Please wait - finding best movies...
Since childhood, Matthew kept a dark secret: he's possessed by a demon. Now grown, serving in the United States Marine Corps, he's learned to tame the demon through self-mutilation. That cure soon ends as two recruits, who are members of the occult, cast a spell on him to manifest Matthew's worst fe …ars. As his life slips away, the demon fully overcomes him and Matthew goes on a killing spree. (Read More)
| Subgenre: | domestic dramaconspiracysuspense |
| Themes: | childhoodevilescapedrugsdeath |
| Mood: | gore |
| Characters: | self mutilationofficerdaughtersoldier |
| Story: | satanic ritualmarine corpskilling spreecoedflashbackssubliminalsoldierstarot cardsmarinessatanicworshipboot campsatanchantinghusband …marinedark secretwifespellwitchcraftmutilationoccultkillingsmokingritualmassacrealcoholdemonshootingnudityfight (See All) |
Skeptical female clinical psychologist Kristen Bouchard joins a priest-in-training and a blue-collar contractor as they investigate supposed miracles, demonic possessions, and other extraordinary occurrences to see if there’s a scientific explanation or if something truly supernatural is at work.
| Subgenre: | domestic dramaconspiracysuspensesupernatural |
| Themes: | evildeath |
| Characters: | officerdaughtersoldierpriestmother |
| Story: | satanic ritualflashbackssubliminalsoldierstarot cardssatanicworshipboot campchantinghusbandwifewitchcraftoccultritualdemon …shootingfightphotographtrainingbarntoycamppsychologistseriesborderpictureshirthandsymbolcardheadachecardsjumptarotblueyoungblue collarawardsfemalecollardemonicplayingcontractorscareddomesticbloodybootlearnmiraclesexplanationscientificneckkilledat workclinical psychologist (See All) |
| Subgenre: | suspensecult film |
| Themes: | evilescapedeathmurderrapepregnancyfeardeceptiondevilmurder of family |
| Mood: | goreslow burn |
| Locations: | hospitalcemeterykitchen knifeblood in carrunning water |
| Characters: | husband wife relationshipfemale protagonistnurseterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
| Period: | 1980syear 1982 |
| Story: | satanic ritualwitchcraftoccultritualdemonbloodflashbackbare chested malecigarette smokingdancingphotographknifechasesurprise endingpanties …pistolcorpseblood splatterblondeshot in the headwatching tvsecretdead bodycollegepianocleavagefoot chasebound and gaggeddeath of friendthroat slittingstabbed to deathsuicide attempthousefishwhite pantiesscantily clad femaleroommatevangraveyardstabbed in the backprologuepay phoneproduct placementknocked outcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexhaunted housepizzagirl in pantieseavesdroppinghypodermic needlebabysitterpatientstabbed in the stomachcovered in bloodattempted suicidepower outagepool tableshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophywilhelm screamlyingceremonyhairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a … family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)
| Subgenre: | conspiracysuspenseindependent filmamerican horrorbritish horrorfolk horror |
| Themes: | evildeathmurderkidnappingreligionghostfearmagicdeath of fathersupernatural powerdeath of motherredemptionguiltinsanityillness …dyingdevilmadnesswildernessfather love (See All) |
| Mood: | goreraindarkness |
| Locations: | churchforestvillagewoodsrural settingfarmenglandcampfirenew englandbackwoods |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerbrother brother relationshipboybrother sister relationshipteenage girlbabysister sister relationshipchristian …reference to godlittle girllittle boyvillainbiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All) |
| Period: | winter17th century1600s |
| Story: | killing spreesatanchantingwitchcraftdemonnudityfemale nuditybloodmale nudityviolencefemale frontal nuditymale rear nuditydogbare chested malekiss …singingknifecryingsongblood splatterfoodhorseundressingsecretlieriflehallucinationreference to jesus christprayersubjective cameracandlestrangulationaxestabbingwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinwolfmass murdergothiceggcrying womancrying manburialanimal attackgoatapplepromisetensionhypocrisysonhungerbutchershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldbonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhisperingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying graceno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutdead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
| Themes: | evildrugsdeathmurderrapetortureincestpsychopathbrutalityinsanityexploitationmurder of family |
| Mood: | goreslasher |
| Locations: | chicago illinois |
| Characters: | brother sister relationshipprostituteserial killerkillervillainterrorslasher killermysterious villainserial murderermurder of a prostitute |
| Period: | 1980s |
| Story: | killing spreemutilationkillingnudityfemale nuditycharacter name in titlebloodviolencebare breastsgunsurprise endingshot to deathblood splattershot in the chest …low budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentsplattermaniacfemale stockinged legsragestabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherbody countpsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
| Themes: | evildeathmurderprisonmonsterpsychopathsupernatural powerinsanitymurder of a police officer |
| Mood: | gorecar chaseslasherdarknessbreaking the fourth wall |
| Locations: | forestcemeterysmall townboatwoodslakeamerica |
| Characters: | policeteenagerzombieserial killerkillervillainsheriffterrorslasher killerserial murderer |
| Period: | 1980s |
| Story: | killing spreemutilationkillingmassacredemonsexcharacter name in titlenumber in titleviolencesequelflashbacksurprise endingblood splattermasknumbered sequel …decapitationflashlightambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | independent filmcult filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
| Themes: | evilescapedrugsdeathmurdersurrealismghosttorturepsychopathsupernatural powerdeath of motherinsanitysadismamnesia |
| Mood: | gorerainhigh schoolnightmareslasherdarkness |
| Locations: | small townairplaneroad trip |
| Characters: | self mutilationdaughterfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterroryounger version of characterdeafnessslasher killerserial murderer …german americanevil father (See All) |
| Period: | 1990s1970s1960s1940s1950s |
| Story: | killing spreemutilationkillingdemonf ratedcharacter name in titlebloodviolencesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in title …title directed by femaledreamblood splatterrescueslow motion scenefalling from heightapostrophe in titlecriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countpsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv …ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
| Subgenre: | independent filmcult filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror |
| Themes: | evildeathmurderrapeghostdancesupernatural powersadismsupernatural rapebook of evil |
| Mood: | goreslasherone night |
| Locations: | forestcarwoodssinging in a car |
| Characters: | self mutilationfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself cannibalism |
| Period: | 1980s |
| Story: | mutilationoccultdemonshootingfightfemale nuditybloodviolencekissthree word titlesurprise endingfireblood splatterremakeshot in the head …shotgunwritten by directorbooklow budget filmcollegeriversubjective cameradecapitationaxestabbingbridgestabbed to deathsnakesevered headanti heronecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentchainsawspiritfireplacedestructionsexual abusegroup of friendscaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | conspiracysuspenseindependent filmcult filmcoming of agesupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | evilescapedeathmurderfriendshipsurrealismfeardrunkennessdancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillness …sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | gorerainnightavant gardeslasherdarknessstylization |
| Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | self mutilationteenagerfrienddoctorboyteenage girlfemale protagonistteachergirlpolice officerstudentsister sister relationshipkillerpsychiatristprofessor …witchgermanamericanamerican abroadaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | satanicwitchcraftoccultkillingritualdemonbloodviolenceone word titleflashbackdogcigarette smokingdancingexplosionknife …chasesurprise endingtelephone callfirevoice over narrationcorpseblood splatterslow motion scenesecretfalling from heightshowdownbathroompianohallucinationvoyeurtelephonesubjective cameraswimminggood versus evilfoot chasewineambushstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathtoiletstabbed in the chestcoffinattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotmissing personcover upcollege studentlightningscreamhangingdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropeitalianeavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencehanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
Cox and Hirsch play father and son coroners who receive a mysterious homicide victim with no apparent cause of death. As they attempt to identify the beautiful young "Jane Doe," they discover increasingly bizarre clues that hold the key to her terrifying secrets.
| Subgenre: | supernaturalsupernatural horror |
| Themes: | evildeathmurderrevengefeartorturebrutalitysupernatural powersadismcrueltypanicmysterious death |
| Mood: | gorenightdarknessone nightblood and gore |
| Locations: | elevatorpolice carstorm |
| Characters: | father son relationshippolicezombiepolice officerbiblewitchsherifffathergirlfriendout of control |
| Story: | dark secretwitchcraftmutilationkillingritualnudityfemale nuditycharacter name in titlebloodviolencebare breastsfemale frontal nudityfemale full frontal nuditynipplestitle spoken by character …firetopless female nuditybeatingcorpseblood splattercataxeman with glassesradiopaindangerdarkundeadsplatterdestructionrevelationmorgueaccidental deathdead womanhomicidecrime scenesufferingsonpower outageescape attemptdisembowelmentautopsyheartsurprisedead mandark pastbruisedead girlblackoutscalpelbellbleedinghallwaynaked dead womanfrightmultiple murdersorceryscareorganeyesloss of controlcorridortoothtortured to deathexaminationmultiple homicideliftsevered tongueevil powerdissectionevil forceaccidental murderbroken anklepower cuteviscerationforces of evilattempted escapekillingstorture victimlungsbroken bonedark forcestormy nightbruiseslungwhite eyesbroken wristmultiple killingforce of evilautopsy roomscar tissuemissing toothforces of darknessgrey eyescause of deathroman numeral (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit …ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
| Subgenre: | suspenseindependent filmcult filmblack comedydark fantasychristian horrorreligious horror |
| Themes: | evilescapedeathmurdersurrealismkidnappingreligionbetrayaljealousyfearfuneralinvestigationdeceptionpsychopathbrutality …supernatural powerparanoiadepressioninsanitysadismhopepanicdyingapocalypsecannibalismhomelessnessdevilmurder of a police officernear death experienceghost townreligious conflict (See All) |
| Mood: | goreneo noirarchive footagedarkness |
| Locations: | hospitalschoolchurchcemeterysmall townlos angeles californiadesertapartmentpolice stationpolice carrooftopcatholic churchschool busschool teacher |
| Characters: | soldierpoliceteacherzombiegirlpolice officernursedetectivepolicemanpriesthostagechristianlittle girlnative americanwaitress …christianitypolice detectiveteacher student relationshipbiblesheriffgrandmother granddaughter relationshipcatholic priesthomeless mancoronerdeath wish (See All) |
| Period: | 1990s |
| Story: | killing spreesatanchantingkillingritualdemonfightbloodviolenceflashbackgunkisscigarette smokingphotographtitle spoken by character …explosionknifesurprise endingfirevoice over narrationcryingbeatingcorpseshot to deathblood splatterfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewritten by directorbrawlfalling from heightshowdownheld at gunpointsunglassesdead bodyhallucinationhandcuffsprayerrevolvershot in the backgood versus evilsurvivalorphanflashlightcaliforniaambulanceimpalementsuicide attemptdinerdisarming someonecoffinnarrationchild in perilhit by a carfictional wardouble crosspolice officer killedgraveyardshot in the foreheadflash forwardattempted murdercharacter repeating someone else's dialoguedangerperson on fireliarfirst of seriesmissionpossessionangelrace against timestatuecover upevil manknocked outskeletonmanipulationexploding bodyfirst partprofanitygrandmothernewspaper headlineundeadhenchmanpizzamaniacpickup truckburned aliveelectronic music scoregothicshot in the stomachsociopathscene during opening creditsmorgueskullmind controlcolonelback from the deadcrime scenevisioncynicismcannibalmercilessnessresurrectionprophecyreference to satanbible quoteheavenhit on the headpunched in the chestjumping through a windowthrown through a windowautopsyaerial shotarizonachoirsoulhealingeye gougingtribebody landing on a cardemonic possessionburned to deathexorcismnewspaper clippinglyingarrogancetelepathyclose up of eyesgothporn magazineliving deadlevitationfinal showdownhead woundsuper strengthworld dominationfilm projectormegalomaniactrailer homeburnt facedeputyshamanburnt bodybadgemaggotsymbolheart ripped outmind readingmurder spreechosen onetheologyheart in handtrenchcoatlapdkorean warhide and seekwar criminalblasphemycrime spreegrave diggingtauntingchild with a gungrand canyoncourt martialluciferinvulnerabilityhermaphroditehealerabandoned carbloody mouthfilm reelabandoned minemisanthropethrown through a windshieldsevered facekiss on the foreheadhenchwomantire ironfallen angelmass deaththrown from heightcrisis of faithpyrokinesiskorean war veteranmale tearsindian reservationmisanthropysoul transferencegross outarchangelexploding trailerface burnhit with a tire ironancient bookshushingcopper minedriving through a wallholy warburning bodygas lampchristian godtirednessmintpersonification of satandark angelgifted childreligious riteburning corpseeating heartmortal woundvisions of heavenarchangel gabrielinitiation ceremony (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | suspenseindependent filmcult filmslasher flickaustralian horrorsadistic horror |
| Themes: | evilescapedeathmurderkidnappingrapedrinkingfeartorturedrunkennesspsychopathbrutalityinsanitysadismabduction …exploitationcruelty (See All) |
| Mood: | gorecar chasenightslasherdarknessblood and gore |
| Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | self mutilationhusband wife relationshipdoctorsingerserial killerhostagekillervillainaustralianterrorslasher killermysterious villainserial murderermysterious killer |
| Period: | year 1999 |
| Story: | killing spreemutilationkillingmassacrebloodviolencedogtwo word titlegunkisscigarette smokingphotographtitle spoken by characterexplosionsinging …partyknifechasebased on true storysongcorpseshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedvideo camerastabbingimpalementstabbed to deathfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufogaragemaniacpickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
New York postal worker Jacob Singer is trying to keep his frayed life from unraveling. His days are increasingly being invaded by flashbacks to his first marriage, his now-dead son, and his tour of duty in Vietnam. Although his new wife tries to help Jacob keep his grip on sanity, the line between r …eality and delusion is steadily growing more and more uncertain. (Read More)
| Subgenre: | conspiracyindependent filmcult filmtragedy |
| Themes: | deathtorturefuneralmonstermemoryparanoiaabductiondying |
| Mood: | gorenightmare |
| Locations: | hospitalnew york citytrainhelicopterbathtubcar bombcar fire |
| Characters: | self mutilationsoldierfather son relationship |
| Period: | 1970syear 1971 |
| Story: | flashbackswifedemonfemale nuditycharacter name in titlebloodmale nudityflashbackmale rear nuditydogfemale rear nudityexplosionpartychase …surprise endingshowerpunctuation in titlecorpseshot in the headbare buttvomitingapostrophe in titlehallucinationnew yorkdeath of friendarmysubwayexploding carhit by a carangelcover upkicked in the facedeath of childdeath of sonneck breakinghauntingsevered armeyeglassesgothiclifting someone into the airtitle based on songstabbed in the stomachcrucifixdrug abusevietnamvietnam warlossfemale singerbuddhistbarefootimaginationvisionanxietypost traumatic stress disorderdelusioncrowclose up of eyesman cryinggothhandshakeplaying poolmind gamestrait jacketfevergurneypostmanenigmapurgatorysevered foottrenchcoatvietnam war veteranman in a wheelchairwoman wearing black lingerieguardian angelfamily photographhuman experimentationsnorricamjumping from a cartitle based on the bibleuh 1 huey helicopterfriendly firesparringstabbed in the foreheadlynchianoneiricpalm readingtwo in a showerburning a photographdemon rapelifting a male into the aircaged birdpostal workerchiropractorbaseball carddog tagsmail truckincubusice bathelbowed in faceauditory hallucinationphantasmagoriasharing a cigaretteterrifiedchained doordead but doesn't know ithonorable dischargeriding a subwaymedivac (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
| Subgenre: | independent filmcult filmsupernaturalpsychologicalpsychological horrorsupernatural thriller |
| Themes: | drugsdeathmurderreligioninvestigationmagicincestmemorycorruptionsupernatural powerblackmailgamblingcannibalismamnesiadevil …murder investigationdeath of daughterfather daughter incest (See All) |
| Mood: | goreneo noir |
| Locations: | hospitalnew york citybarbeachrestauranttrainchurchhotelsnowbathtubbuselevatorfarmtrain station |
| Characters: | soldierfather daughter relationshipdoctorsingerteenage girlserial killernursedetectivemusicianbabypriestlawyerinterracial relationshiplustpolice detective …biblemaidfrenchself discoverypolice arrestfather daughter sex (See All) |
| Period: | 1950s |
| Story: | satanic ritualtarot cardsmutilationoccultritualdemoncharacter name in titlebased on novelbloodfemale frontal nudityflashbackmale rear nuditydogtwo word titlebare chested male …sex scenefemale rear nuditycigarette smokinginterracial sexdancingnipplesphotographsingingsurprise endingpantiespistolcryingdreamcorpseshot to deathblood splatterfistfightmirrorcatwritten by directorvomitingtearsrunninginterrogationpianohallucinationrevolverrivermanhattan new york cityfoot chaseflashlightbracandleold manmansionbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequencesearchgraveyarddrowningbartenderracial slurgunshotgravedrug addictmicrophonekeyuniformstatuemissing personscreamringscene during end creditspianistpursuitcountrysideglassesratstagechickenjazzprivate detectiveapplauseidentityspiritkilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancecomapatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackpreachermental institutionwatching televisionfannew orleans louisianajunkiescene after end creditssuperstitiondisembowelmentheartblood on shirtchoirsoulrainstormcanecastrationlooking at self in mirrorpastorfortune tellervoodooblack magicmusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedceremonyinvestigatorfountainbaptismlouisianaspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinichearing voicesinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingritecrowbarmorphinesymbolheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devillockworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titleincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
Max Renn runs a TV channel, and when looking for new material to show--he discovers "Videodrome." His girlfriend, Nicki Brand, goes to audition for the show, and Max gets drawn into the underlying plot that uses the show as its front for a global conspiracy.
| Subgenre: | conspiracysuspenseindependent filmcult filmvideocyberpunkbody horrorcorporate conspiracy |
| Themes: | escapedeathmurderrevengesurrealismsuicidebetrayalfeartorturedeceptionseductionparanoiainsanityexploitationpanic …philosophytechnology (See All) |
| Mood: | goresatirenightmareambiguous ending |
| Locations: | restauranthotelapartmentusa |
| Characters: | self mutilationlustjapanesepsychiatristprofessorsecretaryengineerwriter directorself inflicted gunshot woundsuicide by shootingsuicide by shooting one's self in the head |
| Period: | 1980s |
| Story: | killing spreenuditysexfemale nuditybloodmale nudityviolenceone word titlefemale frontal nudityflashbackmasturbationmale rear nuditybare chested malegun …female rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterexplosionsurprise endingpistolfiredreamcorpseshot to deathblood splattershot in the chestface slapshot in the headwritten by directorcondombare buttheld at gunpointbombhallucinationtelevisiontelephonebound and gaggedstrangulationtied to a chaircultanti heroassassinationdouble crossnews reportshot in the foreheadattempted murderlimousinemicrophonedangerfantasy sequenceauditionlong takemanipulationscarexploding bodypremarital sexshot in the armlove interestwhippingcult directorpizzapornographyrevelationelectronic music scoregothicshot in the stomachscene during opening creditsred dresstied to a bedmediavideotapecovered in bloodgrindhousevirtual realitysadomasochismmind controlmilksocial commentarywhipdark humordisembowelmentperversionalternate realitycorporationgothintestinesvideo tapemysterious manbrainwashingworld dominationnight visionelectronic musicblack marketradio stationpiercingpornographersnuff filmfight the systemfilmed killinghomeless persontelevision setceomurder spreephilosophersocial decayvcrextreme close upman slaps a womanshoulder holstersex on first dateman slaps womanreference to sigmund freudhidden guntv stationtalk show hosttumorgarroteman hits womanconferencejamaicanhand through chestvisionaryradio hostactress breaking typecastremadeabsurd violenceheadsetsubliminal messagetrailer narrated by percy rodriguezacting musiciancanuxploitationabandoned shipentrailssatellite dishassimilationvirtualityabandoned churchillegalityspectacleshole in chestpinunderground pornographymovie reality crossovervideo recordercable tvtv show within a filmtrade showtelevision executiveblurred boundariesboat yardopticiangimp masktoronto canadapirate broadcastsatellite televisiontelevision as portaldesensitizationvideo libraryagony aunt (See All) |
A visiting actress in Washington, D.C., notices dramatic and dangerous changes in the behavior and physical make-up of her 12-year-old daughter. Meanwhile, a young priest at nearby Georgetown University begins to doubt his faith while dealing with his mother's terminal sickness. And, book-ending the … story, a frail, elderly priest recognizes the necessity for a show-down with an old demonic enemy. (Read More)
| Subgenre: | cult filmtragedyparanormalparanormal phenomenaamerican horrorsupernatural horrorparanormal activity |
| Themes: | evildeathmurdersuicidereligionfeardrunkennessfilmmakingangercorruptionbrutalitysupernatural powerdeath of motherparanoiagrief …sadismfaithcrueltypanicself sacrificedevilmurder investigationclaustrophobiamysterious deathsupernatural being (See All) |
| Mood: | goredarkness |
| Locations: | hospitalbarchurchcarbathtubdesertkitchencatholic churchslum |
| Characters: | self mutilationdaughtermother son relationshipmother daughter relationshipdoctorteenage girlgirlpriestchristianactresssingle motherpolice detectivepsychiatristcatholiccatholic priest …self destructionout of controlself injuryevil girl (See All) |
| Story: | satanwitchcraftoccultritualdemonbased on novelbloodviolencepantiesbased on true storyunderwearblood splatterurinationpunched in the face …vomitingbedbathroompianohalloweenbedroomdeath of friendhouseaccidentman with glassesdream sequencetransformationpainargumentvirgindangerpossessionstatuescreamthreatbasementfirst partloss of motherprofanityheart attackwashington d.c.falling down stairssyringedestructionelectronic music scorehypodermic needleinjurytape recorderwoman with glassesjoggingragetied to a bedloss of friendcrucifixdesperationhomemovie directoriraqrampagewhiskeymiddle eastvisioninnocencesufferingblood on facediscussionmovie setpsychotronicdespairhypnosismedical examinationmedicationstairsabsent fatherfilm setastronautatticperversioninsultdemonic possessionliving roomroombruiseswearingexorcismunclelevitationgreekhit in the facecar drivingsubway stationautographstaircaseadvicevulgarityx raysatanisminsomniahearing voicescatholicismconversationautumnteenage daughterpsychiatrypunching bagseizurefamous scorefrightouija boardsuperhuman strengthmenacetormentriterisksleeplessnessanguishreference to the virgin marymedical doctornoiseholy waterblasphemyloss of controlmovie fanexorcistvoicescreenplay adapted by authorexaminationscreaming in fearskepticismmovie makingemaciationbloody mouthheart conditionmousetrapcocktail partyconvulsionloss of innocenceouijaperildemonicpaganismadolescent girldiagnosisscreaming in horrorboxing gymstabbed in the crotchsubliminal messagetrailer narrated by percy rodriguezcrisis of consciencevulgar languagecrisis of faithvirgin mary statueevil forceheresyarcheological diganimate objectfurypsychological tormentskepticsign of the crossbrain scandistorted voicescotchoccupation in titleforces of eviljeopardymysterious noiseneurologistpossessed girlagnosticmedical testdesecrationex boxerinsomniaclast ritesoccultismevil beingjesuitgreek americanfalling from a windowspeaking in tonguessacrilegeritalinslurhead spinmysterious voicevirgin girldiabolicaltroubled teenage girlvirgin blooddirector actor relationshipdemonic voicespinal tapforce of evilgirl in perilnitroglycerineneurological disordersleeplessquestioning beliefsradiographytalking backwardstwisting one's head completely aroundbaffled doctordiabolical possessionpassing through a wallphysical tormentfollow shotgeorgetown washington d.c.sexual insultgeorgetown universityiv linejesuit priestrough neighborhoodrunning trackspinning headagnosticismcrab walkdemonic forcethorazine (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | suspenseindependent filmamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
| Themes: | evilescapedeathmurdertorturepsychopathbrutalityinsanitysadismhome invasionexploitationcrueltymurder of a police officer |
| Mood: | gorenightslasherblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | self mutilationdaughterhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillervillainterrortalking to oneself in a mirrormysterious villain …the familymysterious killerkiller dogdirector of photography (See All) |
| Story: | wifemutilationfightfemale nuditycharacter name in titlebloodviolencebare breastsfemale frontal nudityflashbacktwo word titlecigarette smokingnipplesknife …lesbian kisssurprise endingpistolbeatingcorpseblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingimpalementstabbed to deathstabbed in the chesthousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manscreamactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recorderhammerhidingspiderdesperationpsychocovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manstabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
| Subgenre: | suspense |
| Themes: | deathkidnappingmarriageghostfearmagicpanic |
| Mood: | rainnightmare |
| Locations: | hospitalcemeterybathtubnightclubelevatorkitchenwheelchairrooftopgas station |
| Characters: | police officernursemusicianbabylawyerlittle girllittle boymaidfrenchwitch doctor |
| Period: | 1920s |
| Story: | husbandwifespelloccultritualfightbloodflashbackdancingphotographpartyknifesurprise endingpantiescell phone …dreamcar accidentmirrorblondeshotguncamerasecretfalling from heightriverflashlightbound and gaggedcandleold manstrangulationmaproommategunshotattempted murderkeyumbrellalightningringhangingdomestic violencecountrysideisolationloss of fatherstagetied uprecord playerropefalling down stairshypodermic needlegothicpatientservanttorchhaircutthunderjob interviewnew orleans louisianaheadphonesrowboatswampsuperstitionatticrainstormvoodooblack magicmusic banddrugged drinkgardeningparalysisgatelouisianaelderlycanoelizardlaundromatno title at beginningponytailparamedicstrokefall from heightbusiness cardpotionnursing homenoosehouse partydumpsterritesymbolpigtailslynchinglockhatchetphonographsecret roomamerican southvolkswagen beetledustbedriddenphonograph recordshackstreetcarbayouspiked drinkinvalidpeacocksouthern gothicchalkbraidscandlelight dinnerhospicesoul transferenceincantationbedsheetvictim invited to dinnerconjurerwant addouble barrel shotgunparalyzedskeleton keyhoodoogumbo (See All) |
On December 28th, 1999, the citizens of New York City are getting ready for the turn of the millennium. However, the Devil decides to crash the party by coming to the city, inhabiting a man's body, and searching for his chosen bride, a 20-year-old woman named Christine York. If he bears her child be …tween 11:00 PM and midnight on New Year's Eve, the world will end, and the only hope lies within an atheist ex-cop named Jericho Cane, who no longer believes in God because of the murder of his wife and daughter. (Read More)
| Subgenre: | suspense |
| Themes: | murdertortureheroredemptionfaithhome invasionself sacrificedevilmurder of a police officer |
| Mood: | goreneo noirnightmare |
| Locations: | hospitalnew york cityrestauranttrainchurchhelicoptercemeterybathtubrooftop |
| Characters: | daughterpolicenursepriesttough guyaction herochristianitypsychiatristbiblecatholicdeath of hero |
| Period: | 1990s1970syear 1999year 1979 |
| Story: | satanic ritualwifeoccultdemonsexfemale nuditybloodviolencethreesomeflashbackkisstitle spoken by characterchasepistol …fireshootoutbeatingshot to deathblood splatterfistfighturinationshot in the headcatswordgunfightbrawlfalling from heightshowdownhand to hand combatshot in the backgood versus evilambushthroat slittingimpalementsuicide attemptsubwaysnakeexploding carnunone man armyshot in the foreheadattempted murderone against manyperson on firemissionpossessionchristmas treebodyguardchildbirthexploding bodysemiautomatic pistolsevered armshot in the armdismembermentchild murderloss of friendexploding buildingloss of wifenew year's eveend of the worldback from the deadwoman in jeopardyvisionreference to satandeath of protagonistbulletproof vestbody landing on a carrefrigeratordemonic possessionsevered legburned to deathfemale detectivegrenade launchermain character diesatheistcrucifixionpopeex coploss of daughtertemptationglocksatanismscene of the crimesaving the worldsole black character dies clichedirector also cinematographergropinghobopool of bloodchosen onelifting person in airman with no namedeal with the devilchrysler building manhattan new york cityprotectionshoulder holsterdoomhit by a trainluciferempire state building manhattan new york citysevered tonguedevil worshipmorphingtrain crashmillenniumstigmatadead body in a bathtubhand through headhit squadnumber 666 (See All) |
In New York, the former NYPD detective Ben Carson is hired to work as night watch of the remains of the Mayflower Department Store that was partially destroyed by fire many years ago. Ben became alcoholic and was retired from the police force after killing a man in a shooting. His marriage was also …destroyed and now he is living in the apartment of his younger sister Angie. However he has not been drinking for three months and sees the employment as a chance to rebuild his life. When he goes to the rounds in his first night, he finds that the mirrors are impeccably clean and his colleague explains that the former night watch was obsessed with the mirrors. After a couple of nights, Ben sees weird images in the mirrors, but due to the lack of credibility of his past, his ex-wife Amy believes he has hallucinations as a side effect of his medication. When Angie is found brutally murdered in her bathtub, Ben discovers that there is an evil force in the mirror that is chasing him and jeopardizing his family. (Read More)
| Subgenre: | supernatural horror |
| Themes: | evildeathsuicidemarriageghostfearangersupernatural powerguiltinsanitygriefalcoholismmurder of a police officer |
| Mood: | gorehorror movie remake |
| Locations: | hospitalnew york citybarbathtubrural settingpolice carpennsylvania |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipgirlpolice officerlittle girlsecurity guardpsychiatristtalking to oneself in a mirrorghost in a mirror |
| Story: | wifemutilationkillingmassacredemonshootingfemale nuditybloodone word titleflashbackfemale rear nudityphotographtitle spoken by characterexplosionknife …chasesurprise endingpistolfirecorpseblood splattercar accidentmirrorremakewatching tvcameravomitingheld at gunpointbirthdayhallucinationprayerflashlightambulancethroat slittingimpalementtied to a chairsubwayapologynunchild in perildrowningbartenderlocker roomperson on firepossessionbasementratgraffitinewspaper headlineburned alivecoplooking at oneself in a mirrortied to a bedmorguebuttockshomecrying manschizophreniacrushed to deathmental institutionwhiskeypillsgash in the facemental hospitalscissorsmedicationdeath of protagonistbathingautopsydeath of sisteralternate realitymarital separationdemonic possessionalarm clocksirennewspaper clippingnannyman cryingdoppelgangerabandoned buildingclosetex cophiding in a closetmonasterybandagesubway stationremorsephysicianconventbroken mirrorburnt faceinterracial marriageglassscene of the crimepsychiatric hospitalvideo footageinterracial coupledeath of familystatue of libertycut handmurder of a nude womanpool hallimmolationbreaking a mirrorhousemaidcityscapenypdnight watchmanbreaking down a doorblond hairexposed breastcprfire enginevideo recordingdummyscreaming in painstartledestranged coupleinterracial loveestranged wifeevil forcethrown through a wallsprinkler systemglass shardmirror does not reflect realityfather child relationshipreflection in waterjaw ripped offremote controlled toy carfaucetestranged husbandhandprintspurting bloodpaint on glasssliced bodychild drowningtrapped underwatermirror as portalpsychiatric treatmentburned out buildingmalevolent entityantisepticpleading for helpremake of korean filmartistic imagery (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | suspensesupernaturalparanormalpsycho thriller |
| Themes: | evilescapedeathmurdersuicidekidnappingmarriagerapeghostprisonfeartorturememorypsychopathsupernatural power …paranoiadrug useinsanitymental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | gorerainneo noirnightmareslasherdarkness |
| Locations: | hospitalswimming poolcarbathtubtaxipolice stationpolice car |
| Characters: | self mutilationfamily relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipdoctortattoofemale protagonistserial killernursepolicemanlawyerreference to god …killersecurity guardvillainpsychiatristsheriffterrordoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | killing spreekillingshootingfightsexfemale nudityf ratedbloodviolencefemale frontal nudityinterviewflashbackbare chested malegunkiss …photographexplosionknifechasesurprise endingpistolshowertelephone callfirecryingcell phonedreamcorpseblood splattercar accidentmirrorshotgunwatching tvcomputerrifletearsrunningcar crashhallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightaxevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrusttherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationpsychorape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarreckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | cult filmpsycho thrillerbody horroramerican horrorindependent horrorsadistic horror |
| Themes: | evildeathmurdertorturepsychopathbrutalitysupernatural powerinsanitysadism |
| Mood: | goreslasherbreaking the fourth wallblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | brother sister relationshipteenage girlteenage boyserial killerkillervillainterrorslasher killermysterious villainserial murderermysterious killer |
| Period: | 1980s |
| Story: | killing spreemutilationkillingmassacresexfemale nuditynumber in titlebloodmale nudityviolencebare breastssequelfemale frontal nuditymasturbationmale rear nudity …female rear nuditysurprise endingpantiescorpseunderwearblood splattermasklow budget filmsubjective cameradecapitationstrangulationimpalementstabbed to deathsevered headchild in perillooking at the cameraskinny dippingstabbed in the backcharacter's point of view camera shotevil manstalkingpremarital sexmurderercabinloss of motherobscene finger gesturemaniacsexual attractionlifting someone into the airragemorguefourth partpsychogrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckbutcherstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onemasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstersummer camphomicidal maniacslashingshot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainknife murderbloody violencedeformitylunaticsadistic psychopathmurder of a nude womanmurder spreevillain not really dead clichedisturbed individualbutcherygrindhouse filmcrime spreedeeply disturbed personpsycho terrordisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
In Baton Rouge, Louisiana, the evangelical Reverend Cotton Marcus was raised by his father to be a preacher. He agrees that the filmmaker Iris Reisen and the cameraman Daniel Moskowitz make a documentary about his life. Cotton tells that when his wife Shanna Marcus had troubles in the delivery of th …eir son Justin, he prioritized the doctor help to God and since then he questions his faith. Further, he tells that exorcisms are frauds but the results are good for the believers because they believe it is true. When Cotton is summoned by the farmer Louis Sweetzer to perform an exorcism in his daughter Nell, Cotton sees the chance to prove to the documentary crew what he has just told. They head to Ivanwood and they have a hostile reception from Louis's son Caleb. Cotton performs the exorcism in Nell, exposing his tricks to the camera, but sooner they learn that the dysfunctional Sweetzer family has serious problems. (Read More)
| Subgenre: | cult filmmockumentaryfound footagedocumentary filmmaking |
| Themes: | deathmurderreligionpregnancyfeardeceptiondeath of motherdeath of wife |
| Mood: | gorerain |
| Locations: | hospitalchurchhotelrural settingfarmroad triptruck |
| Characters: | self mutilationdaughterhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipbrother sister relationshipbiblegay teenagerpregnant teenagerevil priest |
| Story: | satanic ritualwifedemonbloodinterviewphotographknifesurprise endingfirecatlettervomitingheld at gunpointbedcafe …subjective cameradecapitationgood versus evilfoot chasebound and gaggedcandleaxethroat slittingmodeldrivingno opening creditsdrawingchild in perilvantalking to the cameragravecharacter repeating someone else's dialoguebeaten to deathwidowerdollactor shares first name with characterthreatsuspicioncharacter says i love youblindfolddismembermentanswering machinekilling an animallooking at oneself in a mirrorbarncrucifixfraudcovered in bloodpreacherbootscynicismgash in the facehandheld camerapastordemonic possessionexorcismnewspaper clippinglyingblood on camera lensteenage pregnancymagic tricklouisianadead animalflutehuman sacrificesouthern u.s.farmhouseno title at beginningdouble barreled shotgunstethoscopelatinreverenddead catpentagramlocked in a roomcut handscythefetusdocumentary crewexorcistcard trickdocumentary filmmakershacklesbroken fingersatanic cultoverprotective fatherloss of faithhearing aidsouthern gothickilling a catcrisis of faithhome schoolinglivestockboiling waterfarm liferecorderno background scorechained to a bedrare bookbaton rouge louisianaqueen of heartssecret pregnancyquestioning beliefs (See All) |
A woman goes on vacation with her friends after her husband and daughter encounter a tragic accident. One year later she goes hiking with her friends and they get trapped in the cave. With a lack of supply, they struggle to survive and they meet strange blood thirsty creatures.
| Subgenre: | cult filmcreature featuresurvival horrorbritish horror |
| Themes: | escapedeathmurderfriendshiprevengeinfidelitybetrayalghostdrinkingfearmonsterbrutalityguiltgriefpanic …cannibalismblindnessmurder of familyclaustrophobia (See All) |
| Mood: | gorenightmare |
| Locations: | hospitalforestcarwoodscavecave in |
| Characters: | daughterhusband wife relationshipfriendfemale protagonistbest friendlittle girl |
| Story: | killing spreehusbandsmokingf ratedbloodviolencetwo word titlephotographknifesurprise endingcryingbeatingcorpseblood splattercar accident …blondefalling from heightbookvomitingliehallucinationsurvivalflashlightmountainvideo cameradeath of friendwomanthroat slittingimpalementstabbed in the chestunderwater scenecreaturenecklacebeaten to deathdolldarkisolationneck breakingfirst partunderwatercabinwaterfallcult directortrustbirthday cakeropehuggingfireplacewhat happened to epiloguebeer drinkingsurvivorlifting someone into the airgroup of friendsvictimskullcheating husbanddriving a cartorchbroken legearthquakeeaten alivefight to the deathstabbed in the neckstabbed in the headstabbed in the legaccidental killinghandheld cameraeye gougingstabbed in the eyeloss of husbandblood on camera lenssuffocationexpeditiondead animalfemale bondingmeateuthanasiafriendship between womenloss of daughterfalling into waterflarecabin in the woodsmercy killingbitten in the neckhallwaygoblinpondbmwdistrustcavemanloss of familyforddustaerial photographycult figurehospital gownhumanoidboneslifting a female into the airinfra redlicense platecave paintingdisgustcarcasshorseshoemountain cabinwhite water raftingnikon cameraglow stickspelunkingappalachian mountainshead on collisionclaustrophobic settingvictim fights backgroup photostalactitecavingford broncoboneyardlogging truckcult female characterphosphorescence (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | suspenseindependent filmcult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
| Themes: | evildeathmurderrevengesuicidekidnappingghostfeartorturedrunkennesspsychopathdeath of fatherbrutalitysupernatural powerdeath of mother …insanityabductiontraumafear of water (See All) |
| Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
| Locations: | forestcemeterysmall townpolice stationlakeschool nurse |
| Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain …serial murderer (See All) |
| Period: | 2000s |
| Story: | killing spreesatanicmutilationkillingdemoncharacter name in titlebloodviolencesequelflashbackphotographexplosionpartysurprise endingpistol …showerfirevoice over narrationdreamcorpseblood splatterslow motion scenebrawlfalling from heightmaskcar crashdecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragepsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamcamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | suspensecult filmb horrorpsycho thrilleramerican horrorindependent horror |
| Themes: | evildeathmurderfearpsychopathbrutalityinsanityexploitation |
| Mood: | goreslasherdarkness |
| Locations: | woodswheelchairpolice carlakecampfirebackwoodsrunning through the woodschase in the woods |
| Characters: | teenagerboyfriend girlfriend relationshipserial killerkillervillainterrorslasher killermysterious villainserial murderermysterious killer |
| Period: | 1980ssummeryear 1984 |
| Story: | killing spreemutilationkillingmassacrefightsexfemale nuditynumber in titlebloodviolencesequelfemale frontal nudityflashbackkiss …nipplessurprise endingpantiestelephone callcorpsedigit in titleblood splatterblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelsubjective cameraswimmingdecapitationbrastrangulationthroat slittingimpalementjokesevered headcontroversyskinny dippingstalkerprologuecharacter's point of view camera shotevil manopening action sceneconvertiblestalkingmurdererobscene finger gesturelove interestkissing while having sexsplatterchessmaniacchainsawfireplacespearnipples visible through clothingmass murdergothicmachetelifting someone into the airragevillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchbutcherpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onepsychoticmasked killerpsycho killernude swimmingserial murderpsychopathic killerbad guycar troublemadmanmysterious manreturning character killed offhuman monstersummer campfreakskirtsexual violencehomicidal maniacslashingwetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainknife murderpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedying during sexvillain not really dead clichebutcherygrindhouse filmcrime spreecreepkilled during sexmystery killershackmultiple homicidepsycho terrorweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classiceast coasthorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
| Subgenre: | supernaturalamerican horror |
| Themes: | childhoodevildeathmurderfearmonstermemoryracismpsychopathbrutalitysupernatural powersadismbullyingabductionhomophobia …crueltycannibalismmadnessmissing childunlikely friendshipschool bullyingsupernatural powers (See All) |
| Mood: | gore |
| Locations: | schoolforestsmall townbicyclesewernew boy in town |
| Characters: | policeteenagerchildrenzombieserial killerbullylittle boyvillainjewchildhood friendbar mitzvahboy in underwearevil father |
| Period: | 1980ssummeryear 1989year 1988 |
| Story: | killing spreemutilationkillingdemonbased on novelbloodviolenceone word titleflashbackkisstitle spoken by characterblood splattercatbattlepainting …bookbathroompianogay slurnewspaperchild abusechildcoffinchild in perilcreaturelibraryclownmissing persondeath of brotherbasementbrothermurdererfirst partsevered armgaragesplattermaniacsistereyeglassesballoonstreetsexual abuseoverallspsychocovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatbutcherpedophilemurder of a childturtleabusive fatherbroken armcellarloss of brotherpsycho killerheroismunderdogpervertspittingpsychopathic killerbad guygirl in bra and pantiesoutcastwoodabandoned housebicyclinghomicidal maniacwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringbloody violenceteenage girl in underwearpool of bloodreference to michael jacksonoverbearing mothersadistic psychopathold houseghoulglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererdisturbinghypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
| Subgenre: | suspenseindependent filmmartial artscult filmblack comedysupernaturalparanormalamerican horror |
| Themes: | evilmurderrevengefuneralpsychopathsupernatural power |
| Mood: | gorerainhigh schoolnightmareslasher |
| Locations: | hospitalbeachcemeterysmall townelevatorschool nurseblood in water |
| Characters: | father son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitresskillervillainterrorslasher killerserial murderer |
| Period: | 1980s |
| Story: | killing spreemutilationkillingdemonnumber in titlebloodsequelfemale frontal nuditydogbare chested malecigarette smokingphotographsurprise endingfiredream …corpsedigit in titleblood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequelambulancedeath of friendstabbed to deathdinerstabbed in the chestsevered headcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingundeadpizzamaniacsurgeryteen angstelectronic music scoreslow motionwoman with glasseslifting someone into the airstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionbutcherstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armpsycho killerserial murdervillain played by lead actorpsychopathic killerbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spirithomicidal maniacbugweightliftingclimbing through a windowfish tankslashingbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimmurder spreetime loopbutcheryplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
| Themes: | evildeathmurderghostfuneralmonsterpsychopathsupernatural powerinsanitysadism |
| Mood: | gorenightmareslasher |
| Locations: | barchurchcemeteryschool boy |
| Characters: | self mutilationfather daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlsingle motherkillervillainterrorslasher killeralcoholic father …serial murdererevil nurse (See All) |
| Period: | 1980s |
| Story: | killing spreechantingkillingdemonfemale nuditynumber in titleviolencesequelbondagebare chested malecigarette smokingsurprise endingfiredream …corpsedigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | suspenseindependent filmcult filmblack comedytragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror |
| Themes: | evilescapedeathmurderfriendshipkidnappingfeartorturepsychopathbrutalityparanoiadysfunctional familyinsanitysadismexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | avant gardeslasherdarknessambiguous ending |
| Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
| Characters: | self mutilationfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillervillainterrortruck driverslasher killer …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | killing spreemutilationkillingmassacrebloodviolencephotographknifechasesurprise endingvoice over narrationbeatingcorpseblood splatterurination …blondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushdeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
Popular college student Laura (Alycia Debnam-Carey) has tons of friends, both on Facebook and IRL. She graciously accepts social outcast Marina's (Liesl Ahlers) online friend request, until Marina crosses the line and Laura unfriends her. To everyone's shock, Marina takes her own life in a ritual me …ant to torment Laura, which appears in a video posted on Laura's profile. Even though it wasn't Laura who posted the video, or other creepy content that begins appearing on her page, her Facebook friend count begins to dwindle as a result. When her real-life friends start dying mysterious, cruel deaths, Laura must figure out how to break the deadly curse before it's too late. (Read More)
| Subgenre: | videoparanormal |
| Themes: | deathfriendshiprevengesuicidebetrayalghostfearfunerallonelinesssupernatural powerbullyingunrequited lovepanicpolice investigationrape and revenge …end of friendship (See All) |
| Mood: | mysterious |
| Locations: | hospitalforestelevator |
| Characters: | daughtermother daughter relationshipfriendfemale protagonistmotherwitchgirlfriendself immolationex friend |
| Story: | witchcraftoccultritualdemongunknifemirrorcomputerbirthdaycollegestabbingstabbed to deathinternethit by a carbirthday party …cursecollege studenthangingbasementhauntingspiritloyaltyjoggingstabbed in the stomachorphanagestabbed in the neckone dayboyfriendlonerpsychoticlaptop computerreference to facebookcafeteriasocial mediafacebooksocialhoodiepsychotronic filmhouse fireyoung adultmental disordercreepycollege lifesocial networksocial outcastwaspgeneration yvengeful ghostmillennialvisualhorror filmdistortiontaggingshooting oneself in the headdormcross necklaceinternet addictionpulling hair outwasp nestshooting oneselflearning to walk (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | tragedypsycho thrillerslasher flickamerican horror |
| Themes: | evildeathmurdersuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | goreslasherdarknessblood and gore |
| Locations: | small townstrip club |
| Characters: | teenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillervillainpsychiatristsheriffterrorslasher killerserial murderer |
| Period: | 1970s |
| Story: | killing spreesatanickillingmassacresexfemale nuditybloodmale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknife …chasepistolwoman on topbeatingcorpseblood splatterremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationstabbingthroat slittingimpalementstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanityteenage sexblood spattersplattermaniackilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbody countbroken armduct tapecharacters killed one by onepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
| Subgenre: | suspensemartial artscult filmcoming of ageblack comedysupernaturalheist |
| Themes: | evilescapedeathmurderfriendshiprevengesurrealismsuicidekidnappingbetrayalfeardeceptionseductionrobberydeath of father …supernatural powerparanoiasurveillancehome invasionpanic (See All) |
| Mood: | gorenightmare |
| Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
| Characters: | daughterfather daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholic …catholic priest (See All) |
| Period: | 2000s |
| Story: | killing spreemassacrefightsexcharacter name in titlenumber in titlebloodviolenceflashbackbare chested malegunphotographexplosionpartyknife …lesbian kisschasesurprise endingpistoldreamcorpseshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationdisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the …y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)
| Subgenre: | independent filmcult filmparanormalcreature featureamerican horror |
| Themes: | evilescapedeathmurderrevengeghostfearmonstersupernatural power |
| Mood: | darkness |
| Locations: | barbeachchurchsmall townwaterrural settingseashipcampfirefishing boatghost ship |
| Characters: | mother son relationshipchildrenboyzombiepriestsingle motherlittle boyvillainsheriffterroremployer employee relationshipcatholic priestmysterious villain |
| Period: | 1980s1970syear 1979 |
| Story: | killing spreemutilationkillingdemonbloodviolencetwo word titleknifechasesurprise endingcorpsesworddead bodydecapitationcalifornia …stabbingwomanimpalementstabbed to deathchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorundeadrecord playerpirategoldelectronic music scoremass murdergothictape recorderlifting someone into the airstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagebutcherpsychotronicautopsyfogeye gougingslaughterpierdark pastlighthousedjbad guymysterious manliving deadspiral staircasejournalevil spiritblackoutslashingradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulbutcherygrindhouse filmhookradio broadcasttragic villainmistphonograph recorddockscreepydisturbingmusic score composed by directorstained glass windowdemonicremadedrive in classicbayhorror movie remadefemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | suspenseindependent filmb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
| Themes: | evildeathmurderfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadism …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | gorenightmarecar chasenightslasherdarknessblood and gore |
| Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend …killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
| Story: | killing spreemutilationkillingmassacreshootingfemale nudityf ratedbloodviolencebare breastsfemale frontal nudityflashbackmasturbation …dogguncigarette smokingphotographknifelesbian kisschasesurprise endingshowertelephone calldreamcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxestabbingthroat slittingimpalementstabbed in the chesthousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropeblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by oneparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | conspiracysuspensemartial artsblack comedydystopiasurvival horrorpolitical conspiracy |
| Themes: | escapedeathmurderfriendshiprevengekidnappingbetrayalpoliticsfeardeceptioncorruptionpsychopathbrutalityparanoiainsanity …sadismsurveillancehome invasionexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
| Mood: | gorenightslasher |
| Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
| Characters: | self mutilationafrican americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifle |
| Period: | near future |
| Story: | ritualmassacrefightbloodviolencesequelflashbackbare chested malephotographexplosionknifechasepistolfirecell phone …shootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorswordgunfightbrawlshowdownrifleheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf worddecapitationsurvivalflashlightbound and gaggedgangambushaxeambulancedeath of friendmontagestabbed to deathmixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapsevered headman with glassesno opening creditsanti herodisarming someoneone man armyhit by a carvanthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeevil manknocked outkicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47chainsawhand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
| Subgenre: | independent filmcult filmamerican horrorsadistic horror |
| Themes: | evilescapedeathmurderrevengesuicidekidnappingrapetortureinvestigationvoyeurismseductionpsychopathbrutalityinsanity …humiliationsadismabductioncrueltyvengeancemadnessrape and revengerape and murder (See All) |
| Mood: | gorehigh schoolnightmareslasher |
| Locations: | swimming poolforestcemeterylakerunning through the woods |
| Characters: | daughterfamily relationshipsfather son relationshippoliceteenage girlserial killerreference to godkillervillainsheriffterrorslasher killerserial murdererself justice |
| Period: | 1970s |
| Story: | husbandmutilationkillingshootingfightfemale nuditybloodviolencefemale frontal nuditydoggunfemale rear nudity …female full frontal nudityknifepantiesshowershot to deathblood splatterurinationremakebeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertstabbingthroat slittingstabbed to deathtoiletfemale pubic hairwhite pantiesscantily clad femalebathcontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringconvertiblefemale removes her clothesmurdererchickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralessmaniacchainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamgrindhousevictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultfemale in showerbloodbathshot multiple timesdead girlpervertserial murderpsychopathic killerprayingbad guymadmancannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual perversionsexual violencehomicidal maniacelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | conspiracysuspensecult filmblack comedypost modernslasher flickteen movieteen horrorhorror spoof |
| Themes: | escapedeathmurderloverevengebetrayalfeardrunkennessinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism …theatremurder of a police officernear death experience (See All) |
| Mood: | goresatireslasher |
| Locations: | hospitalbicyclepolice stationpolice carfire truck |
| Characters: | policeteenagerboyfriend girlfriend relationshipfemale protagonistpolice officerserial killerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential |
| Period: | 1990s |
| Story: | killing spreekillingf ratednumber in titlebloodviolencesequelinterviewbare chested malekisscigarette smokingsingingpartyknifechase …surprise endingpistolcell phonebeatingcorpsedigit in titleshot to deathblood splattercar accidentshot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlmaskshowdownheld at gunpointsunglassessecond partcar crashcollegehallucinationvoyeurtelevisiontelephonef wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo cameraambulancestabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplaycharacters killed one by oneethnic slursequel to cult favoritemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All) |
A new girl moves to a new city with her family to start a new life. She meets up with the girls who are very interested in the occult and together, the four of them have a seemingly unstopable power. They can do anything, from getting thier dream guys to like them to... the possibilities are limitle …ss. (Read More)
| Subgenre: | cult filmcoming of ageblack comedyteen movie |
| Themes: | murderfriendshiprevengesurrealismsuicidedeceptionmagicracismsupernatural powerinsanitybook of magic |
| Mood: | high schoolnightmare |
| Locations: | beachchurchswimming poolairplanelos angeles californiabustaxiairportwoodslaboratory |
| Characters: | self mutilationfather daughter relationshipteenagerfemale protagonistlawyerbest friendbullywitchsingle fatherhomeless manstepmother stepdaughter relationshipevil witch |
| Period: | 1990s |
| Story: | spellwitchcraftoccultflashbackphotographexplosionpartyknifeshowerfiremirrorhallucinationcandlemansion …snakehit by a carnews reportracial slurspiritualitylightningattempted rapehigh school studentdeath of husbandheart attackfemale stockinged legsteen angstheavy rainoverallsmental institutionvisionfemale leadbutterflyblack magictelekinesisfemale stockinged feetgothlevitationoutcastfemale bondingjukeboxbully comeuppancesatanismwrist slittingcrashing through a windowjockkarmamaggotgoth girlpower strugglewish fulfillmentcliquesockscovenlife insurancehair lossslandervirtualitymirror does not reflect realityreference to pubic hairteenage witchhereditary gift of witchcraftfrench languageprep schoolmirror as portalwhite socksdriven madluxury apartmentlove spellfemale feet in socksinjection in buttwhite magic (See All) |
John Form has found the perfect gift for his expectant wife, Mia - a beautiful, rare vintage doll in a pure white wedding dress. But Mia's delight with Annabelle doesn't last long. On one horrific night, their home is invaded by members of a satanic cult, who violently attack the couple. Spilled blo …od and terror are not all they leave behind. The cultists have conjured an entity so malevolent that nothing they did will compare to the sinister conduit to the damned that is now... Annabelle. (Read More)
| Subgenre: | ghost storyparanormal activity |
| Themes: | evildeathmurderfriendshipsuicidereligionghostpregnancyweddinginvestigationpsychopathsupernatural powerhome invasioncrueltytrauma …self sacrificedevilpolice investigationnear death experience (See All) |
| Mood: | nightdarknessmoving |
| Locations: | hospitalchurchelevatorkitchenapartmentcatholic churchkitchen knifekitchen fire |
| Characters: | husband wife relationshippoliceafrican americanfrienddoctorfemale protagonistnursedetectivepolicemanbabypriestchristianreference to godlittle girlkiller …christianitypolice detectivecatholicterrorpregnant womanpregnantneighbor neighbor relationshipreligious fanaticcrying babybaby girlsuicide by jumping (See All) |
| Period: | 1970syear 1969year 1970 |
| Story: | satanicwifeoccultritualdemonshootingfightf ratedcharacter name in titlebloodviolenceone word titleflashbackphotographtitle spoken by character …knifechasebased on true storytelephone callfirecryingshot to deathblood splattershot in the chestslow motion scenepunched in the facewatching tvcamerabookneighborhallucinationreference to jesus christgood versus evilfoot chaseflashlightname in titlestabbingthroat slittingsuicide attemptnonlinear timelinecultnunno opening creditsdrawingchild in perilnews reporton the rungunshotflash forwardcharacter repeating someone else's dialoguepuppetattackpossessiondollbaseball batscreamscargiftbasementhaunted housesacrificegraffitiblood spattercouplerecord playerspiritdresslistening to musicspin offstabbed in the stomachtoycrying womanvisithometaking a picturefalling to deathreference to satanblack and white scenethunderstormbookstoresoulwedding dressbarefoot femaledemonic possessionblack magicneighborhoodtelekinesisprequelshot multiple timesbeing followedsermontaking a photographforename as titleapparitionhiding in a closetsuit and tiepopcornblood stainhospital roomhearing voicesfilm starts with textlistening to radiofall from heightlocked doorafrican american womanmedical studentreading a booksewing machinesole black character dies clichecrying femaleflametraffic accidentmysterious womanbechdel test passedsymboltraumatic experiencereference to john waynepsychotronic filmdeath by gunshotlocked in a roomhouse firescreaming womanframed photographvinylends with textrocking chairreference to sigmund freudfemale name in titlemoving outflickering lightstabbed multiple timespassive aggressive behaviorevil dollpassive aggressive womanfall to deathlocked inchild's drawingoxygen maskdeath by shootingbaby carriagesatanic cultbiblical referenceblood on handsnurserytoy comes to lifehorror iconreference to charles mansonscratchstab woundwatching someone sleepkiller dollprivate investigationblack and white sequencejump scareshop ownermysterious eventcrayonflamestalking to godjumping from a windowpasadena californiasanta monica californiabusiness suitstabstoragehorror movie prequelpolice investigatorviolent manbook storelocking a doorovercoming fearviolent womananimate dollcult memberdemonic spiritcrying for helpjesus christ quotationopening creditsremembering the pastfinger injurybook as a giftcreepy dollreference to deviltalking to a dollblood on armdrinking coffeeemergency callpossessed dollwhite weddingbig knifegood verses evilsecond hand bookshopshared universethumb wrestling (See All) |
True-crime writer Ellison Oswalt moves himself and his family into a house where a horrific crime took place earlier, but his family doesn't know. He begins researching the crime so that he can write a new book about it to help his flailing career. He uses some "snuff" film footage he finds in the h …ouse to help him in his research, but he soon finds more than he bargained for. There is a figure in each of the films but who or what is it? As a result, his family start to suffer (as does he) and things take a turn for the worse. Will they survive? (Read More)
| Subgenre: | supernaturaltragedyfound footagesupernatural horror |
| Themes: | evildeathmurderghostfearinvestigationobsessionsupernatural powerpanicwritingmurder of familymissing childnovel writing |
| Mood: | nightdarkness |
| Locations: | swimming poolsmall townpennsylvaniacar fire |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipwritersheriffterror |
| Story: | dark secretoccultkillingmassacrealcoholbloodviolencedogcigarette smokingphotographknifecell phoneblood splatterwritten by directorpainting …bookbedroombound and gaggedthroat slittinghousetied to a chairmapsnakeman with glassesdrawingchild in perildrowningcoffeetreeargumentdeath of childbaseball bathangingdisappearancelaptopfirst partchild murderburned aliverevelationtied to a bedwatching a moviepoolhomeduct tape over mouthwhiskeyresearchpower outagenovelistatticfamily dinnerlens flareaxe murderboxdrugged drinkbag over headtrue crimewebcamfilm projectordeputyscorpionpatricideheld captivebloody body of childsnuff filmcollege professorvhshanged manmoving inbackyardkiller childcar set on firefilmed killingmultiple murdermatricideknife murdersuper 8tapegrindhouse filmsleepwalkingsleeping on a couchfratricidesinisterfalling through the floormystery killernew housemovie projectorsuper 8mmst. louis missourighost childfilm reelhanged womangooglesingle locationnew homefoaming at the mouthsacramento californiafilm editingorange county california8mm filmhanged childpov shotkilled with a lawnmowernight terrorsax murdershushing someonecrime novelist (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | evilescapedeathmurderfriendshiprevengesurrealismkidnappingghostfearmonstervoyeurismpsychopathbrutalitysupernatural power …paranoiasadismpanicmysterious deathshower murder (See All) |
| Mood: | gorerainhigh schoolnightmareslasherdarknesspoetic justice |
| Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | self mutilationfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boy …teachergirlserial killerstudentpolicemanlittle girlkillervillainterrordriverslasher killerserial murderergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | killing spreemutilationmassacredemonnudityfightcharacter name in titlenumber in titlebloodmale nudityviolencesequelmale rear nuditybondagedog …bare chested malecigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequelhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellaralarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
In the small village Goksung in South Korea, police officer Jong-Goo investigates bizarre murders caused by a mysterious disease. His partner tells a gossip for him that a Japanese stranger that lives in a secluded house in the mountains would be an evil spirit responsible for the illness. Jong-Goo …decides to visit the Japanese with his partner and a young priest that speaks Japanese. They find an altar with a goat head and pictures of the infected people that died on the walls. However they are attacked by the guard dog and they only can leave the place when the stranger arrives. Jong-Goo finds one shoe of his beloved daughter Hyo-jin in the house of the stranger and soon she becomes sick. His mother-in-law summons the shaman Il-gwang to save her granddaughter while a mysterious woman tells Jong-Goo that the stranger is the responsible. Who might be the demon that is bringing sickness to Goksung? (Read More)
| Subgenre: | supernaturalfolk horror |
| Themes: | evildeathmurderrapeghostinvestigationsupernatural power |
| Mood: | nightmare |
| Locations: | hospitalrestaurantsmall townvillagerural settingpolice stationpolice cargas stationsex in carsex in a carfire truck |
| Characters: | officerdaughterhusband wife relationshippolicefather daughter relationshipteenagermother daughter relationshipdoctorteenage girlzombiepolice officerpolicemanpriestlittle girljapanese |
| Story: | ritualdemonmale nudityone word titleflashbackdogtwo word titlesex scenecigarette smokingphotographknifewritten by directorvomitingdead bodyold man …white pantiesdream sequencedrawinghit by a carcursepossessionnosebleedstrangerdead womanfull moonwatching televisionpower outagescissorsthunderstormfat manexorcismlocation in titledead dogserial murderbarking dogdead animalkilling a dogblood stainrumorshoeshamanbaseball capsouth korearainingreading a newspaperdead birddead wifeshrinepsychotronic filmdog attackhouse on firestabbed with scissorswhite coatpolice partnerrearview mirrorrestaurant ownerchild's drawinghaving sex with skirt hiked uppolice protagoniststruck by lightningacupuncturemotorcycle helmethanged womanpolice badgegluttonybiblical quotewashing clothesbloody handjapanese mandriving in the raindead deerscreaming girlwashing a carpower cutfishing rodsleeping on the floorpolice uniformrashwalking in the woodspolice taperolling down a hillphotograph on wallattacked by a dogattacked by dogsleeping on the groundstone throwingthrowing stonesdivinationkorean womanblack dogcross necklacehanging from a treehouse in the woodsbreaking a lockhitting one's head on a rocktest resultthrowing a stonebiblical quotationhearing parents have sexreference to religionsoy sauceburned out housecorner storemysterious figurepouring rainsick girlsouth koreanthrowing rockskorean girlkorean manneck scarremote housescreaming child (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | evildeathmurderrevengesuiciderapetorturepsychopathinsanitycannibalismrape and revenge |
| Mood: | goreslasher |
| Locations: | desertwaternew mexico |
| Characters: | serial killervillainterrorslasher killer |
| Period: | year 2007 |
| Story: | killing spreesoldiersnudityfightfemale nuditybare breastssequelexplosionsurprise endingpistolfirelickingcorpseshot to deathblood splatter …shot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurstabbingarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplattermaniacropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countaxe murdernude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
| Subgenre: | independent filmcult filmb movievideoamerican horrorsadistic horrorhorror b movie |
| Themes: | evildeathmurderrevengekidnappingrapefeartorturevoyeurismseductionangerpsychopathbrutalityhumiliationsadism …exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
| Mood: | goreslasher |
| Locations: | new york citychurchforestcarsmall townbathtubbicyclewaterlakegas stationcountry |
| Characters: | female protagonistgirlserial killerwriterkillerlustvillainserial murdererself justicesex with a stranger |
| Period: | 1970s |
| Story: | killing spreemutilationkillingsmokingalcoholfemale nuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditybare chested malegun …female rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmvoyeurmale pubic hairrivertelephonecleavagenewspapergangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manygraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurderercabinhandgunvigilanterecord playereyeglassesclaim in titlenipples visible through clothinginjurysexual abuseragedesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdeath threatdark herosexploitationpanties pulled downgang rapeperversioncastrationbody countaxe murderbruisecharacters killed one by onemisogynypsycho killerwoman in bathtubpervertserial murderpsychopathic killerkillviolence against womenvigilantismmisogynisthuman monstercanoefemale removes her dressmental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armymurder spreeviolent deathdelivery boygrindhouse filmnoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
| Themes: | evildeathmurderrevengefearpsychopathbrutalityinsanitysadismexploitationpolice investigation |
| Mood: | gorerainnightmarenightslasherdarkness |
| Locations: | cemeterysmall townwoodsamericabackwoods |
| Characters: | policemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
| Period: | 1980s |
| Story: | killing spreemutilationkillingmassacresexfemale nuditynumber in titlebloodviolencebare breastssequelfemale frontal nuditykissdancingchase …surprise endingpantiesdigit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyebody countaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum …mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
| Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
| Themes: | escapedeathmurdersurrealismkidnappingbetrayalmagicdeath of fathersupernatural powerdeath of motherabductionfalling in lovemissing child |
| Mood: | gore |
| Locations: | forestsmall towndesertvillagewoodscity |
| Characters: | policebrother sister relationshiphostagetough guyaction herovillainsniperwitchsheriffmayorsniper rifleself inflicted gunshot woundevil witch |
| Story: | spellwitchcraftritualmassacrenudityfightfemale nuditycharacter name in titlebloodviolenceflashbackbare chested malegunfemale rear nudityphotograph …explosionknifechasepistolfirevoice over narrationpunctuation in titlebeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownrifleheld at gunpointhand to hand combatinterrogationcombatshot in the backf worddecapitationgood versus evilcleavageorphanassassinsword fightambushaxestabbingimpalementstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timeknocked outtough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassintaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
Jeff is an anguished man, who grieves and misses his young son that was killed by a driver in a car accident. He has become obsessed for revenge against the man and reckless with his wife and daughter. When Dr. Lynn Denlon, who has troubles with her marriage, is abducted by the deranged Jigsaw's app …rentice Amanda, she is brought to a gruesome warehouse to keep John Kramer alive in spite of having a terminal brain tumor. Amanda puts a necklace gadget full of explosives around Dr. Lynn's neck connected to John Kramer's life support system, and tells her that if he dies the device will explode. Meanwhile, Jeff is submitted to a sick game of forgiveness with surprising dark consequences. (Read More)
| Subgenre: | survival horrorsadistic horror |
| Themes: | deathmurderrevengekidnappinginfidelitybetrayaltortureextramarital affairpsychopathbrutalitysadismhome invasionmurder of a police officer |
| Mood: | gore |
| Locations: | hospital |
| Characters: | self mutilationdaughterpoliceafrican americandoctorserial killernursedetectivepolice detectivepolice shootoutsingle father |
| Story: | wifemutilationfightfemale nuditybloodviolencesequelfemale frontal nudityflashbackbare chested malegunfemale full frontal nudityphotographknife …surprise endingpistolshootoutcorpseblood splattercar accidentshot in the chestshot in the headshotgunslow motion scenevomitingheld at gunpointbombrevolvershot in the backdecapitationaxethroat slittingstabbed in the chestnonlinear timelinejudgesevered headchild in perilthird partshot in the legdrowninglatex gloveslocker roomrace against timeevil manexploding bodywitnesstrapsevered armdismembermentsingle parentsurgerychainsawsyringegothiclifting someone into the airloss of wifecaucasianvideotapeswat teambroken legreverse footagegash in the faceshot in the facestabbed in the headexploding headdisembowelmentbooby trapaccidental killingbroken armsevered legchainsequel to cult favoritegothsuffocationreturning character killed offgun in mouthshot in the necktimebombaciddrunk drivingfemale psychopathmind gamescalpelscene of the crimeloss of childshot in the throatfemale copslaughterhousemurder of a nude womansevered footapprenticebroken neckhookbrain tumorno endingstabbed in the footevil dollbrain surgerycriminal mastermindfrozen bodypower drilldummygame of deathentrailshypothermiafreeze to deathmurderer duoexposed braindrill in the headsplit headpig maskplaying godhead spinpig slaughterfamous themesuffocated with plastic bagnecklace bomb (See All) |
Set during the time of the first outbreak of bubonic plague in England, a young monk is tasked with learning the truth about reports of people being brought back to life, a mission that pulls him toward a village ruler who has made a dark pact with evil forces.
| Subgenre: | conspiracysword and sorcerygothic horror |
| Themes: | evildeathrevengereligiontorturedeceptionsadismexecutioncruelty |
| Mood: | gore |
| Locations: | forestvillageengland |
| Characters: | religious nutself flagellation |
| Story: | worshipmassacreviolencetwo word titlesurprise endinghallucinationcolor in titledecapitationsword fightstabbingfalse accusationsevered headpainpoisonevil man …severed armpowerstabbed in the stomachcovered in bloodfaked deathmonkfemale killerback from the deadreincarnationstabbed in the throatfeministswampblack magicbanditmysterious manfake identityplaguefemale psychopathdruggedoffscreen killingstablefemale villainhead cut offevil womanmurderessmiddle agesarm cut offfemale bossstarts with narrationarm ripped offfakeaxe in the headstabbed in the foottorture chamberinquisitionmatriarchbodily dismembermentscreaming in painstabbed in the bellywitch huntburned at the stakecon womanhanged by the neckmatriarchypublic executionfootabbeyfake deathmarshstomach ripped opensword and shield14th centuryheretichanged bodywading in wateriron maidenfemale sociopathnecromancerfoot tortureanimal skullblack deathbubonic plaguedrawn and quarteredpagan ritualanti christianityevil versus evilmatriarchal societyfaking a deathpagan ritualsfakingsycophanthorse drawn cartfemale sadistreligious convictionwoman leader1340smanipulating woman (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
| Themes: | childhoodevildeathmurderrevengefeardeceptionpsychopathsurveillancemurder of a police officer |
| Mood: | goresatireslasher |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | teenage girlteenage boyserial killernursekillersecurity guardvillainpsychiatristslasher killercoroner |
| Period: | 2000s |
| Story: | killing spreekillingfightfemale nuditybloodviolencesequelflashbacktwo word titleknifechasesurprise endingfirecell phone …corpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturemaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexcharacters killed one by onesequel to cult favoritemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com