Please wait - finding best movies...
Four teenage kids from the tiny mining town of Gold Lick vandalize a nineteenth-century cemetery of Chinese laborers when one of them disturbs a demon who's been guarding the souls of 100 workers killed in a cave-in. Jeff, the surviving teen, goes in search of his hero, over-the-hill B-movie star, B β¦ruce Campbell. Jeff kidnaps the actor and brings him to Gold Lick to save the town. Bruce thinks it's a birthday treat engineered by his agent, so he plays along, humoring the townsfolk and chatting up Jeff's unimpressed mom. Bodies pile up as the demon slashes. What will the sorry, boozy Bruce do when he realizes that Guan-Di, the demon, is for real? (Read More)
Subgenre: | screwball comedyb moviecult film |
Themes: | abductionescapedrunkenness |
Locations: | small town |
Characters: | mayorex husband ex wife relationshipchineseprostitute |
Story: | gun shopdevil on shoulderangel on shoulderdark horseangel and devilbig eaterhomosexual overtonesintentionally badstealing carbroken down carmerchandisetofuscreening roomfictional towncult movie cast β¦disembodied handdrinking urinemovie referenceevil deaddeitycult figurehostilityidolstereotypegothwilhelm screamdivorceedynamitemovie setfanbraveryrednecksevered handmovie staragentactor playing himselfanswering machinechainsawfilm within a filmdatedirected by starcountrysidebaseball batknocked outactor playing multiple rolesgraveyardvananti herosevered headdeath of frienddecapitationalcoholdemonbirthdayrifleblood splattertelephone callsurprise endingsingingdancingcharacter name in titlegun (See All) |
Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β¦ end up having to survive this swarm of evil until morning comes. (Read More)
Subgenre: | cult filmindependent filmblack comedyepicdark fantasygross out comedyhorror spoofamerican horrorsupernatural horror |
Themes: | murdersurrealismghostdancemonstermemorytime travelsadismbook of evil |
Mood: | gorenightmareavant garde |
Locations: | forestairplanewoodskitchencastlestormbackwoods |
Characters: | husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation |
Period: | 1980s1990s20th centuryyear 1987 |
Story: | disembodied handevil deadcult figuresevered handchainsawanti herosevered headdecapitationdemonblood splattersurprise endingsexnumber in titlebloodviolence β¦sequelkisschasethree word titlepantiesvoice over narrationsongunderwearmirrorshotgunfalling from heightbooksecond partlow budget filmbathroomnumbered sequelpianohallucinationgood versus evilaxestabbingstabbed in the chesttreecursestabbed in the backpossessionskeletonbasementhauntingratcabinsevered armshot in the armobscene finger gesturecult directordismembermentundeadsplatterfalling down stairsspiritfireplacetape recordertouristroman numeral in titleknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chairpendantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassabsurd violenceover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All) |
Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)
Subgenre: | cult filmindependent filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedyamerican horrorsupernatural horror |
Themes: | murderdeathrapeghostdancesupernatural powersadismevilsupernatural rapebook of evil |
Mood: | goreslasherone night |
Locations: | forestcarwoodssinging in a car |
Characters: | friendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boystudentself mutilationself cannibalism |
Period: | 1980s |
Story: | cult movie castevil deadcult figuresevered handchainsawanti herosevered headdecapitationdemonblood splattersurprise endingfemale nuditybloodviolencekiss β¦three word titlefireremakeshot in the headshotgunwritten by directorshootingbooklow budget filmcollegeriversubjective cameraaxestabbingbridgestabbed to deathsnakenecklacepaingravetreestalkerstabbed in the backkeyfirst of seriescharacter's point of view camera shotpossessionisolationbasementhauntingfirst partcabindirectorial debutcult directordismembermentoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustergrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footgrindhouse filmcardsno endingdecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violenceover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All) |
Several friends take to the mountains and shack-up in the wilderness of back-of-beyond to enjoy a little R and R together. Their peace is soon interrupted by a mysterious old man who informs them that during WWII, Nazi invaders of the area were brutal and harsh in their methods of control until, acc β¦ording to a legend, a villager's revolt drove the invaders up into the cold, dark mountains, where they perished. But now there's the rumor that they returned in the form of zombies --evil Nazi zombies. (Read More)
Subgenre: | b moviecult filmdark comedymedicalb horror |
Themes: | drunkennessfearsupernatural powerself sacrifice |
Mood: | gorespoofnightmarenazi zombie |
Locations: | carsnowkitchenblood on snowsex in a toilet |
Characters: | boyfriend girlfriend relationshipzombiesoldierself mutilationnazi soldierself surgery |
Period: | winter |
Story: | movie referenceevil deadchainsawanti herosevered headdeath of frienddecapitationblood splattersurprise endingsexbloodviolencetwo word titlecigarette smokingfire β¦cell phonemachine gunshot in the chestface slapfalling from heightbeerrunningmassacrethroat slittingstabbed to deathtoilettentfirst partcabinsevered armcult directorundeadhand grenadekilling an animalhead buttgroup of friendsloss of friendhammercovered in bloodbackpackdisembowelmentaccidental killingeye gougingstabbed in the eyeduct tapetripbrainnorwayblood on camera lensintestinesliving deadmolotov cocktailhead woundcabin in the woodsbayoneteastermedical studenthorninessdead birdavalanchesnowmobilecaverndreadlocksbludgeoningbitten in the throatmovie fanfoot pursuitgold coinmoonshinedialectgutsbody torn apartbitten on the armouthousesledge hammernorwegianhidden treasurefilm buffone armed manbelchingnazi flagtwisternazi occultismsmothered with a pillowtwister the gamemountain cabinski tripdead girlfriendsuturehiding in a treepreludedisembodied brainsnow scooternorth norwayhidden goldaltaface to facehead mutilated (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
Subgenre: | b moviecult filmindependent filmblack comedysuspensecreature featuresurvival horrormonster movie |
Themes: | escapedrunkennessmurderdeathlovesurrealismkidnappingfearmonsterdeceptionsupernatural powerparanoiahome invasionpaniccourage β¦near death experiencespace travel (See All) |
Mood: | satirenight |
Locations: | small townbarchurchhelicopterbicyclekitchenpolice stationfarmpolice carrooftopouter spacebicycle accident |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralienpriesthostagelittle boy β¦alcoholicsheriffalien monster (See All) |
Period: | 1980s |
Story: | braveryredneckbaseball batknocked outalcoholrifleblood splattersurprise endingbloodviolenceone word titlecigarette smokingphotographtitle spoken by characterexplosion β¦knifefirecorpseshot to deathcar accidentshot in the chestshotgunrescueslow motion scenewatching tvcatheld at gunpointbombcar crashrevolvertelephonesubjective camerasurvivalbedroomflashlightambushaxeimpalementtoiletradiochild in perilspaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timelightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail cellspacecrafteccentricphone boothlasersocial commentarybroken legeaten alivemechanicwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boymutationlaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | cult filmindependent filmsuspensefairy talepost modernpsychological thriller |
Themes: | escapemurderdeathsurrealismkidnappingfearfuneralmonsterfilmmakingdeceptiondeath of fatherbrutalitysupernatural powerparanoiacourage β¦near death experience (See All) |
Mood: | gorenightmareslasher |
Locations: | hospitalswimming poolcarcemeterylos angeles californiawaterwheelchairtrucksinging in a cartruck accident |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboypolice officerserial killernurseactorpriesthostageactresssecurity guarddirectormaid β¦film directorself referentialcoroner (See All) |
Period: | 1990s |
Story: | movie setbraveryactor playing himselfanswering machinefilm within a filmknocked outactor playing multiple rolesdeath of frienddemonblood splattersurprise endingbloodviolencesequelinterview β¦explosionknifechasefirecell phonedreamcorpsecar accidentblonderescueslow motion scenefalling from heightpaintingvomitingshowdownsunglassesrunningbedcar crashhallucinationtelevisiontelephonegood versus evilfoot chaseambushcaliforniastrangulationmansionstabbingwidowstabbed to deathstabbed in the chestsnakebrunetteno opening creditsdream sequencechild in perilhit by a cartonguenews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialoguescreamingperson on firecharacter's point of view camera shotrace against timeactor shares first name with characterscarinjectionstalkingexploding bodydeath of husbandneck breakingburned aliveelectronic music scorewoundhypodermic needleslow motioninjurybabysitterlifting someone into the airmorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodplaygroundstabbed in the throatstabbed in the legfilm settitle at the endalternate realityeye gougingdisfigurementstabbed in the eyefemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All) |
Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com β¦plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)
Subgenre: | cult filmindependent filmblack comedysuspensestop motion animationcreature featureteen romancebody horror |
Themes: | escapedrunkennessmurderdeathfriendshipfearmonsterdeceptionmilitaryparanoiaredemptionpaniccourageself sacrificenear death experience β¦unlikely hero (See All) |
Mood: | gorehigh schoolpoetic justiceone nighthorror movie remake |
Locations: | small townhospitalchurchforestcarhelicoptersnowmotorcyclecemeterywoodskitchenpolice stationpolice carouter spacesewer β¦car motorcycle chasemotorcycle chasetruck accident (See All) |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girlteenage boysoldier β¦nursepriesttough guywaitressvillainbiblesheriffself mutilationhomeless manbiologistalcoholic drink (See All) |
Period: | 1980s |
Story: | braveryfilm within a filmdatevananti herosevered headdeath of frienddecapitationblood splattersurprise endinggunbloodviolencedogcigarette smoking β¦explosionchasepistolfirecorpsemachine guncar accidentremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverscientistsurvivalorphanflashlightambushaxeambulancebridgefootballdinermapexploding carfalse accusationdisarming someonechild in perilhit by a carcreaturepolice officer killednecklacetransformationdangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderexploding bodyratsevered armdismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachercrushed to deathsocial commentarybikereaten alivefemale warriormechanicrampagereverse footageexplosiveu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiummutationjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage loveurban legendfirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemexperiment gone wrongmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stuntjumping from a carhazmat suitmotorcycle crashprojectionistyo yosinkmass deathbiohazardjarpart stop motionfreeze to deathbiological warfaregeiger counterblobmanholetown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerchild eatenface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikecrash siteevil preachertoilet plungerteen heroteen couple eaten (See All) |
All 'Jay Baruchel' (qv) expected coming to LA was a fun time with 'Seth Rogen' (qv) with all the wild partying to have both by themselves and at 'James Franco' (qv)'s housewarming party. Suddenly, the Rapture hits and the Biblical Apocalypse has begun. Now, Jay and Seth are desperately sheltering in β¦ James' house for rescue along with a few other friends. Together, they must band together to attempt to survive the end of the world, only for Jay to find that they are all too dumb and superficial to do it until they discover the only way out. (Read More)
Subgenre: | black comedysupernatural |
Themes: | escapedrunkennessdeathfriendshiprapemonsterredemptioncelebrityhome invasionpanicapocalypsecannibalismself sacrifice |
Mood: | goresatireparodyself parody |
Locations: | helicopterlos angeles californiabathtubwaterairportkitchen |
Characters: | homosexualactoractressreference to godbiblecanadianself referentialactor director writer |
Story: | drinking urineactor playing himselfchainsawfilm within a filmbaseball batsevered headdecapitationdemonblood splattersingingbloodmale frontal nuditymasturbationmale rear nudity β¦bare chested malecigarette smokingexplosionpartyknifechaseerectionpistolfirecell phonebeatingcar accidenturinationface slapshotgunslow motion scenepunched in the facefalling from heightpaintingvomitingbeercar crashmarijuanahallucinationprayerf wordsurvivalfoot chasegay sluraxevideo cameramansionmontageimpalementcocaineexploding carman with glassesno opening creditshit by a carcreaturenews reportracial slurlibrarycharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotkicked in the facecrossexploding bodybasementcharacter says i love yousevered armclaim in titlefalling down stairsburned alivetied to a bedloss of friendhollywood californiagiantskullend of the worldbreakfastcrushed to deathearthquakeeaten alivecameocannibalchaosconvenience storefalling to deathensemble castreference to satanstabbed in the legheavenjumping through a windowthrown through a windoweye gougingknife throwingraised middle fingersiegebarbecuelens flaredemonic possessiongay stereotypeburned to deathcrude humorexploding helicopterexorcismpipe smokingfast motion scenedrugged drinkhit with a baseball batmarijuana jointporn magazinehiding in a closetgun in mouthgiant monstersex slaveselfishnessmale rapehelicopter crashhit by a truckecstasyfall from heightbased on short filmcrushed headcar set on firematchrecreational vehiclebutt slapsaintscatological humorwoman slaps a manraptureactress playing herselflootingmovie posterfalling through the floormoney falling through the airvideo diarygiant creaturefinger cutphallic symbolmagic mushroomecstasy the drugdemon rapehit on the head with a rockbitten in the facedamnationhalosinkholefriends who hate each otherreference to lindsay lohanreference to george clooneysevered nosesleeping in a bathtubreference to sandra bullockascending to heavenreference to new kids on the blockreference to the backstreet boys (See All) |
Subgenre: | cult filmsuspense |
Themes: | escapemurderdeathrapepregnancyfeardeceptionevildevilmurder of family |
Mood: | goreslow burn |
Locations: | hospitalcemeterykitchen knifeblood in carrunning water |
Characters: | husband wife relationshipfemale protagonistnurseterrorpregnanttalking to oneself in a mirrorself inflicted gunshot woundself cutting |
Period: | 1980syear 1982 |
Story: | wilhelm screamknocked outgraveyardvandeath of frienddemonblood splattersurprise endingdancingbloodflashbackbare chested malecigarette smokingphotographknife β¦chasepantiespistolcorpseblondeshot in the headwatching tvsecretdead bodycollegepianocleavagefoot chasebound and gaggedthroat slittingstabbed to deathsuicide attempthousefishwhite pantiesscantily clad femaleritualroommatestabbed in the backprologuepay phoneproduct placementcollege studentshot in the shoulderwigdeath of sonbasementpremarital sexhaunted housepizzagirl in pantiesocculteavesdroppinghypodermic needlebabysitterpatientstabbed in the stomachwitchcraftcovered in bloodattempted suicidepower outagepool tableshot in the faceanxietyheadphonesbilliardsmurder of a childeye gougingcanetrophylyingceremonyhairshot in the neckplaying poollightervery little dialoguecamera shot of bare feetloud sexgoldfishfilm starts with textlandladyshot point blankaudio cassettenewscastpizza deliverysome scenes in black and whitegravestoneritetenantsymbolwoman smokerpentagramzippo lighterthroat cutmuraleclipsebegins with texthooded figurescreaming in feardrinking bloodrunning for your lifehundred dollar billdorm roombarefoot womanhead bandagesatanic cultsatanic ritualstained glass windowstartledstabbed in the bellysingle location911 calllock of hairintravenousbleeding from eyesdreadbroken vasedancing alonetwenty dollar billlunar eclipsestrange noisegermophobeanimal skullrotary phonedeformed facetrip and fallscratching facepoked in the eyegoldfish bowlbulletin boarddevil worshiperbreaking a vaseignoring advicesecluded houseslit wristluncheonettebait and switchcircumscribed pentagrampizza shoppepperoni pizza (See All) |
A young girl (Baby Doll) is locked away in a mental asylum by her abusive stepfather where she will undergo a lobotomy in five days' time. Faced with unimaginable odds, she retreats to a fantastical world in her imagination where she and four other female inmates at the asylum, plot to escape the fa β¦cility. The lines between reality and fantasy blur as Baby Doll and her four companions, as well as a mysterious guide, fight to retrieve the five items they need that will allow them to break free from their captors before it's too late... (Read More)
Subgenre: | cult filmmartial artstragedysteampunkcaper |
Themes: | escapemurderdeathsurrealismbetrayaldancefuneralgangstersurveillanceself sacrificesamurai |
Mood: | satire |
Locations: | trainhelicoptersnowbuskitchencastlestrip clubbrothelbus driverbus stationtrain explosion |
Characters: | mayorprostitutepolicedoctorfemale protagonistzombiesoldierpolice officerdancerpriesthostagesister sister relationshipwarriorsecurity guard β¦teacher student relationshipsnipersniper riflepimp (See All) |
Story: | dynamitesevered headdeath of frienddecapitationdemonrifleblood splattersurprise endingdancinggunf ratedbloodviolenceflashbacktwo word title β¦explosionknifechasepistolfirevoice over narrationshootoutdreamcorpseshot to deathmachine gunshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facebattleswordarrestfalling from heightheld at gunpointhand to hand combatbombbathroomrobotprostitutionhallucinationhandcuffscombatshot in the backfoot chaseflashlightcandlesword fightthroat slittingstabbed to deathstabbed in the chestmapnonlinear timelinechild abuseno opening creditsradiocoffincreaturecigar smokingshot in the legshot in the foreheadstabbed in the backprologuekeymini skirtmissiondragonrace against timeevil mankicked in the faceattempted rapeshot in the shoulderexploding bodyworld war onethreatened with a knifesilencerbattlefieldmissilebow and arrowkilling an animalheavy rainsexual abusecooksecurity cameratemplekicked in the stomachtherapistplanetgiantlaserrocket launcherrapistanimal attackback from the deadfemale warriorgas maskcyborgmental institutiondiamondimaginationexplosivecrossbowkatana swordgash in the facestabbed in the neckresurrectionshot in the facemental hospitalstabbed in the headthunderstormstabbed in the legpunched in the chestschool uniformsexploitationaccidental killingdeath of sisterblack eyehologramalternate realityschoolgirl uniformstabbed in the eyedressing roomsevered leggatling gunlaser gunbullet timecrowtorso cut in halfclose up of eyesfemale assassingiant robotkatanafire extinguisherswastikamolotov cocktailtimebombspit in the facefemale bondingpistol whipsuper strengthalarmmini dresslighterstepfatherplane crashflareinsane asylumshot in the eyeblackboardshort skirtshot point blankguardiantop secretbomberforgeryfighter planebiplaneexploding airplaneclimbing out a windowknocked out with a gun buttalice in wonderlandtrenchstarts with narrationdojosexual predatorvermontcovert operationfemale pilotdark heroinebody torn apartfemale empowermentminiskirtpunched in the crotchextreme closeupexploding planefire breathing dragonlobotomyeye candylooking through a keyholeblimpkicked in the ballsstomach ripped openinside the mindescapeegirl gangescape plantelescopic rifleexploding trainflying dragonaerial bombardmentdream sequence within a dream sequenceknocked out with gun buttdesk bellhit with a gun butthit on the head with a riflehuman versus dragonbody landing on carmaster keythigh high sockstriplanesliding down a drain pipe (See All) |
In this continuation to the adventure of the demon superhero, an evil elf breaks an ancient pact between humans and creatures, as he declares war against humanity. He is on a mission to release The Golden Army, a deadly group of fighting machines that can destroy the human race. As Hell on Earth is β¦ready to erupt, Hellboy and his crew set out to defeat the evil prince before The Golden Army can destroy humanity's existence. (Read More)
Subgenre: | martial artssuperheroparanormal phenomenasteampunkparanormal investigation |
Themes: | abductiondrunkennessdeathsuicidechristmaspregnancyherowrestlingapocalypsefalling in loveself sacrificenear death experience |
Locations: | new york city |
Characters: | father son relationshipfather daughter relationshipbrother sister relationshipbabyaction herogerman |
Period: | 1950s |
Story: | film within a filmanti herosevered headdecapitationdemonsurprise endingsingingcharacter name in titlebloodviolencesequelflashbackfighttitle spoken by characterpistol β¦showershootoutfistfightshot in the chestface slapbattlegunfightbrawlfalling from heightbookbased on comicshowdownhand to hand combatsecond partgood versus evilsword fightbased on comic bookimpalementmixed martial artsstabbed in the chestmapno opening creditsone man armychild in perilfictional warcreaturecigar smokingone against manystabbed in the backprologueperson on fireskeletonsplit screenthreatened with a knifesevered armtwinprincespearmutantroman numeral in titlenosebleedrebellioncrushed to deatheaten alivehit in the crotchgash in the facesuper villainstabbed in the headexilechristmas evethrown through a windowsoulbody landing on a carexploding helicopterauctionelfblood on camera lensoutcastremorsecrownquitting a jobpatricidesuperhero teamtrollgoblinhead cut offshot through the mouthblacksmithnorthern irelandgoggleshead ripped offregenerationunwed pregnancyresignationarm ripped offmultiple time framesstabbed in the mouthtumorcut armstabbed in the footfederal bureau of investigationturned to stoneson murders fatherpyrokinesisreference to the wizard of ozthrown through a glass doorangel of deathdark horse comicsteeth knocked outtooth fairytruceinterspecies romancenazi experimentsecret government organisationindestructibilityoccult detectiveowning many catswebbed fingersaquatic humanoidbreathing apparatushumanoid demon (See All) |
In this blend of the B movie classic The Blob (1958), and some Romero's zombies film, a meteorite collides in a small town. Grant finds it, and is infected by a parasite worm, which installs in his brain and causes him a creepy transformation into a monster. Starla, his wife, and Bill, a policeman, β¦will try to stop him and the plague of worms generated by the creature. (Read More)
Subgenre: | b moviecult filmblack comedycreature feature |
Themes: | drunkennessmurdermonstercannibalismmurder of a police officer |
Mood: | gorehigh school |
Locations: | small townbarswimming poolforestpolice station |
Characters: | mayorhusband wife relationshipteenagerzombiealiencountry singer |
Period: | year 2005 |
Story: | severed headdecapitationrifleblood splattersexbloodviolenceone word titleflashbackmale rear nuditybare chested malephotographexplosionpartypistol β¦corpseshot to deathshot in the chestshot in the headshotgunwritten by directorcar crashclassroomfoot chasebandimpalementstabbed to deathstabbed in the chestmapchild in perilhit by a cartransformationshot in the foreheadcharacter repeating someone else's dialoguedomestic violenceexploding bodybasementpolicewomancharacter says i love youdirectorial debuttwincowdismembermentgrenadekilling an animalmutantbarnnosebleedmind controlanimal attackeaten alivealien invasionstabbed in the throatobesityhungerkaraokestabbed in the headthrown through a windowdisembowelmentinfectiondeerdisfigurementranchmutationfemale in showersurprise after end creditssouthern accentdead dogblood on camera lensdirector cameohigh school teacherdead animalhead blown offmeatpolice chiefacidold flameanimal abusedeputystakeouttentaclemeteorshot in the foothit with a shovelcountdownparasitehomeless persondeformityreference to charles darwinslime555 phone numberearth viewed from spacecamera focus on female buttnightgownsouth carolinasliced in twonail polishzombie childpossebody torn apartbitten on the armwife murders husbandsteakwoman in a bathtubtentacle rapemass deathvomiting bloodhit on the head with a fire extinguisherjumping off a rooflesbian slurinfestationnude drawingoverweight womanslugcrossing guardsquare dancingradar gun (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | independent filmmartial artsblack comedymelodramadystopiaalternate historyzombie apocalypse |
Themes: | escapedrunkennessmurderdeathfriendshiprevengekidnappingmarriagebetrayalfeardanceweddingdeceptionincestmilitary β¦travelbrutalityparanoiaredemptionillnessunrequited lovehopeapocalypsecannibalismprejudicewealthcouragenear death experience (See All) |
Mood: | gorerainominous ending |
Locations: | forestcemeterylondon englandvillagewoodsenglandrooftopwalled city |
Characters: | family relationshipsfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipfemale protagonistzombiesoldierpriesthostagesister sister relationshiptough guylove trianglewarrioraction hero β¦cousin cousin relationshipaunt niece relationshipaunt nephew relationship (See All) |
Period: | 19th century |
Story: | braverysevered handknocked outanti herosevered headdecapitationrifleblood splattersurprise endingdancinggunbased on novelbloodviolenceflashback β¦dogkissfightexplosionpartyknifechasepistolfirevoice over narrationbeatingcorpsefistfighthorserescueslow motion scenepunched in the facewritten by directorbattleswordbrawlfalling from heightletterpaintingshowdownheld at gunpointhand to hand combathallucinationbritishcombatkung fusubjective cameragood versus evilsurvivalsword fightambushaxemassacremansionthroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestdisarming someoneone man armyfictional wardouble crossmarriage proposaltransformationtraininglibrarydangerstabbed in the backprologueattackcharacter's point of view camera shotrace against timetenttough girllightningscene during end creditslong takescarbodyguardexploding bodypigthreatened with a knifesevered armclass differencesdismembermentsubtitled scenebattlefieldstylized violencestrong female charactereavesdroppingtraitorcaptaincard gamemartial arts mastergrenadeburned aliverevelationspearheavy rainlooking at oneself in a mirrordiseaseroyaltyjail cellservantrebelstrong female leadforbidden loveviolinaction heroinecolonelcrushed to deathcannonfemale warriorguarddamsel in distressexplosivecorsetdual wieldstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the necklove at first sightballexploding headpunched in the chestdark herosuperstitioninfectionprideaerial shotrainstormdisfigurementknife throwingdark pasteye patchlieutenantmutationsword dueltragic herocellarmoral dilemmaroundhouse kickblood on camera lensswordsmanface maskfemale fighterhead blown offepidemicphysicianquick drawmilitiaplagueflypocket watchbritish armywoman kills a manbritainstabbed in the shoulderfight the systemheirbritish soldieropen endedtragic pastwoman fights a manarm cut offaristocracycourtshiparmy basefade to blackanti heroinegrindhouse filmbilingualismthroneoutbreakhigh societygold diggersuitorelopementrich manslow motion action scenehorse drawn carriagesurprise during end creditswoman punches a manlordaxe in the headman fights a womansecret passagewaycountry estatemanor houseshaolinladywoman hits a manstory continued during end creditscliffhanger endingrich womansisterhoodswordswomanblood on mouthabandoned churchenglish countrysidegolddiggercavalry chargehordeman murders a womanfire pokergeorgian eraexploding bridgepeace treatyjourney shown on maprogue soldierends with weddingburning bodymashupregency periodparsoncollapsing bridgehouse flyrace warreference to the four horsemen of the apocalypsetotal warwoman wearing an eye patch (See All) |
Seventeen year old slacker Anton Tobias wakes up one Halloween morning to discover that both of his parents have been turned into two headless Halloween decorations. After speaking to his equally irresponsible friends, Mick and Pnub, he discovers that his right hand has a blood-thirsty mind of its o β¦wn and is hell-bent on wreaking havoc whether he likes it or not. (Read More)
Subgenre: | screwball comedycult filmmusic videoblack comedydark comedyteen moviebody horror |
Themes: | murderdeathfriendshipdeath of fatherdeath of motherdrug use |
Mood: | gorehigh school |
Locations: | hospitalpolice stationtruck |
Characters: | husband wife relationshipteenagerfriendboyfriend girlfriend relationshipteenage boyserial killerpolicemanself mutilation |
Story: | disembodied handsevered handanti herosevered headdeath of frienddecapitationdancingbloodfemale frontal nuditydogtitle spoken by characterknifepistolcorpse β¦rescueslow motion scenewatching tvcatmarijuananeighborgood versus evilhalloweenflashlightbandstrangulationimpalementstabbed to deathmapbreast fondlingpolice officer killedshot in the foreheadcharacter repeating someone else's dialoguepuppetelectrocutionangelhalloween costumebasementneck breakingundeadgaragepot smokingtied to a bedcrushed to deathdamsel in distresscameostealing a carheadphonesstabbed in the headreference to satanthrown through a windowatticeye gougingslackerknife throwingduct tapedemonic possessionkilling spreenude woman murderedsmokedaggernewspaper clippingclose up of eyesliving deadstabbed in the handbongtaserdisposing of a dead bodytrailer homestonerphone sextwin brothermaking outhit by a truckbowling alleypatricideoffscreen killingeyeballmeat cleaverutahdisembodied headhandhit with a shovelhiding under a bedmatricideknittingcut into piecesmemorialpentagramjack o'lanternzippo lighterreference to ludwig van beethovensevered earwriting in bloodbitten handlazinessmicrowavehigh school dancecircular sawhand through chestdevil costumehanged womangirl next doorscalpingincenseburnt handstabbed in the foreheadangel costumeashtraylyricistpriestessreference to mozartnun costumedrive thruasthma inhalerheadless corpsereference to o.j. simpsonbutt grabstabbed in the earhiding under the coverscrawling through an air shaftbody castreference to kevin costnerknitting needlepencil sharpenerfighting with selfcouch potatoburritoreference to kiss the bandcrawling handelectric carving kniferising from the grave (See All) |
Martin Blank is a freelance hitman who starts to develop a conscience, which causes him to muff a couple of routine assignments. On the advice of his secretary and his psychiatrist, he attends his 10th year High School reunion in Grosse Pointe, Michigan (a Detroit suburb where he's also contracted t β¦o kill someone). Hot on his tail are a couple of over-enthusiastic federal agents, another assassin who wants to kill him, and Grocer, an assassin who wants him to join an "Assassin's Union." (Read More)
Subgenre: | cult filmmartial artsblack comedy |
Themes: | abductionescapedrunkennessmurderdeathfriendshiprevengeinfidelityreligionmoneybetrayaldancegangsterdeceptioncorruption β¦theftpsychopathdeath of fatherterrorismdepressiondrug usemafiaredemptiondatinghome invasion (See All) |
Mood: | satireneo noirhigh schoolcar chase |
Locations: | small townbarchurchmotorcyclecemeteryairplaneboatbathtubbicyclekitchenwheelchairpolice caroffice |
Characters: | policemother son relationshipfather daughter relationshipteacherbabytough guywarriorbest friendhitmanwaitresssecurity guardpsychiatristsnipersecretaryex boyfriend ex girlfriend relationship β¦sniper rifleself discoveryex soldierold friendmurder for hire (See All) |
Period: | 1980s1990s |
Story: | answering machinegraveyardvananti heroalcoholrifleblood splattersurprise endingdancingbloodviolencekissfightcigarette smokingexplosion β¦partyknifechasethree word titlepistolfirecell phoneshootoutbeatingcorpsearcade gameshot to deathfistfightmachine gunshot in the chestface slapshot in the headpunched in the facewatching tvcomputergunfightletterheld at gunpointhand to hand combatsunglassesbombplace name in titlerock musicmarijuanabathroomrevolverkung fushot in the backf wordfoot chaseassassinterroristmansionstabbingbridgestabbed to deathmixed martial artsdinerweaponman with glassesradioone man armyassassinationhit by a cardouble crosscigar smokingbartenderon the runhotel roomsuburbpoisonundercoversuitcasekicked in the faceopening action scenestreet shootoutshot in the shoulderscarconvertiblebodyguardfemale removes her clotheshigh school studentautomobilebasementreunionthreatened with a knifesecret agentsilencerkissing while having sextherapyrecord playertwenty somethinguzitape recordershot in the stomachsociopathred dresshammermagazinekicked in the stomachtherapistpsychologistmexican standoffgun fubikershopliftingexplosivestabbed in the throatgash in the faceconvenience storemental hospitalheadphonesjumping through a windowblack eyeblood on shirtalzheimer's diseasegasolinebroken armlaser gunlaptop computervodkashot through a windowdjstorefire extinguisherneedleset uptimebombdetroit michiganlockernight visiondisposing of a dead bodyglockreal estateold flameinformantretirement homeradio stationstakeoutbaseball capunionjointradio showpalm treecontract killerdisc jockeyrealtorgrassneck bracetieshot through a doorcut handwiretappingproposaljoggerhidden gunone last jobgeneration xcyclistbandaged handforkmoral ambiguitynsashot through a wallhigh school reunionfax machinemicrowavestore clerkstabbed with a knifefrying panshot in the sideclass reunionheadsetpulp fictionphysical therapyyearbookbiblical quotewashing handsmalletair venthotel suitecontrol roomchain link fencethrown through a glass doorbuilding explosionelderly peopleparty invitationtitle appears in textbotched crimefalling off a bicyclebomb makinghiding in a bathroomkicked in the shinprom nightstabbed with a penhigh school sweetheartsnsa agentdance floorblack suit clad killerfaygosemtexcovering a dead bodydrunken telephone callinfrared scope (See All) |
Ash is transported with his car to 1,300 A.D., where he is captured by Lord Arthur and turned slave with Duke Henry the Red and a couple of his men. When Ash is thrown into a pit, he defeats two monsters and wins respect of Arthur's army and vassals. The Wiseman points Ash as The Chosen One that wil β¦l retrieve the Necronomicon but Ash is only interested in returning home. When he learns that the only way to return to his time is using the Necronomicon, Ash decides to travel to the unholy land of the Deadites. The Wiseman advises that he must say the words "Klaatu Barada Nikto" to safely get the evil book. However, Ash forgets the last word and an army of the dead resurrects to attack Arthur fortress and recover the Necronomicon. The battle between the living and the dead is about to start and the support of Henry the Red is the only way to help Ash and Arthur to defeat the army of darkness. (Read More)
Subgenre: | cult filmmartial artsblack comedyabsurdismsword and sorceryepicslapstick comedyfish out of watersteampunkdark fantasysword and fantasy |
Themes: | surrealismfearmonsterheromagicsupernatural powertime travelevilpanicbook of evil |
Mood: | gorespoofavant gardesequel to cult horror |
Locations: | forestcarcemeterydesertwoodsenglandcastle |
Characters: | zombiesoldiertough guywarrioraction herowitch |
Period: | 1990s20th centuryyear 1992 |
Story: | evil deadcult figuresevered handchainsawactor playing multiple rolesgraveyardanti herodecapitationdemonblood splattersurprise endingsingingsexnudityblood β¦violencebare breastssequelkissfightchasethree word titlevoice over narrationfistfighthorsecar accidentmirrorface slapshotgunbattleswordbookhand to hand combatrunningfightingcombatgood versus evilsword fightambushaxearmyimpalementmixed martial artsprisonerdisarming someoneone man armyfictional warcreaturesearchthird partgunshotduelone against manycurseprologueuniformpossessionstatuelightningopening action scenescreamskeletonscarautomobilecabincult directordismembermentundeadbattlefieldstylized violencefireplacebow and arrowspearfarcequestcaptiveskullknighttorchgun fuslavefull moondamsel in distressreverse footageshieldexplosivethundercrossbowwhiphit in the crotchshot in the faceprophecypsychotronicmedieval timesarmorh.p. lovecraftsiegekingdomsword dueltragic herosequel to cult favoritearrowspelldoppelgangerlevitationgatespit in the facefreakarcherydouble barreled shotgunbeastfortressreluctant heroone linergun violencetrampolinewindmillchainedgravestoneblacksmithpigtailstongue in cheekbagpipeschosen onepitwinchester riflerepeating rifleshot with a bow and arrowalternate versionmistbattle axeogrechemistryflaming arrowdukeprosthetic limbevil twincartcatapultvortexbannerbattering ramover the topsame actor playing two charactersnecronomiconpart stop motionanvilbraidslanceanimate objectminiature personhorseback14th centuryalternate endingsame actor playing two characters simultaneously on screencult film reference1300shuman duplicationenchantmentbook of the deadsalesclerkcitadelhead spinoldsmobileanimate skeletondiscount storedemonic undeadvoice over flashbackwise manskeleton warriorartificial handportcullistwo headed personmetal handwar crychainmailsumerian (See All) |
A British Squad is sent on a training mission in the Highlands of Scotland against Special Operations squad. Ignoring the childish "campfire" stories heard about the area, they continue with their mission and come across the bloody remains of the Special Ops Squad, and a fierce howling is pitching t β¦he night sky... With two mortally wounded men, they make an escape, running into a zoologist by the name of Megan - who knows exactly what hunts them. What began as what they thought was a training mission turns into a battle for their lives against the most unlikely enemies they would have expected - werewolves. (Read More)
Subgenre: | cult filmindependent filmsurvival horrorbritish horror |
Themes: | escapedrunkennessdeathself sacrifice |
Mood: | gore |
Locations: | foresthelicopterkitchenblood in car |
Characters: | soldierwarriorfemale scientist |
Story: | severed handknocked outsevered headdeath of frienddecapitationblood splattersurprise endinggunblooddogphotographexplosionknifepistolfire β¦shot to deathmachine gunshot in the chestshot in the headshotgunpunched in the facecameraswordfalling from heightheld at gunpointfoot chasenewspaperaxeimpalementstabbed in the chesttied to a chairexploding carshot in the foreheadstabbed in the backskeletongiftbasementtrapsevered armshot in the armdismembermentwerewolfgrenadebulletkilling an animalinjuryeaten alivefull moonscotlandpunched in the stomachspecial forcesdisembowelmentwisecrack humorhealingstabbed in the eyemudshot through a windowblood on camera lensintestinesmolotov cocktailstandoffnight visionstabbed in the armclimbing through a windowflarecabin in the woodsmetamorphosisbritish armywalesgasexploding housesole survivorarm cut offtrapdoorbreaking through a doorshot through a doorgas explosionhead ripped offbitten in the throatfalling through the floorthroat rippingsoccer fansilverglueplatoonhiding in a carbackpackerreference to little red riding hoodcampsitescottish highlandsjumping from a helicoptersuperglueancient swordtraining missionwerewolf family (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | b moviecult filmindependent filmblack comedysuspenseabsurdismsurvival horrorpsychological thrillerbody horror |
Themes: | escapedrunkennessmurderdeathfriendshiprevengedrinkingfearbrutalityparanoiaguiltinsanityillnessunrequited lovehome invasion β¦exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed |
Characters: | father son relationshippoliceafrican americanboyfriend girlfriend relationshipdoctorpolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | redneckbaseball batknocked outsevered headdeath of frienddecapitationrifleblood splattersurprise endingfemale nuditybloodviolencefemale frontal nudityflashbackmasturbation β¦dogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiespistolshowerfirecell phonewoman on topbeatingcorpseshot to deathhorsecar accidentshot in the chesturinationblondeshot in the headshotgunslow motion scenepunched in the facewritten by directorbikinibrawlbare buttvomitingheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingcleavagesurvivalfoot chasegay slurambushaxemassacreambulanceimpalementstabbed to deathstabbed in the chesttied to a chairbrunettefalse accusationscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkaratescreamingperson on fireproduct placementstorytellingvacationcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desirereverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their β¦ courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | black comedyconspiracysupernaturalsurvival horror |
Themes: | escapedrunkennessmurderdeathrevengesurrealismmarriagemoneybetrayalghostdrinkingfeardeceptionseductionsupernatural power β¦paranoiainsanitysurveillanceunemploymentcourageself sacrificenear death experience (See All) |
Mood: | goreone nighthorror movie remake |
Locations: | barlos angeles californiabathtubelevatorwheelchaircave |
Characters: | husband wife relationshipafrican americandoctornursesecurity guardalcoholic |
Period: | 1990s1930s |
Story: | gothbraveryknocked outsevered headdecapitationdemonbirthdayblood splattersurprise endingfemale nuditybloodfightphotographtitle spoken by character β¦partyknifechasepistolfirecell phonecorpseshot to deathfistfightshot in the chestremakerescuepunched in the facewatching tvcomputerdrinkbrawlheld at gunpointsunglasseshallucinationf wordsubjective camerasurvivalflashlightjournalistambushaxeimpalementstabbed to deathstabbed in the chestfalse accusationdouble crossbirthday partycreaturefemme fataleracial slurflash forwardattempted murderprologuescreamingelectrocutioncharacter's point of view camera shotskeletonbasementhauntingsuspicionhaunted houseriotsurgeryfireplacegothicsecurity cameraeccentriccovered in bloodstrangerskullfaked deathpresumed deadmental institutioncameoguestimpostorstabbed in the neckbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsstabbed in the handfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcamcordercut into piecestheme parkhuman experimentinvitationelectric chairpencilstupid victimhillclimbing out a windowmad doctorpoltergeistbullet proof vestcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All) |
Subgenre: | cult filmindependent filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller |
Themes: | escapemurderdeathfriendshiprevengekidnappingfeartorturepsychopathbrutalityparanoiainsanityhome invasionpaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | forestbathtubwoodspolice cartruckcavegas station |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | braveryrednecksevered headdeath of frienddecapitationrifleblood splattersurprise endingsexbloodviolencecigarette smokingexplosion β¦knifechasepistolfirecryingcell phonebeatingcorpseshot to deathcar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdowncar crashmarijuanacollegeshot in the backsurvivalfoot chaseflashlightbound and gaggedambushaxemountainstabbed to deathtoiletstabbed in the chestmapexploding cardisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legdamsel in distressstealing a carjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi β¦kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)
Subgenre: | b movieindependent filmsword and sorcerysword and fantasychrist allegorygothic horror |
Themes: | abductiondrunkennessmurderdeathrevengekidnappingreligionbetrayaltorturefuneralmonsterdeceptionmagicredemptionfaith β¦cannibalismdevilmurder of familycooking over a campfire (See All) |
Locations: | churchforestsnowcemeteryvillagewoodsenglandshipcastlecavecampfire |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierpriesthostagewarriorbiblewitchself mutilation β¦ex soldiership captain (See All) |
Period: | winter16th century1600s |
Story: | wilhelm screamknocked outanti herosevered headdecapitationdemonblood splattersurprise endingcharacter name in titlegunbloodviolenceflashbacktwo word titlebare chested male β¦title spoken by characterexplosionknifechasefirecorpsehorsemirrorshot in the chestshot in the headrescueslow motion scenebattleswordfalling from heightmaskbased on comicshowdowninterrogationbritishprayerrivershot in the backgood versus evilsword fightambushaxemassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestno opening creditschild in perildouble crosskingjourneytransformationshot in the foreheadcursestabbed in the backprologueperson on firestatuetentdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenarysevered armundeadprincerevelationheavy rainhatslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controltorchmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydark herodead childjumping through a windowdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legblack magicburned to deathdaggerteleportationcrowmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortresssorcerershot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired malehorse chaseknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All) |
When a mercenary warrior (Matt Damon) is imprisoned within the Great Wall, he discovers the mystery behind one of the greatest wonders of the world. As wave after wave of marauding beasts besiege the massive structure, his quest for fortune turns into a journey toward heroism as he joins a huge army β¦ of elite warriors to confront the unimaginable and seemingly unstoppable force. (Read More)
Subgenre: | heistfish out of watercreature featureperiod dramaperiod piecedark fantasyalternate historysword and fantasymonster movielive action and animation |
Themes: | escapemurderdeathfriendshipsurrealismbetrayalprisonfearfuneralmonsterdeceptionrobberyparanoiaredemptiongreed β¦paniccourageself sacrificenear death experience (See All) |
Mood: | poetic justice |
Locations: | churchdesertrooftopcavechinacampfiretunnelsewer |
Characters: | chineseteachersoldierthieftough guywarrioraction herointerracial relationshipalien monster |
Period: | 15th centuryzip line |
Story: | dynamitebraverysevered handknocked outanti herosevered headdecapitationblood splattersurprise endingviolenceexplosionknifechasethree word titlefire β¦corpsehorseshot in the chestrescueslow motion scenebattleswordarrestfalling from heightshowdownbombcombatgood versus evilorphanbound and gaggedambushaxemassacremountainarmyimpalementstabbed to deathprisonermapno opening creditsdisarming someonefictional wardouble crosscontroversycreatureshot in the legcharacter repeating someone else's dialoguedangerattackstatueopening action sceneexploding bodysuspicionthreatened with a knifemercenarysevered armgeneralqueensubtitled scenetrustbattlefieldstylized violenceshavinggrenadedestructionbow and arrowburned alivespearcagehelmetjail cellcaptivetemplebeardjumping from heightirishculture clashhonortorchcannoneaten aliveguardrampageshieldtarget practiceexplosiveinvasioncrossbowdual wieldanimated sequencepartner3 dimensionalchaosevacuationescape attempt3ddark heromedieval timesaerial shotdungeoncapturetribesiegestabbed in the eyedark pastkingdomtragic heroburned to deathpalacebullet timeimprisonmentrockettorso cut in halfheroismbanditfemale soldiertranslatorblood on camera lensflaghistorical fictionfinal showdowntowergiant monsterfireballstonetwo man armyshot with an arrowarcherywallemperorcommanderdrumfilm starts with textcrash landingoffscreen killingcrashing through a windowmacguffinpotionmale protagonistacrobatfinal battlegurneybritish soldiermeteorarcherhot air balloontragic pastmiddle agesdistrustpsychotronic filmcavalrybanquetarmoryacrobaticsthronealien creaturenomadhorse chasemedallionscrollhands tiedsuit of armorspaniardstudio logo segues into filmkaijumagnetnunchucksharpoongiant creaturecatapultcouncilgunpowdercaught in a netstampedespear throwinggreen bloodspear gunbowlswarmancient chinabackflipgreat wall of chinacannonballstore roomdining roombungee jumpchinese armyaxe throwinghordeman with a ponytailtunic11th centuryburning bodyengine roomsecret military operationstabbed through the mouthhiveopening creditsenvoygreat wallwhite saviorchinese lanternwall of firesleeping potion (See All) |
The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum β¦mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)
Subgenre: | martial artsblack comedysupernaturalfairy talesword and sorcerysteampunkdark fantasy |
Themes: | abductionescapemurderdeathsurrealismkidnappingbetrayalmagicdeath of fathersupernatural powerdeath of motherfalling in lovemissing child |
Mood: | gore |
Locations: | small townforestdesertvillagewoodscity |
Characters: | mayorpolicebrother sister relationshiphostagetough guyaction herovillainsniperwitchsheriffsniper rifleself inflicted gunshot woundevil witch |
Story: | knocked outanti herosevered headdecapitationrifleblood splattercharacter name in titlegunfemale nuditynuditybloodviolenceflashbackbare chested malefemale rear nudity β¦fightphotographexplosionknifechasepistolfirevoice over narrationpunctuation in titlebeatingshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownheld at gunpointhand to hand combatinterrogationcombatshot in the backf wordgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingimpalementstabbed to deathcolon in titlestabbed in the chestchild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timetough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachwitchcraftbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t β¦he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
Subgenre: | martial artsblack comedysuspenseconspiracydystopiasurvival horrorpolitical conspiracy |
Themes: | escapemurderdeathfriendshiprevengekidnappingbetrayalpoliticsfeardeceptioncorruptionpsychopathbrutalityparanoiainsanity β¦sadismsurveillancehome invasionexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All) |
Mood: | gorenightslasher |
Locations: | churchhelicopterairporturban settingtruckrooftoptunnel |
Characters: | african americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifleself mutilation |
Period: | near future |
Story: | braverychainsawbaseball batknocked outvananti herosevered headdeath of frienddecapitationrifleblood splatterbloodviolencesequelflashback β¦bare chested malefightphotographexplosionknifechasepistolfirecell phoneshootoutbeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorswordgunfightbrawlshowdownheld at gunpointbeerhand to hand combatbombcar crashrevolvercombatshot in the backf wordsurvivalflashlightbound and gaggedgangambushaxemassacreambulancemontagestabbed to deathmixed martial artspoliticianstabbed in the chestimmigranttied to a chairmapman with glassesno opening creditsdisarming someoneone man armyhit by a carritualthird partnews reportshot in the legshot in the foreheadracial sluron the runflash forwardattempted murderdrug addictbinocularscharacter repeating someone else's dialoguedangerstabbed in the backcostumeprologueperson on fireelectrocutionfugitivemissionproduct placementrace against timeevil mankicked in the facestreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionthreatened with a knifemercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47hand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristsociopathhelmetsecurity camerawalkie talkieoverallskicked in the stomachwristwatchpress conferencerebelcovered in bloodrebellionparking garagemexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingcynicismministerresistancedual wieldstabbed in the throathatredhit in the crotchmanhuntmercilessnesschaosstabbed in the neckconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestbody landing on a carraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunmedia coveragebullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterstabbed in the armneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralfilmed killingshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | cult filmblack comedyconspiracysupernatural |
Themes: | escapemurderdeathloverevengesurrealismkidnappingmarriagemoneybetrayalpregnancyfearweddingdeceptionseduction β¦robberypsychopathbrutalitysupernatural powerparanoiaredemptionsadismunrequited lovepanicpolice brutalitymurder of a police officerpolice corruptionnear death experienceregret (See All) |
Mood: | gorecar chaseslasherpoetic justice |
Locations: | hotelcemeterybathtubwaterkitchenpolice stationpolice carroad tripmotel |
Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerserial killerdetectivepriesthostagethiefpolice detective β¦maidgay teenagerex boyfriend ex girlfriend relationshipuncle niece relationshipgay friendself referentialmurder of girlfriend (See All) |
Period: | 1990s |
Story: | gothchainsawfilm within a filmbaseball batknocked outgraveyardvanblood splattersurprise endingcharacter name in titlegunsexbloodviolencesequel β¦bare chested malekissfightcigarette smokingphotographknifechasepistolfirecryingcell phonebeatingcorpseshot to deathcar accidentmirrorshot in the chestrescueslow motion scenewatching tvbare buttlettershowdownheld at gunpointrock musiccar crashdead bodymarijuanahandcuffsrevolvertelephonef wordorphanflashlightambushstrangulationmansionmontagethroat slittingbridgeimpalementstabbed in the chesttied to a chairexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualpolice officer killedfemme fatalenews reportmarriage proposalon the runattempted murderargumentstalkercharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomelectrocutionpay phonefugitiveumbrellarace against timedolllightningskeletonringscarfishnet stockingsstalkingchildbirthexploding bodypremarital sexratsuspiciontied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingpot smokingsabotagefireplacehead buttgothicheavy rainsociopathscene during opening creditsragemutilationtoyfourth partspiderphone boothskullbirthblack humormexican standofffemale killerback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetdead woman with eyes opensequel to cult favoritevoodooframed for murderprivate investigatorengagement ringclose up of eyesspellmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererstupid victimvillain not really dead clicheinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All) |
Steven Kovak has been kicked out of his apartment by his girlfriend. Steven has a new apartment, and decides to slip the cable guy (Chip) $50 for free cable. Steven then fakes an interest in Chip's line of work. However Chip takes this to heart trying to become Steven's best bud. When Steven no long β¦er wants to be Chips friend the man who can do it all goes on an all out assault to ruin Steven's life. In the backdrop is the delicate sub-plot of the trial of a former kid star for murdering his brother. (Read More)
Subgenre: | cult filmblack comedydark comedy |
Themes: | friendshiprevengekidnappingbetrayaljealousyprisondeceptionpsychopathobsessionblackmailinsanityhome invasionbreak up |
Mood: | satirenightmare |
Locations: | barrestauranthelicopterapartment |
Characters: | prostitutehusband wife relationshipfather son relationshippolicemother son relationshipfriendpolice officerhostagewaitresssecretaryterrorex boyfriend ex girlfriend relationshipself referential |
Period: | 1990s |
Story: | homosexual overtonesmovie referenceactor playing himselfanswering machinedirected by staractor playing multiple rolesvansurprise endingcharacter name in titleviolenceflashbackfightphotographtitle spoken by characterparty β¦chasethree word titleshowercell phonebeatingdreamfistfighthorseblonderescueslow motion scenepunched in the facewatching tvcameraswordarrestkissingbrawlfalling from heightbeersunglassesjailhandcuffstelevisiontelephonesubjective camerafoot chasesword fightdisguisebasketballmontageprisonerfalse accusationtrialdouble crossnews reportstalkercharacter repeating someone else's dialoguefired from the jobcharacter's point of view camera shotmassagerace against timelightningmanipulationstalkingthreatpremarital sexsuspicionmaniaceavesdroppingdestinysabotagehead buttheavy rainsociopathscene during opening creditslifting someone into the airjail cellarchitectmediavideotapeeccentricpsychojumping from heightparking garageblack humorfalse identitywoman in jeopardyreverse footageshieldcameoprison guardconstruction siteattempted suicideimpostorpower outagekaraokeframe upmedieval timesmusical numberrainstormlonerpublic humiliationcrude humorphysical abusemedia coverageclose up of eyessatelliteintimidationbriberyvillain played by lead actormysterious mandirector cameocartoon on tvset upconstruction workerdirected by cast memberyoung version of characterknocking on a doorforeplayarenabusiness cardtv studiorepeated linemenacecheating boyfriendreference to james bondpolaroid camerahomosexual subtexttongue in cheekbreaking through a doorvillain not really dead clichewrongful arrestman with no namecrime of passiondeeply disturbed persontragic villaindutch anglehands tieddouble entendrestudio logo segues into filmpower drilltv setdinner dategay subtexthomoeroticmentalreference to star trekbroken backspeech impedimentpeepholesatellite dishsex jokefrat packlispstaplerthreatening telephone callreference to spidermanreference to pepsidangerous friendhead in a toiletpersonality disorderreference to jerry springerwanting to dienarcissistic personality disorderdry humpmentally disturbed personreference to kevin costnercable televisioncable guyjoustantisocial personality disorderderanged manfake mustachereference to jason voorheesmending friendshipcoveralls (See All) |
After the first massacre in 1974, the townspeople suspected that the Sawyer family were responsible. A vigilante mob of enraged locals surrounded the Sawyer house, burning it to the ground and killing every last member of the family. Decades later, a young woman named Heather learns that she has inh β¦erited a Texas estate from her grandmother. She decides to bring her friends along on the road trip to investigate her inheritance. On arrival, she discovers she has inherited a mansion, but is yet to uncover the terrors that lurk in the basement underneath it. (Read More)
Subgenre: | b movieslasher flick |
Themes: | murderdeathrevengevoyeurismmurder of a police officer |
Mood: | gorerainslasher |
Locations: | barcemeterypolice stationroad triptexas |
Characters: | mayorfather son relationshipbabylawyerkillerinterracial relationshipsheriffcousin cousin relationshipyounger version of characterslasher killer |
Period: | 1990s1970s |
Story: | severed handchainsawknocked outgraveyardsevered headblood splatterfemale nuditynuditybloodbare breastssequelfemale frontal nudityflashbackbare chested malephotograph β¦pantiespistoltopless female nudityshootoutcorpseshot to deathshot in the chestremakeshot in the headshotgunslow motion scenecar crashdead bodyvoyeurshot in the backcleavagehalloweenfoot chasebound and gaggedmassacremansionstabbingimpalementstabbed to deathstabbed in the chestscantily clad femalehit by a carnecklaceshot in the foreheadblack pantiescharacter repeating someone else's dialoguebeaten to deathstabbed in the backperson on firekicked in the facescarfemale removes her clothesdismembermentcorrupt copbralessgirl in pantiesfalling down stairssupermarketrevelationscene during opening creditsbarnstabbed in the stomachcarnivalhitchhikermasked manduct tape over mouthpump action shotguninterracial romancebra and pantiessevered finger3 dimensionalpool tablescene after end creditssevered legchaincharacters killed one by onefifth partmasked killertorso cut in halfmarijuana jointliving deadreturning character killed offmolotov cocktailgateplaying pooldouble barreled shotguninterracial kissnude girlhead bashed indeputywoman in bra and pantiesferris wheelwoman wearing only a man's shirtcrotch grabgraphic violencedeath of grandmothercheating boyfriendslaughterhousecut into pieceshit with a hammerpsychotronic filmhouse firebonegrindhouse filmhatchetvinylwoman wearing black lingerieangry mobtrail of bloodshot through a wallhidden doorwine cellarmidnight moviesevered facehorror icontape over mouthduct tape gagbreast kissingchain link fencechainsaw murderblack man white woman relationshipwoman undressing for a manmeat grinderhung from a hookachilles tendon cuthacked to deathdead body in a freezerleatherface3d sequel to 2d filmopen graveskinningwearing human skinadopted girlretconstabbed with a pitchforkblood trailblack man white woman kissblack man white woman sexgroup photographhiding in a coffin (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the β¦mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
Subgenre: | b moviecult filmindependent filmblack comedydark comedypost apocalypseabsurdismdystopiacreature featuresurvival horrorzombie apocalypseamerican horrorindependent horroritalian horrorzombie outbreak |
Themes: | escapemurderdeathrevengesuicidekidnappingmoneypregnancyfearmonstermilitaryrobberybrutalityparanoiasadism β¦executionexploitationpanicapocalypsecannibalismpolice brutalityhuntingmurder of a police officernear death experience (See All) |
Mood: | goresatirepoetic justicemurder of a boy |
Locations: | restaurantcarhelicoptermotorcycleairplaneboatelevatorapartmentfarmtruckrooftoppennsylvaniafire truck |
Characters: | policeafrican americanboyfriend girlfriend relationshipdoctorzombiesoldierpolice officerpolicemanpriesthostagetough guywarriorsecurity guardvillainprofessor β¦sniperpolice shootoutsexistpolice doghispanic americanhunting partymurder of a girl (See All) |
Period: | 1970s |
Story: | gun shoprednecksevered handbaseball batknocked outvansevered headdeath of frienddecapitationrifleblood splattersurprise endinggunbloodviolence β¦sequeldogbare chested malecigarette smokingphotographexplosionknifechasepistolfireshootoutbeatingcorpsearcade gameshot to deathfoodmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewatching tvcamerawritten by directorbattleswordgunfightfalling from heightvomitingheld at gunpointsunglassessecond partbedlow budget filmrevolvertelevisioncombatkung fuscientistshot in the backsubjective cameragood versus evilsurvivalgangambushaxemassacreambulancebasketballdrug dealerwomanmontagebridgefootballstabbed to deathtoiletstabbed in the chestexploding carnunradiohit by a carcontroversycreaturepolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial slurtrainingone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backscreamingprotestsuburbperson on fireattackcharacter's point of view camera shotmoaningkicked in the facedeath of childtough girlopening action scenebankscene during end creditsscarbasementdie hard scenariothreatened with a knifesevered armshot in the armhandguncult directordismembermentundeadchild murderstylized violencehenchmanrioteyeglassesdisasterhand grenadecard gamesupermarketgrenadebow and arrowburned alivehead buttelectronic music scoremass murderlooking at oneself in a mirrormachetesociopathscene during opening creditshelmetdiseaseviruscowboy hatsecurity camerawalkie talkiehunterloss of loved onebeardhammerkicked in the stomachswat teamcovered in bloodgrindhouseend of the worldburialgun fuinterracial friendshipsocial commentarybikercannoneaten alivefemale warriorgas maskthugstealing a cartarget practiceu.s. armycrossbowdual wielditalian americancannibalmercilessnesspower outagechaosstabbed in the neckshot in the faceshopping mallm 16butcherpsychotronicescape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestice skatingdisembowelmentoutlawghettoinfectionaerial shotblood on shirtracistslaughtertough copdisfigurementknife throwingsiegegasolinephiladelphia pennsylvaniapolice raideye patchbody countdead boymutationsevered legethnic slurdeath of loved oneburned to deathmoral dilemmamannequinmedia coveragefirefighterhit with a baseball batleather jacketdead girlbanditmexican americanblood on camera lensintestinesbad guyhysteriasidekickcandyliving deadhiding in a closetvomithead blown offepidemicspiral staircasegolf clubquick drawstolen moneyplaguebroken windowmallstabbed in the armclimbing through a windowgang violencefalling into waterflaskflaredepartment storeshot in the eyeanarchyhit by a trucksawed off shotgunhillbillymercy killingoffscreen killingbitten in the neckpiecheesen wordfriends who live togetherconsumerismdeath of boyfriendmoustacheperfumecar set on firedirector also cinematographerextreme violencemeteorflesh eating zombiegraphic violencemotorcycle gangrepeated linewalking deadairfieldoutlaw gangcrowbarpuerto ricanradio newsbloody violencehit with a hammerzombie violencevending machinesledgehammertommy gunbiker gangshot through a doorgang leaderhedonismshopping cartcalendardreadlockselevator shaftfamous linekicking in a doorgrindhouse filmsocial decayberetoutbreaktechno musiczombie attackmotorcycle with a sidecarbitten in the throatlootingvinylice rinkhardware storejewelry storebandanabloody body of a childhelicopter pilotmacewrencharm ripped offrookie copdoomsdaynewscasterdecomposing bodysurprise during end creditsreanimationwheelbarrowbarricadedocksdinner dateharley davidsonheadbandsecret passagewayvideo arcadezombie childmartial lawjamaicancircular sawblowtorchphoto boothflesh eatinghangarpolice vigilantismblockadehousing projectgas grenadegolf ballham radioloss of boyfriendmidnight moviescalpingremadeabsurd violencenational guarddrive in classictire irongun storeanthropophagusmass deathtennis racketcontemplating suicideentrailsgory violencehorror movie remadezombificationsombrerotennis ballair ventbaseball glovehare krishnadumb policenewsroomhell on earthmorning sicknessleg ripped offderringergrowlingclaustrophobichordedeadly diseaseamateur radiostabbed in the eardouble child murderend of civilizationtelevision stationcomplainingevil nuncontemporary settingemergency broadcast systemright hand manfirearm pointed at the cameragang that lives togethermilitary jeepracist copbiker chickdereliction of dutysidecarpie fightscally capthompson gungroaningracket ballpropanebikersbitten in the armmorning starshort wave radioshot at the camerabattle cryshooting a childbitten in the leggearing uphelicopter landing padlooternewsboy capbiker womenknit capmass panicmilitary jacketabandoned shopping mallbald zombiebiker babelong haired bikermuzak (See All) |
A vigilante homeless man pulls into a new city and finds himself trapped in urban chaos, a city where crime rules and where the city's crime boss reigns. Seeing an urban landscape filled with armed robbers, corrupt cops, abused prostitutes and even a pedophile Santa, the Hobo goes about bringing jus β¦tice to the city the best way he knows how - with a 20-gauge shotgun. Mayhem ensues when he tries to make things better for the future generation. Street justice will indeed prevail. (Read More)
Subgenre: | b moviecult filmblack comedyabsurdismpunk |
Themes: | murderrevengekidnappingdrugstorturerobberybrutalitysadismhomelessnessmurder of a police officerpolice corruption |
Mood: | gore |
Locations: | hospitaltrainpolice stationschool bus |
Characters: | prostitutefather son relationshipbrother brother relationshipbabypimpshooting a police officerbaby killer |
Story: | severed handknocked outsevered headdecapitationalcoholblood splattertelephone callcharacter name in titlefemale nuditybloodviolencebare breastsmasturbationcigarette smokingtitle spoken by character β¦pistolcorpsearcade gameshot to deathfistfightshot in the chestshot in the headshotgunpunched in the facedead bodyprostitutionshot in the backfoot chasenewspapergangaxemassacrevideo cameraimpalementcocainestabbed in the chestone man armychild in perilnews reportshot in the foreheadbinocularscharacter repeating someone else's dialoguestabbed in the backelectrocutionkicked in the facedeath of childattempted rapedeath of brotherfishnet stockingsdeath of sonvigilantenewspaper headlinedismembermentcorrupt copchild murderak 47burned alivemacheteshot in the stomachscene during opening creditsspin offmutilationphone boothcovered in bloodgrindhouseblack humorgenociderapistcrushed to deathmasked manduct tape over mouthrampagepump action shotgunswitchbladesevered fingergash in the facestabbed in the neckpunched in the stomachshot in the faceexploding headpedophiledisembowelmentcanecastrationlens flarebroken armflamethrowershot multiple timeshit with a baseball batblood on camera lensintestinesvideo tapebarbed wiremolotov cocktailgun in mouthhead blown offpolice chiefarcadehanging upside downhead bashed insawed off shotguntentaclestreet fightbased on short filmbumcrushed headski maskhanged manpawnshophomeless personwoman in a bikinifilmingdumpsterdeath of title characterspitting bloodhoboimprovised weaponshot in the crotchshopping cartsevered footimmolationbreaking a bottle over someone's headman with no namerecyclingfratricidecrime lordangry mobdrinking from a bottlecowardiceboom boxhung upside downsuit of armorflame throwerlawn mowertoastersanta claus suitlawnmowerchild killerwearing sunglasses insidewoman smoking cigarettebody armorfilicidered lighthanged womanmotorcycle ridingvhs tapebumper carhanged by the neckdeath of unclereference to mother teresacandollar billpawn shopelectrocutedfacial cutwhite suithospitalityice skatesmass child killinghack sawattempted kidnappingwearing sunglasses at nightstreet prostitutionfoiled robberypulling haircutting torchsuspended by armsmanhole coverneo 80sweapon in titleemergency surgeryhead crushedstilletoeating glasswelding maskbreaking an armbricklinrobber wearing a ski maskfire in a 55 gallon drumriding a freight train (See All) |
Young Danny Madigan is a big fan of Jack Slater, a larger-than-life action hero played by Arnold Schwarzenegger. When his best friend, Nick the projectionist, gives him a magic ticket to the new Jack Slater film, Danny is transported into Slater's world, where the good guys always win. One of Slater β¦'s enemies, Benedict the hitman, gets hold of the ticket and ends up in Danny's world, where he realises that if he can kill Schwarzenegger, Slater will be no more. Slater and Danny must travel back and stop him. (Read More)
Subgenre: | b moviecult filmmartial artsblack comedy |
Themes: | murderdeathlovefuneralgangsterheromagicpsychopathmafiainsanityhome invasionmurder of a police officer |
Mood: | satirespoofcar chasebreaking the fourth wallself parody |
Locations: | new york cityhelicopterlos angeles californiataxitruck |
Characters: | family relationshipspolicemother son relationshipfather daughter relationshipserial killertough guywarrioraction herosingle motherkillervillainself referential |
Period: | 1990s20th centuryyear 1993 |
Story: | cult movie castmovie referencestereotypedynamitefanactor playing himselffilm within a filmviolenceflashbackkissfightchasethree word titlecell phoneshootout β¦beatingcorpseshot to deathfistfightshot in the chestblondeface slapshot in the headpunched in the faceswordgunfightbrawlfalling from heightshowdownheld at gunpointsunglassescar crashdead bodyhandcuffsmanhattan new york citycriminalshot in the backsword fightgangold manaxemansionwomanweaponexploding carno opening creditschild in perildouble crosscigar smokingtheaterattempted murderelectrocutionfantasy sequencestatueevil mantough girlopening action sceneexploding bodydeath of sonneck breakingmurdererdie hard scenariothreatened with a knifecinemasemiautomatic pistolkillingredheadcorrupt cophenchmanmaniacuzilifting someone into the airmobstermovie theaterclassical musicmexican standoffgun fudinosaurmovie theatrecameoswitchbladestealing a carchild's point of viewdark humorkicked in the crotchfather figureblack and white scenestabbed in the legghettodeceithealingbulletproof vesttough coplasersightexploding helicoptergatling gunpsycho killerdesert eaglepsychopathic killerbad guymadmancartoon on tvhuman monstervideo storetwo man armyhomicidal maniacgang violenceno title at beginningcameo appearancestuntshot in the eyeexploding truckhollywood signman punching a womanpunmaverick coptimes square manhattan new york cityexploding housefart jokegrim reapercartoon catmass murdererkicking in a doorpremature ejaculationkicked in the groinactress playing herselfticketbullet proof vest555 phone numberdeja vumovie posterchild with a gunfalling off a roofjumping from a rooftopmushroom cloudsharpshooterprojectionistfilm premieremovie premieredobermancraneglass eyesame actor playing two charactersactor playing dual rolechild driving a caraxe murdererairbagthrown through a wallhandcuffed to a pipetwentieth centurywhite suitmagical objectsame actor playing two characters simultaneously on screenactor talks to audiencemovie reality crossovertarworried motherattempted child murdercartoon reality crossoverbreaking a glass windowlos angeles storm draindriving through a wallcartoon characterfictional characterknife in the thighhand slapplaying chickenhowie screamspinning axeinvisible barrierlife imitates artroaringla brea tar pitt 1000nun with a gunactor meets characterboy sidekickpunching through a car window (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β¦are after the backpackers find a way to escape. (Read More)
Subgenre: | cult filmindependent filmsuspenseslasher flickaustralian horrorsadistic horror |
Themes: | abductionescapedrunkennessmurderdeathkidnappingrapedrinkingfeartorturepsychopathbrutalityinsanitysadismevil β¦exploitationcruelty (See All) |
Mood: | gorecar chasenightslasherdarknessblood and gore |
Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β¦australian outbackcar on fireshed (See All) |
Characters: | husband wife relationshipdoctorsingerserial killerhostagekillervillainaustralianterrorself mutilationslasher killermysterious villainserial murderermysterious killer |
Period: | year 1999 |
Story: | broken down carredneckcountrysidevanrifleblood splattersinginggunbloodviolencedogtwo word titlekisscigarette smokingphotograph β¦title spoken by characterexplosionpartyknifechasebased on true storysongcorpseshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo camerastabbingimpalementstabbed to deathfalse accusationcontroversypainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuittragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufokillinggaragemaniacpickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagesufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavageryhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
Derek and his friends must investigate the missing people in a small village. Then they find out its human formed aliens that are really big headed monsters that used all the people in the small village into their snack burgers. Now, Derek must save the day and the world with his chainsaw before the β¦ meat eaters strikes the whole planet. Will Derek kill all the aliens? (Read More)
Subgenre: | cult filmindependent filmblack comedygross out comedy |
Themes: | torturecannibalismunlikely hero |
Mood: | gore |
Locations: | small townbeachouter space |
Characters: | alien |
Period: | 1980s |
Story: | chainsawdirected by staranti heroblood splattersurprise endingbloodviolencetwo word titleshootoutmachine gunshot in the chestshot in the headfalling from heightvomitingrock music β¦low budget filmthroat slittingexploding carshot in the foreheadbinocularswritten and directed by cast memberdirectorial debutsevered armobscene finger gesturecult directorsplatterropeelectronic music scoremacheteshot in the stomachwalkie talkienosebleedsheeprocket launcherkicked in the crotchshoveldisembowelmentaxe murdernew zealandall male castfast foodhead injurydisembodied headextreme violencecollectorexploding housesledgehammerhead ripped offsliced in twoarm blown offentrailstestosteronesplit headsplit in twoknife through the neckdubbedeating brainsunsynchronized sound (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | independent filmmartial artsblack comedypost modernhorror spoof |
Themes: | escapedrunkennessmurderdeathrevengekidnappingbetrayaljealousyfearfilmmakinginvestigationdeceptionvoyeurismtheftbrutality β¦paranoiacelebrityhome invasioncourage (See All) |
Mood: | goresatirenightmareslasher |
Locations: | barswimming poolhelicopterlos angeles californiaapartmentpolice stationpolice car |
Characters: | policefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officerserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm directorex boyfriend ex girlfriend relationship β¦death of girlfriendself referentialpregnant from rape (See All) |
Period: | 1990s2000s |
Story: | movie setbraveryanswering machinefilm within a filmbaseball batknocked outbirthdayblood splattersurprise endingf ratednumber in titlebloodviolencesequeldog β¦bare chested malefightcigarette smokingphotographpartyknifechasepistolshowercell phonebeatingcorpsedigit in titleshot to deathfistfightcar accidentshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretfalling from heightmaskshowdownheld at gunpointsunglassescar crashhallucinationhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalfoot chaseflashlightjournalistbound and gaggedambushstrangulationambulancemansionthroat slittingstabbed to deathtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingrace against timecover upkicked in the facetough girlscreamprankshot in the shoulderbodyguardstalkingexploding bodyisolationbasementpremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppingfalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameomobile phonestabbed in the throatpartnermercilessnessfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | b movieindependent filmsuspenseb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | murderdeathfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | gorenightmarecar chasenightslasherdarknessblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend β¦killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | rednecksevered handchainsawvansevered headdecapitationrifleblood splattertelephone callsurprise endinggunfemale nudityf ratedblood β¦violencebare breastsfemale frontal nudityflashbackmasturbationdogcigarette smokingphotographknifelesbian kisschaseshowerdreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingsunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective camerasurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chesthousescantily clad femaleon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychogrindhousestrangerrape victimfollowing someonerapistfemale killerrampagetensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | cult filmindependent filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror |
Themes: | abductiondrunkennessmurderdeathrevengesuicidekidnappingghostfeartorturepsychopathdeath of fatherbrutalitysupernatural powerdeath of mother β¦insanityeviltraumafear of water (See All) |
Mood: | gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore |
Locations: | small townforestcemeterypolice stationlakeschool nurse |
Characters: | father son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β¦serial murderer (See All) |
Period: | 2000s |
Story: | severed handvansevered headdecapitationdemonblood splattersurprise endingcharacter name in titlebloodviolencesequelflashbackphotographexplosionparty β¦pistolshowerfirevoice over narrationdreamcorpseslow motion scenebrawlfalling from heightmaskcar crashfoot chasestabbingimpalementdream sequencechild in perilunderwater scenedrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderercabinsevered armdismembermentkillingundeadsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the aircomaragemutilationpsychovictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | cult filmblack comedysupernaturalfairy taleslapstick comedydark fantasy |
Themes: | escapedrunkennessmurderdeathrevengesurrealismkidnappingmoneybetrayalghostprisondrinkingfeartorturemonster β¦deceptionmagicmilitarynaturedeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemythologymissing childunlikely hero (See All) |
Mood: | rainnightmare |
Locations: | small townchurchforestsnowcemeteryvillagewoodscastlecavegermany |
Characters: | mayorprostitutemother son relationshipfather daughter relationshipfriendbrother brother relationshipboygirlsoldierdanceractorpriesthostagesister sister relationshiplove triangle β¦warriorwitchfrench soldier (See All) |
Period: | 19th century1810s |
Story: | anti herosevered headdecapitationrifledancingcharacter name in titlegunbloodviolenceflashbackdogkissfighttitle spoken by characterexplosion β¦knifethree word titlepistolfirecorpseunderwearfoodhorsemirrorshot in the chestshot in the headrescuecatdrinkbattleswordarrestfalling from heightbookrunningbedinterrogationhallucinationshot in the backbound and gaggedwinecandleold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestweaponmapsnakeman with glassestrialanimaldrawingchild in perildouble crossritualkingcreaturefemme fataletransformationgunshotflash forwardattempted murdergravetreecursestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upsevered armgeneralfireworksqueencowtrustwerewolfitalianropewolfbow and arrowmedicineflyingwoundgothiccagelifting someone into the airhatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfemale warriorfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legdaggerexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablefolklorehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
Five twenty-something friends become holed up in a remote cabin. When they discover a Book of the Dead, they unwittingly summon up dormant demons living in the nearby woods, which possess the youngsters in succession until only one is left intact to fight for survival.
Subgenre: | supernatural |
Themes: | suiciderapesupernatural rape |
Mood: | gorerainhorror movie remake |
Locations: | forest |
Characters: | father daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipself mutilation |
Story: | evil deadsevered handchainsawknocked outdeath of frienddemonblood splatterbloodviolenceflashbacktwo word titlephotographlesbian kissshowerfire β¦shot in the chestremakeshotguncar crashf wordimpalementstabbed in the chestno opening creditsdrawingshot in the legnecklacedrowningshot in the foreheaddrug addictcharacter repeating someone else's dialoguebeaten to deathperson on firecharacter's point of view camera shotshot in the shoulderinjectioncharacter says i love yousevered armshot in the armsubtitled scenesyringekilling an animalmachetegroup of friendscovered in bloodrape victimclockpromisegash in the facestabbed in the neckshot in the facestabbed in the legscene after end creditstitle at the endh.p. lovecraftdemonic possessionchaincharacters killed one by onecellarfemale in showersurprise after end creditsdead dogblood on camera lensstabbed in the handburied alivebag over headhead blown offstabbed in the armwellbroken mirrordouble barreled shotgunburnt facehead bashed incabin in the woodsdripping bloodshot in the handstabbed in the shouldersole black character dies clicheextreme violencestabbed in the facecrowbardead cathit with a hammersole survivorarm cut offtrapdoorhouse firesevered footimmolationzippo lightergrave diggingtrail of bloodalternate versionstabbed in the mouthnail guncrushed by a carremake of american filmbitten handbroken handfilicidedrug withdrawaldefibrillationhit with a rifle butthead cut in halfvomiting blooddriving in the rainremake of cult filmsplit headglass shardincantationbox cutterchainsaw murderboiling waterstabbed with glassanimate treemultiple versionsslip and fallbook of the deadremake of cult favoriterecovering drug addicttwitchingbloody knifehit with a crowbaroldsmobileattacked by a plantelectric knifegroup of fivelocked in a cellarstabbed with a needledemonic undeadshower with clothes onroast beefbreaking mirrorraped by treesregistered nursechained to a treeunrated version available (See All) |
Top London cop, PC Nicholas Angel is good. Too good. And to stop the rest of his team looking bad, he is reassigned to the quiet town of Sandford. He is paired with Danny Butterman, who endlessly questions him on the action lifestyle. Everything seems quiet for Angel, until two actors are found deca β¦pitated. It is called an accident, but Angel isn't going to accept that, especially when more and more people turn up dead. Angel and Danny clash with everyone, whilst trying to uncover the truth behind the mystery of the apparent "accidents". (Read More)
Subgenre: | cult filmblack comedyconspiracydark comedyabsurdismslapstick comedyfish out of waterbritish comedypolice procedural |
Themes: | drunkennessmurderdeathfriendshipinfidelityadulterydrinkinginvestigationextramarital affairpsychopathwrestlingunfaithfulnessaffairpolice corruption |
Mood: | gorerainspoofparodycar chaselaw enforcement satire |
Locations: | small townbartrainschoolchurchhotelhelicoptercemeterybuslondon englandbicycletaxivillagepolice stationpolice car β¦cityenglandcastlerooftopsea mine (See All) |
Characters: | husband wife relationshipfather son relationshippolicedoctorteenage boyteacherpolice officerserial killerdetectivepolicemanactorpriesthostageactresspolice detective β¦uncle nephew relationshippolice chase (See All) |
Story: | movie referencegraveyardsevered headdecapitationalcoholbirthdayrifleblood splattertelephone callgunbloodviolenceflashbackdogkiss β¦fightcigarette smokingphotographexplosionknifechasevoice over narrationcell phoneshootoutcorpseshot to deathmachine gunhorsecar accidenturinationshotgunslow motion scenecameraarrestgunfightkissingbeersunglassesbombrunningcar crashdead bodyhandcuffsbritishf wordreporterfoot chaseflashlightsword fightstabbingmontageimpalementaccidentapologycultno opening creditschild in perilbirthday partyshot in the legbartendergunshotflash forwardprologuelocker roomwidowerchampagneangelcover upskeletonflowersfarmerloss of fatherpolicewomanratshot in the armtwinreference to william shakespearegraffitipubcorrupt copchessbirthday cakesupermarketmass murdercaketape recorderlifting someone into the airice creamjoggingwalkie talkiemale bondingsergeantvideotapeculture clashfaked deathanimal attackclockcrime sceneseriesbloody noseshopliftingsurveillance camerabreakupbuddyresearchministerunderage drinkingstabbed in the throatanimated sequencebackstagepartnerconvenience storegunshot woundbutchertheatre audiencestabbed in the headexploding headevidencewisecrack humormusical numbertitle at the endrainstormslackertough copmineaxe murderdead motherpolice inspectoratheisthorseback ridingblood on camera lensserial murderdeadvideo surveillancesidekicknew jobfinal showdownstabbed in the handbrainwashingnotebookstuffed animalfountaindvdsarcasmfencesecret societytombstonedrunk drivingno title at beginningbuddy coptape recordinggreenhousechandeliercrushed headfinal battlemacabrefemale police officermugshotexploding housereference to shakespeare's romeo and julietdead wifeinspectorman childshopping cartspray paintjuvenile delinquencyscythegas explosionnewspaper reporterbullet proof vestswanautomatic weaponworkaholicinterpreterice cream conecrossword puzzlehooded figurebuddy moviebig cityforkarsenalgun held to one's headperson in a car trunkvicarfloristbreaking down a doorinnkeepermerchantshooting gallerydecapitated bodygay subtextteen drinkinghuman skullgiallo esquespit takemultiple cameosfake bloodperson in car trunkbaconclock towercowboy costumeshopliftersolicitorstab woundconstablegarden shearshotel desk clerkdumb policepramstabbed through the chinc wordsociologistenglish countrysiderafflecatacombgrocerspeeding tickethooded sweatshirtsanta claus costumetoothpickappointmenthorticulturestop signdead body in a freezerliving statuenikon camerapolice forcebuddy filmauditflip bookhunting tripsanta suitdetective sergeantneighborhood watchopening creditsoriginal storypublic housestage doorwatching a playtown councilcachehooded killerscale model of cityhouse plantminiature setrecycling bincatsupcranberry juicespirelost animalsarcastic clappingswear jar (See All) |
Faber College has one frat house so disreputable it will take anyone. It has a second one full of white, anglo-saxon, rich young men who are so sanctimonious no one can stand them except Dean Wormer. The dean enlists the help of the second frat to get the boys of Delta House off campus. The dean's p β¦lan comes into play just before the homecoming parade to end all parades for all time. (Read More)
Subgenre: | cult filmblack comedyslapstick comedyteen movieteen comedygross out comedy |
Themes: | drunkennessrevengeinfidelityadulterydrinkingextramarital affairunfaithfulnessdatinghumiliation |
Mood: | parodybreaking the fourth wallsocial satire |
Locations: | barnightclubroad trippennsylvania |
Characters: | mayorhusband wife relationshipteacherbullylustprofessorsheriffolder woman younger man relationship |
Period: | 1960syear 1962 |
Story: | devil on shoulderangel on shoulderangel and devilchainsawanti herodancingsexfemale nuditymale nudityfemale frontal nuditymasturbationmale rear nudityfemale rear nudityparty β¦pantiesbeatinghorsecar accidentdrinkvomitingliebeeranimal in titlemarijuanacollegevoyeurorgygay slurconcertwhite pantiesroommatespankingracial slurblack pantiespay phonecollege studentactor shares first name with characterprankfemale removes her clothescheerleaderheart attackfemale stockinged legsgolfpot smokingsupermarketwhat happened to epiloguemobsterblockbusterladderwomanizerparadevirginitypeeping tomstupiditycamera shot of feetswitchbladegrocery storenicknameshopliftingmay december romanceblack eyewoman in underweardirector cameocafeteriaarmored carjukeboxbully comeuppanceneo naziman in underwearfraternitysororityhazingmarching bandstablechewing gumoverweightbra removingcollege campusneck bracereference to richard nixonshopping cartfood fightpillow fightpirate costumeinitiationpaddlepayphoneblowtorchcucumbernational lampoon seriesbinge drinkingstatutory rapegolf ballfootball fieldslip the undergarmentactor shares last name with characterschool expulsionmustardstealing foodunderagecollege freshmankilling a horsecollege deanephebophilemarblescheating on a testparade floattogaslobstudent councilpity sexdeadpan humorfraternity pledgejuke jointsmashing a guitarfraternity initiationtoga partycollege seniorfrat housedoor shut in facegroup dancerotcdisciplinary hearingfat insulthit with a golf ballrunning over a fire hydrantscene at a windowsensualhell week (See All) |
Having awoken from their spring break extravaganza at Lake Victoria, the swarm heads upstream where they look to make a meal out of Big Wet, a local water park where when it comes to fun, nobody does it wetter! Though they came to get wet, get loaded and get some, the staff and patrons get more than β¦ they bargained for when they must face the fiercest, most bloodthirsty piranhas yet. Lead by the strong-willed, studious Maddy and her friends, Barry and Kyle, the trio must dive in and take on these man-eating creatures using every ounce of their being but can they be stopped? (Read More)
Subgenre: | independent filmblack comedysuspenseabsurdismcreature featureteen moviesurvival horrormonster movie |
Themes: | escapedeathfriendshipfearvoyeurismseductionparanoiaunrequited loveexploitationpaniccouragemurder of a police officernear death experienceghost townfear of water |
Mood: | gorenightmarepoetic justice |
Locations: | hospitalswimming poolbathtubwaterwheelchairpolice carlakemotelsex in a carcar in waterwater pistolwater wellsex in vansex in a van |
Characters: | teenagerboyfriend girlfriend relationshipteenage girlpolice officerlove triangleinterracial relationshipsheriffex boyfriend ex girlfriend relationshipself mutilationstepfather stepdaughter relationship |
Period: | 2010ssummer |
Story: | braveryredneckactor playing himselfvansevered headdeath of frienddecapitationblood splattertelephone callsurprise endingfemale nuditynuditynumber in titlebloodmale nudity β¦violencebare breastssequelthreesomefemale frontal nuditymale rear nuditybare chested malekissfemale rear nudityfemale full frontal nudityexplosionpartyknifeleg spreadingchaseerectionpantiestopless female nuditycell phonecorpsedigit in titleurinationblondeshotgunrescueslow motion scenepunched in the facecondomundressingbikinisex in bedbare buttsunglassessecond partanimal in titlehandcuffsvoyeurstripperscientistf wordsubjective cameracleavagesurvivalgay slurflashlightmassacreambulancemontageimpalementfishno opening creditsscantily clad femalechild in perilhit by a carunderwater scenepolice officer killednews reportdrowningskinny dippingvirgindangerkeyattackdeath of childcollege studentskeletonscene during end creditsfarmerpremarital sexunderwatersevered armprofanityfireworkscowcorrupt copsingle parentgirl in pantiespickup truckkilling an animalno pantiesloss of virginityeggwalkie talkieloss of loved oneeccentricyoutubeflatulencecovered in bloodfroggrindhousecoituscgianimal attackinterracial friendshipeaten aliverampagedivingreverse footagecameofloodsevered finger3 dimensionalevacuationescape attemptblack and white scenecigarette lighterswamp3dsexploitationaccidental killingaerial shotarizonatitle at the endcastrationpiersevered legdeath of loved onetan linecopulationblack bra and pantiesfast motion scenemarijuana jointblood on camera lensbriberybloopers during creditsvomitdead animalblue pantiesnudecrutchesstepfatherautographvulgarityamputeewhistlefish tanknude girlhead bashed indeputywoman in bra and pantiesman in swimsuitdeath of boyfriendsole black character dies clicheextreme violencewet t shirtgraphic violencewoman in a bikinilifeguardcamera phonebloody violencetongue in cheeksong during end credits3d in titleanimal killingstupid victimkeyboardgas explosionfemale in swimsuitexcrementsexual innuendodouble entendresurprise during end creditsmascotwoman punches a manfemale explicit nudityfossilface ripped offpiranhanumber 3 in titleloss of boyfriendsevered penismass deathgory violencesequel to remakewater slidefish in titlehandcuffed to a pipebitten in the facetridentpenis bitten offpainful sexcorrupt sheriffwater parkbeheadeddead cowkiller animalmarine biologistmarine biologybitten on the legdecapitated childgiant fishhead bitten offaquaphobiakiller fishman vs naturecrying for helpchild killed by animalleg bitten offbitten in the armcinder blocktv advertbitten in the legfictional placebitten by a fishshark costumetitaniumcelebacyunderground lake (See All) |
Preston, Idaho's most curious resident, Napoleon Dynamite, lives with his grandma and his 32-year-old brother (who cruises chat rooms for ladies) and works to help his best friend, Pedro, snatch the Student Body President title from mean teen Summer Wheatley.
Subgenre: | cult filmindependent filmteen movie |
Themes: | friendshipdanceweddingtime travelbullyingphotography |
Mood: | satirehigh school |
Locations: | small townrestaurantbicyclemexicoschool busmotorcycle accidentbus stationschool dancebicycle accident |
Characters: | family relationshipsmother son relationshipfriendboyfriend girlfriend relationshipsingerbrother brother relationshipboyteenage boygirldancerphotographerbullycousin cousin relationshipuncle nephew relationshipgrandmother grandson relationship |
Story: | dynamitevananti herorifletelephone callsingingdancingcharacter name in titlephotographtitle spoken by charactercell phonefoodhorseface slapshot in the head β¦shotgunwatching tvcomputercameracafeclassroomgangbasketballinternetdrawingmicrophonelocker roompay phonedollbraceletfarmerconvertiblewigelectionchickenclasscownerdkilling an animaleggcakeoverallsamerican footballmilkinterracial friendshippicnicinterracial romancehit in the crotchkickingrejectiontitle appears in writingfootball playerlionsalesmantigermustachenotebowlingsign languageshaved headsurprise after end creditsmexican americanvideo tapewedding ceremonycafeteriatime machinetaekwondoloserboy with glassesmedalself defensepeer pressureinterracial marriagemisfitanimal abuseinterracial kissbowling alleyfootsie under the tablewhite trashbased on short filmjockutahroller skateswatching a videofamous lineschool lifeonlinewater fountaintrack and fieldmirror ballidahogeneration ysand dunepinatahensteakcyberspaceschool lockerbelchdune buggyvestwolverinename tagllamapopular girlhamkeychainmale to female footsie playingchicken farmnunchuckstallionreference to loch ness monsterspanish accentclass presidentinternet romancecorsageinternet chatroomhigh school electionlying about one's ageschool auditoriumtetherballblowing nosejuarez mexicochicken farmersleeper hit (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
Subgenre: | cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
Themes: | escapemurderdeathfriendshiprevengesurrealismfearmonstervoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness β¦murder of a police officermurder of family (See All) |
Mood: | goresatirenightmaremurder of a boy |
Locations: | hospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtrucktaxi driver β¦laboratorysex in shower (See All) |
Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
Period: | 1980s |
Story: | severed handfilm within a filmknocked outvansevered headdeath of frienddecapitationrifleblood splattersurprise endingsexfemale nuditynuditybloodmale nudity β¦violencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested malesex scenefemale rear nuditycigarette smokingknifechaseshowertopless female nuditydreamcorpseshot to deathmachine guncar accidentshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameracleavagegay slurambulancemontagethroat slittingsuicide attemptsubwayjokedream sequencescantily clad femalehit by a carnews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
Six friends are on their way to a football game. They decide to camp out for the night and continue driving the next day. The next day the friends find that they're having car troubles, so two of the friends accept a stranger's ride into a small town named Ambrose. The main attraction in Ambrose is β¦the House of Wax. Except something is not right in this town, the wax figures are so realistic and the whole town is deserted - except for two murderous twin brothers. The six friends must fight to survive and escape from being the next exhibits in the House of Wax. (Read More)
Subgenre: | psycho thrillerslasher flickaustralian horrorteen horror |
Themes: | escapemurderdeathtorturefuneralbrutalityyouthabusecampingghost town |
Mood: | goreslasherhorror movie remake |
Locations: | small townchurchforestroad tripcampfire |
Characters: | boyfriend girlfriend relationshipdoctorbrother brother relationshipbrother sister relationshipserial killerpriesttough guyinterracial relationshipvillainsheriffslasher killer |
Story: | redneckbaseball batsevered headdeath of frienddecapitationsurprise endingbloodmale nudityviolencemale rear nuditybare chested malefighttitle spoken by characterknifechase β¦three word titlepantiesfirecryingcell phonecorpseshot in the chesturinationface slapshot in the headshotgunundressingbare buttvomitinglingeriegood versus evilbravideo cameraimpalementstabbed to deathstabbed in the chestchild abusescantily clad femalebeaten to deathstripteaseperson on firetentkicked in the faceinjectionpremarital sexsevered armshot in the armtwinsyringebow and arrowlifting someone into the airgroup of friendsloss of friendamerican footballhidingfloridasevered fingercrossbowgash in the facestabbed in the necktitle appears in writingscissorsstabbed in the legred pantiesbody countcharacters killed one by onetank topcar troublegroupmysterious manold dark housestrandedtrafficthong pantiesstabbed in the armtraffic jaminterracial kissslappingdisfigured facesiblingsiblingsdeformitywrongful imprisonmentsadistic psychopathstupid victimburning buildinglifting female in airgpscar mechanicstabbed in the footstabbed in the sideroadkillsiamese twinsbludgeoned to deathbowie knifewaxhypodermicimpaled through the headsuper gluewax figure (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | cult filmindependent filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror |
Themes: | escapemurderdeathfriendshipkidnappingfeartorturepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation β¦paniccannibalisminheritancemadnessnear death experience (See All) |
Mood: | avant gardeslasherdarknessambiguous ending |
Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
Characters: | family relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillervillainterrorself mutilationtruck driverslasher killer β¦serial murdererself inflicted injury (See All) |
Period: | 1970syear 1973 |
Story: | redneckchainsawcountrysideknocked outgraveyardvandeath of frienddecapitationblood splattersurprise endingbloodviolencephotographknifechase β¦voice over narrationbeatingcorpseurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegesurvivalfoot chaseflashlightbound and gaggedambushmassacreimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversynews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manskeletonscardeath of brotherhairy chesttragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampagewoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
The Ultimate Western Spoof. A town where everyone seems to be named Johnson is in the way of the railroad. In order to grab their land, Hedley Lemar ('Harvey Korman' (qv)), a politically connected nasty person, sends in his henchmen to make the town unlivable. After the sheriff is killed, the town d β¦emands a new sheriff from the Governor ('Mel Brooks' (qv)). Hedley convinces him to send the town the first Black sheriff ('Cleavon Little' (qv)) in the west. Bart is a sophisticated urbanite who will have some difficulty winning over the townspeople. (Read More)
Subgenre: | cult filmslapstick comedymadcap comedy |
Themes: | drunkennessdrugsfilmmakingheroracismunlikely hero |
Mood: | satirespoofbreaking the fourth wallwestern spoof |
Locations: | small townchurchlos angeles californiabathtubdesertwheelchaircampfire |
Characters: | prostituteafrican americansingerdancermusicianactorwarriornative americaninterracial relationshipsherifffilm directorself referential |
Period: | 19th century1870s |
Story: | stereotypedynamitefilm within a filmactor playing multiple rolessurprise endingsingingdancingflashbackkissexplosionchasesongshootoutfistfightmirror β¦blondeface slapgunfightbrawlshowdownlingeriemarijuanapianojailrevolvergood versus evilcleavagegay slurdisguiseprisonerscantily clad femalepantyhosecigar smokinglooking at the camerabartenderracial slurlimousinecowboywritten and directed by cast memberevil manhangingstageblack americanchessred dresscowboy hatblockbusterflatulenceorchestrastupiditymovie theatreabsurd humorbackstageshoveltheatre audienceoutlawmusical numbersexy womanpastorethnic slurcrude humorplaying cardsgartercamelceremonysidekickcannabiscafeteriamini dressquick drawgovernorpopcorncattlegunslingerdrunkardanimal abusecowboy bootssaloonrailroadreluctant heromarching bandmovie studion wordfriends who live togetherpunspittelegramoutlaw gangsix shooterku klux klanred brahorse and wagonanachronismshot in the crotchwanted postergunfighterfinger gunsmoking potsnoringphysical comedyshowgirlcolt .45lassorailroad trackcowboy shirtoathwestern towncomic herocomic violencecowboys and outlawsgallowswhite horsereference to friedrich nietzscheexecutionerwestern heroquicksandmeta filmmultiple cameosnylonsbell towertalking to the audiencelispburpingmarqueeballadeerbimbosound stagebig bandfrontier townderringerhangmanmovie reality crossoverfunny accentgrauman's chinese theaterjewish humorinterrupted hangingsinger offscreenwagon trainsaloon girlchess setgun shot out of handreference to cecil b. demillepie fightreference to louis pasteurreference to douglas fairbanksbaked beansblack cowboychanteusereference to jesse owensfamous entrancereference to w.c. fieldssioux indianreference to hedy lamarrstudio tourwestern unionyear 1874cootpaddleball (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ β¦le'. (Read More)
Subgenre: | martial artsblack comedyabsurdismspy spooflow comedyspy comedy |
Themes: | escapedrunkennessmurderdeathfriendshiprevengekidnappingdrugsbetrayalfeartorturedanceweddingdeceptionseduction β¦brutalityterrorismparanoiadrug usesurveillancepaniccannibalismamnesiaself sacrificetechnologynear death experience (See All) |
Mood: | goresatireraincar chasejames bond spoof |
Locations: | hospitalnew york citybarforestcarhelicoptersnowairplanelondon englandwatertaxiwoodsapartmentpolice caritaly β¦englandjungletaxi driverlaboratorysewercable car (See All) |
Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshiptattoosingersoldierhostagelawyertough guywarrioraction herosecurity guardamerican abroad β¦older woman younger man relationshipex boyfriend ex girlfriend relationshipex soldieramerican in the uk (See All) |
Period: | 2010s |
Story: | rednecksevered handbaseball batknocked outanti herodeath of friendalcoholrifleblood splattersurprise endingsingingdancinggunbloodviolence β¦sequelflashbackdogbare chested malefightcigarette smokingphotographtitle spoken by characterexplosionknifechasepistolcell phoneshootoutbeatingshot to deathfistfightmachine gunhorsecar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewatching tvcomputercondombattlearrestgunfightbrawlpaintingbased on comicshowdownheld at gunpointhand to hand combatsunglassesbombsecond partbedcar crashinterrogationrobotpianohallucinationhandcuffsbritishrevolverfightingshot in the backf wordsubjective cameragood versus evilspybraassassinbased on comic bookambushstrangulationaxemountainambulancemansiondrug dealermontageimpalementfour word titlemixed martial artsdinertoilettied to a chairmapdinnerexploding carfalse accusationman with glassesno opening creditsdisarming someonedouble crossunderwater scenekingfemme fatalenews reportprincessmarriage proposalshot in the foreheadbartenderlatex glovesattempted murderone against manydrug addictorganized crimecharacter repeating someone else's dialoguebeaten to deathdangerelectrocutioncowboypay phoneumbrellacharacter's point of view camera shotmissionundercoverproduct placementrace against timesuitcasestatuetentkicked in the faceu.s. presidentopening action scenestreet shootoutshot in the shouldermanipulationscaramerican flagbodyguardinjectiontragic eventexploding bodylaptopneck breakingcharacter says i love youthreatened with a knifecabinmercenarysemiautomatic pistolsevered armprofanitygeneralhandgunsecret agentobscene finger gestureespionagequeensubtitled sceneheroinbattlefieldwashington d.c.stylized violencehenchmanmaniaceyeglasseseavesdroppingmissiletraitorgoldshavinghand grenadesabotagefireplacedestructionbullethead buttassassination attemptwarehousehypodermic needlelooking at oneself in a mirrordrugwoman with glassessociopathdiseaseviruscowboy hatloss of friendsecurity camerawalkie talkieexploding buildingkicked in the stomachcaucasianmovie theatervillainesseccentricwristwatchphone boothculture clashdriving a carrocket launcherwhite housegun fuinterracial friendshipcrushed to deathsocial commentaryback from the deadbar fightandroidmexicanpresumed deaddrug overdosethugwhiskeybra and pantiesreverse footageshieldcameofloodexplosivefight to the deathdual wieldwhipmercilessnesspool tableresurrectionshot in the facejunkiecigarette lightermarvel comicspunched in the chestsafebutterflyassault rifleinfectionaccidental killingaerial shotknife fightparachutewisecrack humorhologramundercover agentbody landing on a carraised middle fingersiegemustachered pantieseye patchbowlingbroken armstadiumpuppytourgadgetterrorist plotburned to deathgunfirecrude humorswearingdrug lordmoral dilemmagatling gungrenade launchermedia coveragesouthern accenttorso cut in halftracking devicememory lossenglishman abroadtext messagingdesert eaglebazookareference to elvis presleygay manfinal showdownreturning character killed offbongparalysisstuffed animalreference to facebookabuse of powerarmored carsuit and tiecomputer crackerworld dominationdroneamputeemegalomaniacyoung version of characterfemale spyunited kingdomcowboy bootscambodiaanarchysalooncomputer hackerfighter jetbowling alleystrong languagebaseball caphamburgerstatue of liberty new york citycrashing through a windowmeat cleaversaving the worldtour guidefight the systemfinal battletop secretteamworkfilmed killingtwo way mirrorhigh techreference to twittermusic festivalsuperhuman strengthcurerogue agentcar radioexploding housetragic pastspy heroman wearing glassessix shootercut into piecesdrug cartelcamera phonealpsred brafemale bartendertailorimprovised weaponshot through a doorvice presidentbarrelanimal killingbreaking a bottle over someone's headknocked out with a gun buttarmorywiretappingbilingualismsurveillance footagechrysler building manhattan new york citythrown from a carepic battlemartiniscottish accentlandminecryogenicsswedishkentuckyloss of memoryslow motion action sceneantidotegadgetrysexual innuendodetonatorhit with a chairlassodouble entendrecowboy shirtsecret organizationbrandinggadget carbig ben londonbritish actor playing american characterzero gravityone eyed manshot through a wallbroken handmanor houseprosthetic limbblond hairflash drivenanotechnologycaged humanthrown through a windshieldbowling ballbroken windshieldeye injuryover the topsecret laboratorycar stuntcratervintage carsex joketwo against onegolden gunreference to instagramspectaclescirclecut in halfsinkholeukmeat grindersalonlost citymountain cabinpugsecret headquartersfemale sociopathamnesiachit with a fire extinguisherspray canrobot dogtooth knocked outhousing estatepiccadilly circus londoncriminal organizationsecret hideoutamphibious vehicleends with weddingexploding eyeknife in shoewhiskyblow darticon comicssmashed car windshieldimpeachmentretrograde amnesiabreaking a car windshieldarmorerdrug userminesweepermetal handpirate broadcasttailor shopweapons cabinetglastonburymetal armreference to john denverreference to tinderrobotic armteam workthrown through windshieldgoing through windshield (See All) |
Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t β¦rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)
Subgenre: | independent filmblack comedyconspiracysupernaturalparanormal phenomena |
Themes: | escapemurderdeathrevengesurrealismkidnappingghostfearheroinvestigationdeceptionmemorysupernatural powerterrorismparanoia β¦redemptionsurveillancehome invasionpanicpolice brutalitynear death experienceafterlifeunlikely hero (See All) |
Mood: | neo noirnightmaredarknesspoetic justice |
Locations: | small townhospitalrestaurantchurchswimming poolbathtubdesertwheelchairapartmentpolice carmotelsinging in a carcar bombdesert town |
Characters: | prostitutehusband wife relationshippolicemother daughter relationshipboyfriend girlfriend relationshipdoctortattoopolice officernursepolicemanhostagetough guywarriorsingle motherwaitress β¦security guardsheriffpolice shootoutdeath of girlfriend (See All) |
Period: | seeing the future |
Story: | fictional townbaseball batknocked outvansevered headdemonblood splattersurprise endingcharacter name in titlebased on novelbloodviolenceflashbackdogtwo word title β¦kissfightcigarette smokingphotographtitle spoken by characterexplosionpartyknifechasepistolfirevoice over narrationcell phoneshootoutbeatingdreamcorpseshot to deathfistfightmachine gunhorsecar accidentshot in the chestshot in the headrescueslow motion scenepunched in the facecomputerwritten by directorarrestgunfightbrawlsecretshowdownheld at gunpointbombcar crashhandcuffsrevolvershot in the backgood versus evilfoot chasebound and gaggedcaliforniaterroristmassacremontagedinerexploding carfalse accusationcultno opening creditsbirddisarming someoneone man armychild in perilhit by a cardouble crosscreaturepolice officer killedattempted murderlimousinecursedangerscreamingperson on fireuniformproduct placementrace against timecover upopening action sceneshot in the shouldermanipulationexploding bodymanagercharacter says i love yousevered armshot in the armlas vegas nevadasilencerpsychiccorrupt copfreeze framesingle parenttwenty somethingprivate detectiveeavesdroppingburned aliverevelationeggslow motionsociopathice creamcooksecurity cameraloss of loved onespiderskullcarnivalfateanimal attackpicnicmasked mancrime scenedamsel in distressstealing a carvisionexplosivesevered fingershot in the faceshopping mallm 16police officer shotescape attemptframe uptime lapse photographybutterflyassault riflewisecrack humorblood on shirtbulletproof vestrefrigeratorbarbecuedemonic possessionterrorist plotfortune tellerkilling spreedeath of loved oneburned to deathowlnewspaper clippingframed for murdershot multiple timesprivate investigatorbullet timehit with a baseball batshot through a windownarrated by characterinvisibilitymysterious manterrorist grouppickpockettimebombfountainold dark housecockroachevil spiritpolice chiefportaldisposing of a dead bodyyoung version of charactermalltrailer homescootercheering crowdhearing voiceselvis presleyflybody in a trunkhit by a truckdeputybowling alleypremonitionman kills a womanoffscreen killingpool partyshot point blankbullet woundmeteorbomberpart computer animationtragic lovehiding under a bedexploding housewoman in a bikinitragic endingcarouselanimal killingvillain not really dead clichelocketinnocent person killedclairvoyantgas explosionpoltergeistwater fountainpancaketoothmusic storetime bombice cream conefingerdecomposing bodyrunning for your liferescue attemptchild killerloss of girlfriendjumping from a carcamel toerottweilersatanic culttiredevil worshipgas chamberblowing a kissclairvoyancestartledable to see the deadbirdcagechased by a dogdomestic terrorismmilkshakesatanicseeing dead peoplewalking on waterdead body in a bathtubice cream parlorstorm drainpushed into a swimming poolexploding trailerhouse explosioncoitus interruptuscontemporary settingbarbecue grillsevered toesweethearthomemade explosiveseeing ghostscamera shot of a woman's legshotwiringshort order cookabandoned prisonice packwoman wearing a little black dressbody in a car trunkbreak door incar truck crashbluetoothdevil worshiperfalling into swimming poolvehicular accidentchurch towerdriver shotdriving licensevan explosionreloading a gunfortune telling machinehorse rideshot in facetruck car collisionabandoned restaurantsupernatural ability (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
Subgenre: | cult filmmartial artsblack comedychristian horror |
Themes: | drunkennessmurderdeathrevengekidnappingbetrayalprisonfeartorturedeceptionvoyeurismangersupernatural powerpanicvengeance β¦murder of a police officerghost town (See All) |
Mood: | gore |
Locations: | small townbartrainchurchhoteldesertelevatormotelgas stationcampfirenew mexico |
Characters: | prostitutepolice officerpriesthostagetough guyvampireaction heroevil priest |
Period: | 1990s |
Story: | severed handknocked outanti herosevered headdecapitationblood splatterfemale nuditybased on novelnuditybloodviolenceone word titlebare breastsfemale frontal nudityfemale rear nudity β¦cigarette smokingphotographtitle spoken by characterexplosionpartyknifechasepistolfiretopless female nuditybeatingcorpseshot to deathmachine guncar accidentshot in the chesturinationblondeface slapshotgunrescueslow motion scenepunched in the faceshowdownheld at gunpointcar crashinterrogationprostitutionvoyeurprayerrevolvershot in the backsubjective cameragood versus evilcleavagegay slurbound and gaggedaxemassacreambulancethroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapscantily clad femaleritualsearchnews reportcigar smokingshot in the legtransformationshot in the foreheadpaingunshotlegendbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firemini skirtpay phonecharacter's point of view camera shotmissionlightningscreamshot in the shoulderpursuitcrossexploding bodyneck breakingtied upmercenaryshot in the armcult directorundeadpickup truckmachismowolfburned aliveno pantiesspearfarcemass murderjeepinjuryscene during opening creditsmutilationtied to a bedsecurity cameracrucifixhammerexploding buildingbuttocksphone boothskulleaten alivewatching televisionduct tape over mouthvisionthundercrossbowteamshot in the facehungershovelimmortalitycigarette lighterthrown through a windowslaughtergasolinelens flareburned to deathexorcismtelepathytorso cut in halfceremonystolen carsunsetcrucifixiongatebandagespit in the faceold dark housesuper strengthnudedisposing of a dead bodyfemale vampiregunslingernude girlbellsawed off shotgunlatinbitten in the neckman punching a womansunrisewindmillcarjackingriteiconvampire huntermind readingreliccamera focus on female buttvampire slayerfalling through the floorthroat rippingblood drinkingsuper speedsliced in twocardinal the priestnestarmored truckbitten on the armhand through chestmusic score composed by directorcablesteakstabbed in the heartburnt handstabbed in the foreheadover the topvampire bitevampire human lovemurdered priestcorrupt priestwooden stakebitten on the legpetrolvampire human relationshipfrenzysexy female vampirecauterizationmaster vampirenude woman tied uppadrerear end (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
Subgenre: | cult filmsupernaturalpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
Themes: | murderdeathprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer |
Mood: | gorecar chaseslasherdarknessbreaking the fourth wall |
Locations: | small townforestcemeteryboatwoodslakeamerica |
Characters: | policeteenagerzombieserial killerkillervillainsheriffterrorslasher killerserial murderer |
Period: | 1980s |
Story: | graveyardsevered headdecapitationdemonblood splattersurprise endingcharacter name in titlesexnumber in titleviolencesequelflashbackmasknumbered sequelflashlight β¦massacreambulancestabbingstabbed to deathchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmankillsummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh β¦ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)
Subgenre: | cult filmblack comedysuspenseconspiracypost modern |
Themes: | escapedrunkennessmurderdeathloverevengebetrayaljealousyinvestigationdeceptionpsychopathdeath of mothersurveillancehome invasiongreed β¦murder of a police officer (See All) |
Mood: | goresatirehigh schoolslasher |
Locations: | small townhospitalelevatorpolice station |
Characters: | husband wife relationshippoliceteenagerfemale protagonistserial killersheriffcousin cousin relationshipex boyfriend ex girlfriend relationshipself mutilationaunt niece relationshipself referentialshooting a police officer |
Period: | 2010s |
Story: | answering machinefilm within a filmknocked outdeath of friendblood splattersurprise endingnumber in titlebloodviolencesequelpartyknifechasepistolcell phone β¦corpsedigit in titleshot to deathshot in the chestrescuepunched in the facefalling from heightmaskbookheld at gunpointnumbered sequelf wordreporterfoot chaseflashlightbound and gaggedvideo cameradisguiseambulancethroat slittingstabbed to deathstabbed in the chesttied to a chairno opening creditspolice officer killedfemme fatalenews reportshot in the foreheadauthorcharacter repeating someone else's dialoguevirginstabbed in the backfired from the jobelectrocutionhigh school studentpolicewomansuspicionthreatened with a knifevigilantestrong female characterfalling down stairsrevelationsociopathfamegroup of friendsred dressbarnsecurity camerawalkie talkiestabbed in the stomachkicked in the stomachfourth partimpersonationpress conferencestrong female leadparking garagefemale killerduct tape over mouthcrime scenetensionunderage drinkingstabbed in the throatstabbed in the neckpunched in the stomachdeath threatstabbed in the legdisembowelmentbookstorebody landing on a carlens flarecharacters killed one by onedead woman with eyes opensequel to cult favoritemasked killermedia coveragelaptop computerintestinesstabbed in the handhiding in a closetreference to facebookwebcamstabbed in the armclimbing through a windowwhodunitfacebookdeputystabbed in the shouldersole black character dies clichefilmed killingcamcorderreference to twitterfemale cophiding under a bedspitting bloodbreaking through a doorshot in the crotchstupid victimvillain not really dead clichewoman in dangerbullet proof vestred herringdead woman on floormovie fantauntingdeeply disturbed personmystery killerpretending to be deadbook signingstabbed in the footdoorbellaccomplicebreaking down a doorbloggerdead teenagergeneration ydefibrillatorstartledstabbed in the bellystabbed in the foreheadclichepublicistmillennial generationthreatening telephone callfourth in seriesthrown through a glass doorunmaskingparty crashingmotivephone terrorreference to jeffrey dahmertelephone terrorweb camerathrown off a balconyreference to bruce willissudden disappearanceschool clubstabbing a womanhiding evidencemise en abymestabbing a police officerself inflicted woundcrashing through windowgarage door openerwatching a horror movieactress shares last name with characterdraw bladerunning into a wall (See All) |