference to twitterfemale cophiding under a bedspitting bloodbreaking through a doorshot in the crotchstupid victimvillain not really dead clichewoman in dangerbullet proof vestred herringdead woman on floormovie fantauntingdeeply disturbed personmystery killerpretending to be deadbook signingstabbed in the footdoorbellaccomplicebreaking down a doorbloggerdead teenagergeneration ydefibrillatorstartledstabbed in the bellystabbed in the foreheadclichepublicistmillennial generationthreatening telephone callfourth in seriesthrown through a glass doorunmaskingparty crashingmotivephone terrorreference to jeffrey dahmertelephone terrorweb camerathrown off a balconyreference to bruce willissudden disappearanceschool clubstabbing a womanhiding evidencemise en abymestabbing a police officerself inflicted woundcrashing through windowgarage door openerwatching a horror movieactress shares last name with characterdraw bladerunning into a wall (See All) |