Please wait - finding best movies...
A community of mutant outcasts of varying types and abilities attempts to escape the attention of a psychotic serial killer and redneck vigilantes with the help of a brooding young man who discovers them. Based on the novel "Cabal" by Clive Barker.
| Subgenre: | creature featurechrist allegorydark fantasystop motion animationsupernaturalsuspenseblack comedycult filmmartial artsindependent film |
| Themes: | police brutalitysupernatural powerunlikely heromurder of familynear death experiencemurder of a police officerself sacrificeprejudicehopeexploitationhome invasionfaithinsanityredemptionparanoia …brutalitypsychopathangerdeceptioninvestigationmonsterescapedrunkennesstorturefearghostbetrayalkidnappingsuicidesurrealismmurderdeathrevengelove (See All) |
| Mood: | darknessnightnightmaregore |
| Locations: | gas stationcavemotelcanadapolice carpolice stationcemeterybarhospital |
| Characters: | police detectivepolice shootoutshooting a police officerpolice sergeantself cuttingcoronerself mutilationbiblepsychiatristvillaintough guyhostagepriestdetectivepolice officer …nurseserial killersingertattoodoctorboyfriend girlfriend relationshipmother daughter relationshippolice (See All) |
| Period: | 1990s1980s |
| Story: | mass murdererhuman skeletonhomicidal maniacfactory workeralberta canadaanimal attackdouble impalementrope bridgebible quotejail cellwrongful arresthuman monsterrecurring dreamcar set on firethrowing knife …knife in chestmale in showerhunting knifedream sequenceknife held to throatfemale singerperson on fireknife fightoutrunning explosionknife throwingmad doctortopless female nuditythreatened with a knifefoot chasekiss of deathpolice officer bombeddumb policekilled in police carfriend murderedspontaneous human combustionmurdered friendidentifying dead bodycop killed by a cophole in a wallpolice vigilantismlighting a cigarface slashedscenic beautyiron gateford pickupleather maskhouse of cardsfalling into a holeface burnadaptation directed by original authorstabbed through the chesttortured to deathdrinking bloodhole in chestpoison dartbetrayedtrip wirevoice recordinghockey gamehandprintexposed brainporcupineinitiation ritehand through chestcaged humanpoison gasdeityspikescalpingrunning for your lifebuilding collapseface ripped offsunlightfalling through the floortaxidermymodern westerncut armmausoleuminvulnerabilitygarrotegraphic violenceknocked out with a gun buttinnocent person killedangry mobbanishmentfight the systemclimbing out a windowthroat cutcityscapelandmineglowing eyesanimal killingstupid victimimprovised weaponcryptburn victimarmoryvending machinetommy gunku klux klanschizophrenicstabbed in the facepolice captaindeformitywalking deadjailbreaksubterraneanstabbed in the shoulderopen endedcrotch grabwoman in lingeriedisembodied headbullet woundpolice officer shot in the chestbitten in the neckoffscreen killingmercy killingexploding truckone linerhit by a trucktentacledruggedman in underwearshamanburnt facekittenlsdsecret societyhideoutsuper strengthhangovermilitiaspiral staircasearmored carabuse of powerframed for murderstuffed animalburned to deathpolice inspectorbaptismpsychopathic killermental patientoutcastbad guysunsetyellingshot multiple timestombblood on shirtmoral dilemmafight to the deathmasked killerkilling spreeflamethrowerlasersightbody countbody landing on a carmutationeye gougingsiegewisecrack humortribedisfigurementbooby trapslaughterpunched in the chestdiscriminationdynamiteframe upkicked in the crotchgash in the faceimmortalityprophecynippleresurrectionchaosmercilessnesshatredstealing a carticklingreverse footageexplosivecamera shot of feetvisionmental institutioncrime sceneswitchbladepresumed deadsocial commentaryback from the deadredneckrampagemasked manrocket launcherpress conferenceskullgrindhousekicked in the stomachswat teamexploding buildingspiderlifting someone into the airmorguebarnragetape recordermutantsociopathmachetegothicburned alivefalling down stairshand grenadeanswering machinechild murderdestructiondestinypickup truckak 47maniacnewspaper headlinebattlefieldundeadcult directorvigilanteshot in the armsevered armdie hard scenarioneck breakingmurdererexploding bodyshot in the shoulderscarkicked in the faceskeletonknocked outcharacter's point of view camera shotevil manrace against timeproduct placementstatuebeaten to deathfactoryattackstabbed in the backscreamingone against manypolice officer killedshot in the foreheadbartendershot in the legtransformationcigar smokinggraveyardcreaturedouble crossfictional warchild in perilhit by a cardrawingcoffinanti herofalse accusationsevered headexploding carsnaketied to a chairstabbed in the cheststabbed to deathdeath of friendmixed martial artsthroat slittingimpalementbridgemontagestabbingmassacretoplessstrangulationambushgood versus evilsubjective camerasurvivaldecapitationshot in the backf wordtelephonerevolverhallucinationjaildemoninterrogationcar crashhand to hand combatbombsunglassesheld at gunpointrifleshowdownvomitingfalling from heightbrawlgunfightarrestswordbattlewritten by directorcatwatching tvpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsedreambeatingshootoutfireshowerpistolsurprise endingchaseknifeexplosiontitle spoken by characterphotographnipplescigarette smokingfemale nuditybare chested malebased on novelone word titlebare breastsnudityflashbackdogfightbloodviolence (See All) |
A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.
| Subgenre: | suspenseblack comedycult filmindependent film |
| Themes: | supernatural powernear death experiencemurder of a police officerinsanityredemptionpsychopathdeceptioninvestigationescapedrunkennessfearbetrayalkidnappingrevengemurder …death (See All) |
| Mood: | nightgore |
| Locations: | gas stationmotelpolice carpolice stationbar |
| Characters: | police shootoutshooting a police officerhostagepolice officertattoopolice |
| Period: | 1980s |
| Story: | mass murdererhuman monsterperson on fireknife throwingthreatened with a knifefoot chaseface burninitiation ritesunlightinvulnerabilityinnocent person killedvending machinepolice officer shot in the chestbitten in the neckexploding truck …one linerhit by a truckburnt facesuper strengthburned to deathblood on shirtmoral dilemmasiegedisfigurementpunched in the chestimmortalitymercilessnessstealing a carreverse footageredneckbarnsociopathgothicburned alivepickup truckundeadneck breakingexploding bodyscarrace against timeproduct placementscreamingpolice officer killedshot in the foreheadbartendershot in the legcigar smokingtransformationdouble crosschild in perilhit by a carexploding carstabbed in the cheststabbed to deaththroat slittingmassacrestrangulationgood versus evilshot in the backf wordrevolversunglassesheld at gunpointrifleshowdownvomitingbrawlgunfightwatching tvpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosioncigarette smokingbare chested malebloodviolencedogfight (See All) |
Though safely entombed in a crypt deep beneath the unforgiving desert, an ancient princess, whose destiny was unjustly taken from her, is awakened in our current day bringing with her malevolence grown over millennia, and terrors that defy human comprehension.
| Subgenre: | dark fantasysupernaturalblack comedymartial arts |
| Themes: | supernatural powerunlikely heromurder of familynear death experienceself sacrificeredemptionparanoiaangerdeceptionmonsterescapefearghostbetrayalkidnapping …revengemurdersurrealismdeath (See All) |
| Mood: | darkness |
| Locations: | police carcemetery |
| Characters: | self mutilationtough guyhostagepriestpolice officertattoodoctorpolice |
| Story: | human monstermad doctorthreatened with a knifefoot chasestupid victimcryptimprovised weaponsubterraneanopen endedbitten in the neckoffscreen killingsecret societyarmored cartombmoral dilemma …fight to the deathwisecrack humorpunched in the chestimmortalityresurrectionmercilessnessreverse footagevisioncrime sceneback from the deadrampageskullkicked in the stomachspidermorguetape recordergothichand grenadedestructiondestinypickup truckak 47battlefieldundeadscarskeletonknocked outcharacter's point of view camera shotrace against timeproduct placementstatuebeaten to deathattackscreamingpolice officer killedshot in the legtransformationdouble crosscoffinanti herostabbed in the cheststabbed to deathdeath of friendmixed martial artsthroat slittingmassacrestrangulationambushgood versus evilsubjective camerashot in the backhallucinationcar crashhand to hand combatsunglassesheld at gunpointshowdownbrawlgunfightbattlepunched in the faceslow motion scenerescueshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsedreambeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested malefightflashbackdogbloodviolence (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | black comedycult filmindependent film |
| Themes: | police brutalitymurder of familynear death experiencemurder of a police officerself sacrificeexploitationinsanityparanoiabrutalitypsychopathangerdeceptionescapetorturefear …betrayalkidnappingsuicidedeathmurderrevenge (See All) |
| Mood: | nightmaregore |
| Locations: | gas stationmotelpolice stationbar |
| Characters: | police shootoutvillaintough guyhostagepolice officernurseserial killertattooboyfriend girlfriend relationshipmother daughter relationshippolice |
| Story: | mass murdererhomicidal maniachuman monsterdream sequenceknife throwingthreatened with a knifefoot chasepolice vigilantismmodern westerngraphic violenceinnocent person killedhit by a truckpsychopathic killerbad guyblood on shirt …killing spreebody countsiegewisecrack humordisfigurementslaughterpunched in the chestmercilessnesshatredstealing a carcrime sceneredneckrampagemasked mangrindhousekicked in the stomachragemaniaccult directorshot in the armneck breakingmurderershot in the shoulderknocked outevil manbeaten to deathattackstabbed in the backscreamingpolice officer killedshot in the foreheadshot in the legcigar smokingdouble crosschild in perilanti herotied to a chairstabbed in the cheststabbed to deathdeath of friendthroat slittingimpalementstrangulationambushsurvivalshot in the backf wordrevolverjailinterrogationheld at gunpointrifleshowdownvomitinggunfightarrestwritten by directorpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsedreambeatingshootoutfireshowerpistolchaseknifeexplosiontitle spoken by characterphotographcigarette smokingbare chested maleflashbackbloodviolencedog (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
| Subgenre: | suspenseblack comedymartial artsindependent film |
| Themes: | police brutalitysupernatural powernear death experienceself sacrificeexploitationhome invasioninsanitybrutalitypsychopathdeceptionescapedrunkennesstorturebetrayalkidnapping …revengesurrealismdeathmurder (See All) |
| Mood: | gore |
| Locations: | police carbar |
| Characters: | police shootoutself mutilationtough guyhostagetattoodoctorpolice |
| Story: | person on fireknife throwingtopless female nudityfoot chasehand through chestinvulnerabilityinnocent person killedknocked out with a gun buttthroat cutimprovised weaponarmorytommy gunstabbed in the facestabbed in the shoulderbullet wound …offscreen killingsuper strengtharmored carburned to deathshot multiple timesfight to the deathkilling spreeflamethrowerbody countbody landing on a careye gougingdisfigurementpunched in the chestresurrectionchaosmercilessnessstealing a carback from the deadrampagemasked manrocket launchergrindhousekicked in the stomachsociopathmacheteburned alivehand grenadedestructionak 47shot in the armsevered armneck breakingexploding bodyshot in the shoulderkicked in the faceknocked outcharacter's point of view camera shotevil manbeaten to deathattackstabbed in the backone against manypolice officer killedshot in the foreheadshot in the legdouble crosshit by a caranti herosevered headexploding cartied to a chairstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmontagemassacrestrangulationambushgood versus evilsubjective camerasurvivaldecapitationshot in the backf wordrevolverinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlewritten by directorcatpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosioncigarette smokingfemale nuditybare chested malebare breastsfightdogbloodviolenceflashback (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | martial arts |
| Themes: | self sacrificehopeinsanityredemptionparanoiabrutalityangerdeceptionmonsterescapefearbetrayalkidnappingmurderrevenge …death (See All) |
| Mood: | nightmaregore |
| Characters: | biblehostagedoctorboyfriend girlfriend relationship |
| Story: | animal attackperson on fireknife throwingmad doctorthreatened with a knifespikefight the systemlandmineanimal killingarmorysubterraneanopen endedbitten in the necksuper strengtharmored car …burned to deathfight to the deathbody landing on a carbooby trappunched in the chestchaosmercilessnesshatredstealing a carsocial commentaryrocket launcherkicked in the stomachsociopathmacheteburned alivehand grenadedestructionak 47battlefieldundeadshot in the armsevered armexploding bodyshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotevil manrace against timebeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legcreaturedouble crossfictional warsevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushgood versus evilsurvivalsubjective cameradecapitationshot in the backinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionfightdogviolencebloodflashback (See All) |
Set within a year after the events of Batman Begins, Batman, Lieutenant James Gordon, and new district attorney Harvey Dent successfully begin to round up the criminals that plague Gotham City until a mysterious and sadistic criminal mastermind known only as the Joker appears in Gotham, creating a n …ew wave of chaos. Batman's struggle against the Joker becomes deeply personal, forcing him to "confront everything he believes" and improve his technology to stop him. A love triangle develops between Bruce Wayne, Dent and Rachel Dawes. (Read More)
| Subgenre: | christ allegorysuspensecult filmmartial arts |
| Themes: | police brutalitynear death experienceself sacrificehopehome invasioninsanityparanoiabrutalitypsychopathangerdeceptioninvestigationescapetorturefear …betrayalkidnappingrevengelovemurderdeath (See All) |
| Mood: | darknessnight |
| Locations: | police stationbarhospital |
| Characters: | police detectivepolice shootoutvillaintough guyhostagedetectivepolice officernursetattoodoctorboyfriend girlfriend relationshipmother daughter relationshippolice |
| Story: | mass murdereranimal attackjail cellwrongful arresthuman monstercar set on fireperson on firethreatened with a knifeface burnknocked out with a gun buttinnocent person killedfight the systemimprovised weaponburn victimjailbreak …open endedoffscreen killinghit by a truckburnt facearmored carburned to deathmoral dilemmakilling spreelasersightbody landing on a carbooby trappunched in the chestdynamitegash in the facechaosmercilessnesshatredexplosivecrime scenepresumed deadsocial commentarymasked manrocket launcherpress conferenceswat teamkicked in the stomachexploding buildinglifting someone into the airsociopathgothicburned alivefalling down stairshand grenadedestructionak 47maniacnewspaper headlinevigilantedie hard scenarioexploding bodyscarkicked in the faceknocked outcharacter's point of view camera shotevil manrace against timebeaten to deathone against manypolice officer killedbartendercigar smokingdouble crosschild in perilhit by a caranti herofalse accusationexploding cartied to a chairdeath of friendmixed martial artsimpalementbridgemontageambushgood versus evilsubjective camerashot in the backrevolverinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointrifleshowdownfalling from heightbrawlgunfightarrestwritten by directorpunched in the faceslow motion scenerescueshotgunshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosiontitle spoken by characterbare chested malefightdogbloodviolence (See All) |
In 2029 the mutant population has shrunken significantly and the X-Men have disbanded. Logan, whose power to self-heal is dwindling, has surrendered himself to alcohol and now earns a living as a chauffeur. He takes care of the ailing old Professor X whom he keeps hidden away. One day, a female stra …nger asks Logan to drive a girl named Laura to the Canadian border. At first he refuses, but the Professor has been waiting for a long time for her to appear. Laura possesses an extraordinary fighting prowess and is in many ways like Wolverine. She is pursued by sinister figures working for a powerful corporation; this is because her DNA contains the secret that connects her to Logan. A relentless pursuit begins - In this third cinematic outing featuring the Marvel comic book character Wolverine we see the superheroes beset by everyday problems. They are aging, ailing and struggling to survive financially. A decrepit Logan is forced to ask himself if he can or even wants to put his remaining powers to good use. It would appear that in the near-future, the times in which they were able put the world to rights with razor sharp claws and telepathic powers are now over. (Read More)
| Subgenre: | christ allegorysuspensemartial arts |
| Themes: | supernatural powermurder of familyself sacrificehopehome invasionredemptionparanoiabrutalityangerdeceptionescapedrunkennesstorturefearbetrayal …kidnappingmurderdeathrevenge (See All) |
| Mood: | darknessnightmaregore |
| Locations: | gas stationmotelpolice carcemeterybarhospital |
| Characters: | self mutilationtough guyhostagenursedoctorpolice |
| Story: | topless female nuditythreatened with a knifefoot chaseface burnstabbed through the chestmodern westerninvulnerabilitygraphic violenceinnocent person killedknocked out with a gun buttfight the systemstabbed in the facestabbed in the shoulderbullet woundoffscreen killing …exploding truckhit by a trucksuper strengtharmored caryellingblood on shirtmoral dilemmafight to the deathkilling spreebody countbody landing on a carwisecrack humorpunched in the chestimmortalitynipplemercilessnesshatredstealing a carsocial commentaryredneckrampagekicked in the stomachswat teamragemutantsociopathhand grenadepickup trucknewspaper headlineshot in the armsevered armneck breakingexploding bodyshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotevil manrace against timeproduct placementbeaten to deathstabbed in the backscreamingone against manypolice officer killedshot in the foreheadshot in the leggraveyarddouble crosschild in perilhit by a cardrawinganti herosevered headexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmontagemassacretoplessstrangulationsurvivalsubjective cameradecapitationshot in the backf wordrevolverinterrogationcar crashhand to hand combatsunglassesheld at gunpointshowdownbrawlswordwritten by directorwatching tvpunched in the facerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosiontitle spoken by characterphotographnipplesfemale nuditybare chested maleone word titlebare breastsviolenceblooddogfightnudity (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
| Subgenre: | supernaturalsuspenseblack comedycult filmmartial arts |
| Themes: | supernatural powerhome invasionparanoiadeceptionescapefearbetrayalkidnappingsuicidemurderrevengedeathsurrealism |
| Mood: | nightmaregore |
| Locations: | police stationcemetery |
| Characters: | biblehostagepriestdoctor |
| Story: | person on firethreatened with a knifefoot chasevoice recordingsunlightinvulnerabilityglowing eyesstupid victimopen endedbitten in the neckoffscreen killingone linersuper strengthburned to deathtomb …killing spreewisecrack humorbooby trappunched in the chestimmortalityresurrectionmercilessnesshatredreverse footageexplosiveback from the deadrampageskullkicked in the stomachgothicburned alivedestinyundeadsevered armneck breakingkicked in the faceknocked outevil manrace against timeproduct placementstabbed in the backpolice officer killedtransformationdouble crosscoffinsevered headstabbed in the cheststabbed to deathdeath of friendmixed martial artsthroat slittingimpalementmassacrestrangulationambushgood versus evilsurvivaldecapitationshot in the backf wordhallucinationinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlarrestswordpunched in the faceslow motion scenerescueshotgunshot in the chestblood splatterfistfightshot to deathcorpsedreampistolsurprise endingchaseknifeexplosionphotographbare chested maleviolenceflashbackfightblood (See All) |
| Subgenre: | christ allegorydark fantasysupernaturalblack comedymartial arts |
| Themes: | supernatural powerself sacrificehoperedemptionparanoiabrutalityangerdeceptionmonsterescapefearbetrayalkidnappingrevengemurder …surrealismdeath (See All) |
| Mood: | darknessnightmare |
| Locations: | cave |
| Characters: | tough guyhostagetattoo |
| Story: | animal attackjail cellknife throwingthreatened with a knifefoot chasestabbed through the chestfight the systemglowing eyesanimal killingjailbreaksubterraneansuper strengthburned to deathwisecrack humordisfigurement …punched in the chestprophecychaosmercilessnesshatredreverse footageexplosivevisionmasked mankicked in the stomachburned alivefalling down stairsdestructionbattlefieldshot in the armsevered armexploding bodyshot in the shoulderscarknocked outcharacter's point of view camera shotevil manbeaten to deathattackstabbed in the backscreamingone against manyshot in the legtransformationcreaturefictional warchild in perilanti herosevered headsnakestabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementbridgemontagemassacrestrangulationambushgood versus evilsubjective cameradecapitationshot in the backdemoninterrogationhand to hand combatshowdownfalling from heightbrawlswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestblood splatterfistfightshot to deathcorpsebeatingfiresurprise endingchaseknifeexplosiontitle spoken by characterbare chested maledogflashbackfightviolenceblood (See All) |
It feels good to be bad...Assemble a team of the world's most dangerous, incarcerated Super Villains, provide them with the most powerful arsenal at the government's disposal, and send them off on a mission to defeat an enigmatic, insuperable entity. U.S. intelligence officer Amanda Waller has deter …mined only a secretly convened group of disparate, despicable individuals with next to nothing to lose will do. However, once they realize they weren't picked to succeed but chosen for their patent culpability when they inevitably fail, will the Suicide Squad resolve to die trying, or decide it's every man for himself? (Read More)
| Subgenre: | black comedymartial arts |
| Themes: | supernatural powerunlikely heromurder of familynear death experienceself sacrificeinsanityredemptionbrutalitypsychopathdeceptionmonsterescapetorturefearbetrayal …kidnappingsuicidelovedeathmurderrevengesurrealism (See All) |
| Locations: | cavebar |
| Characters: | psychiatristtough guyhostagetattooboyfriend girlfriend relationship |
| Story: | jail cellperson on fireknife fighthand through chestcaged humanglowing eyesarmorystabbed in the facedeformityjailbreaksubterraneantentaclesuper strengthspiral staircasearmored car …burned to deathlasersightbody landing on a carmutationwisecrack humorbooby trappunched in the chestdynamiteimmortalitychaosexplosiverampagemasked manrocket launcherskullkicked in the stomachswat teammutantsociopathmacheteburned alivedestructionak 47newspaper headlinebattlefieldneck breakingexploding bodyscarkicked in the faceknocked outcharacter's point of view camera shotrace against timebeaten to deathstabbed in the backone against manyshot in the foreheadtransformationcreaturedouble crossfictional waranti herosevered headexploding cartied to a chairstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmontagemassacrestrangulationambushsurvivalsubjective cameradecapitationshot in the backrevolverhallucinationinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightarrestswordbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingknifeexplosiontitle spoken by characterphotographbare chested maleviolenceflashbackfight (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles … Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
| Subgenre: | dark fantasysupernaturalmartial arts |
| Themes: | supernatural powernear death experienceself sacrificeredemptionparanoiabrutalityangerdeceptionescapetorturefearbetrayalmurderlovedeath |
| Mood: | darknessgore |
| Characters: | tough guyhostage |
| Story: | knife throwingthreatened with a knifedrinking bloodbetrayedsunlightknocked out with a gun buttglowing eyesarmorystabbed in the faceopen endedstabbed in the shoulderbullet woundsuper strengthframed for murderburned to death …fight to the deathpunched in the chestframe upresurrectionmercilessnessstealing a carreverse footageexplosiveback from the deadkicked in the stomachgothicburned alivefalling down stairsak 47battlefieldshot in the armsevered armneck breakingshot in the shoulderkicked in the faceknocked outevil manbeaten to deathstabbed in the backone against manyshot in the foreheadshot in the legtransformationfictional wardouble crossfalse accusationsevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementbridgemassacrestrangulationambushsurvivaldecapitationshot in the backinterrogationhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosionbare chested malebloodfightflashbackviolence (See All) |
The general public is concerned over having Superman on their planet and letting the "Dark Knight" - Batman - pursue the streets of Gotham. While this is happening, a power-phobic Batman tries to attack Superman.,Meanwhile Superman tries to settle on a decision, and Lex Luthor, the criminal mastermi …nd and millionaire, tries to use his own advantages to fight the "Man of Steel". (Read More)
| Subgenre: | christ allegorysuspensemartial arts |
| Themes: | supernatural powernear death experienceself sacrificehopeinsanityredemptionparanoiabrutalityangerdeceptioninvestigationmonsterescapetorturefear …betrayalkidnappingrevengemurderdeath (See All) |
| Mood: | nightmare |
| Locations: | cemeterybar |
| Characters: | self mutilationtough guyhostagepolice officerboyfriend girlfriend relationship |
| Story: | dream sequencethreatened with a knifetortured to deathcaged humanbuilding collapsefalling through the floormausoleuminvulnerabilityknocked out with a gun buttglowing eyessubterraneanopen endedstabbed in the shoulderexploding trucksuper strength …armored carframed for murderburned to deathmoral dilemmafight to the deathflamethrowerbody landing on a carbooby trappunched in the chestframe upimmortalitychaoshatredreverse footageexplosivevisionpresumed deadrampagemasked manrocket launcherpress conferencekicked in the stomachexploding buildingsociopathburned alivehand grenadedestructionak 47newspaper headlinebattlefieldvigilantesevered armexploding bodyscarkicked in the faceknocked outrace against timeproduct placementstatuebeaten to deathattackstabbed in the backone against manytransformationcreaturedouble crossfictional warchild in perilhit by a carcoffinanti herofalse accusationexploding cartied to a chairstabbed in the cheststabbed to deathdeath of friendimpalementmontagemassacrestrangulationambushgood versus evilhallucinationdemoncar crashhand to hand combatbombsunglassesheld at gunpointrifleshowdownfalling from heightbrawlgunfightarrestswordbattlewatching tvpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunfistfightshot to deathcorpsedreambeatingshootoutfirepistolsurprise endingknifeexplosionphotographbare chested malebloodviolenceflashbackfight (See All) |
It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)
| Subgenre: | suspenseblack comedymartial arts |
| Themes: | murder of familynear death experienceself sacrificehopeexploitationhome invasioninsanityparanoiabrutalitypsychopathdeceptionescapefearbetrayalkidnapping …revengemurderdeath (See All) |
| Mood: | nightgore |
| Characters: | self mutilationtough guyhostagepriesttattoo |
| Story: | person on fireknife fightthreatened with a knifefight the systemstabbed in the facebullet woundhit by a truckmilitiaburned to deathblood on shirtmoral dilemmabody landing on a carbooby trappunched in the chestchaos …mercilessnesshatredsocial commentarymasked manpress conferencekicked in the stomachsociopathmacheteburned alivehand grenadeak 47shot in the armexploding bodyshot in the shoulderkicked in the faceknocked outevil manrace against timeproduct placementstabbed in the backshot in the foreheadshot in the leghit by a caranti herosevered headtied to a chairstabbed in the cheststabbed to deathdeath of friendmixed martial artsmontagemassacreambushsurvivaldecapitationshot in the backf wordrevolvercar crashhand to hand combatbombheld at gunpointrifleshowdownbrawlgunfightswordwritten by directorpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionphotographbare chested malefightbloodviolenceflashback (See All) |
Inspector Wing of the Hong Kong Police Force has become the victim of a gang, led by the evil Joe. When his entire team is killed, Wing becomes a hapless drunk, feeling guilty for the deaths of his team. A young man with a troubled past pretends to be a police officer working on the case with Wing, …to get him back on his feet and begin an adventure to get revenge on the evil Joe and his Gang of Five, especially when it becomes personal. (Read More)
| Subgenre: | black comedycult filmmartial artsindependent film |
| Themes: | police brutalitynear death experiencemurder of a police officerself sacrificeinsanityredemptionpsychopathdeceptioninvestigationescapedrunkennessbetrayalkidnappingdeathrevenge …murder (See All) |
| Locations: | police carpolice stationbarhospital |
| Characters: | police detectivepolice shootoutself mutilationtough guyhostagedetectivepolice officernurseboyfriend girlfriend relationshippolice |
| Story: | jail celloutrunning explosionfoot chasetrip wirefalling through the floorinnocent person killedburn victimjailbreakmercy killinghit by a truckpolice inspectorkilling spreelasersightbooby trappunched in the chest …mercilessnesshatredreverse footageexplosivemasked manpress conferencekicked in the stomachswat teamfalling down stairshand grenadeak 47shot in the armdie hard scenarioshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotrace against timeproduct placementbeaten to deathone against manypolice officer killedshot in the foreheadshot in the legdouble crossanti heroexploding cardeath of friendmixed martial artsmontagemassacrestrangulationambushgood versus evilsubjective camerashot in the backrevolverinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointshowdownvomitingfalling from heightbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseexplosionphotographbare chested maleflashbackfightbloodviolence (See All) |
A down and out cynical detective teams up with a down and out ex-quarterback to try and solve a murder case involving a pro football team and a politician.
| Subgenre: | suspenseblack comedycult filmmartial arts |
| Themes: | murder of a police officerself sacrificebrutalitypsychopathdeceptioninvestigationescapetorturebetrayalkidnappingsuicidemurderrevengedeath |
| Mood: | nightgore |
| Locations: | police stationbar |
| Characters: | police detectivepolice shootouttough guyhostagedetectivepolice officertattooboyfriend girlfriend relationshipmother daughter relationshippolice |
| Period: | 1990s |
| Story: | person on firetopless female nuditythreatened with a knifegraphic violenceone linerframed for murderburned to deathbody landing on a carwisecrack humorkicked in the crotchframe uphatredstealing a carreverse footageexplosive …crime sceneswitchbladepresumed deadswat teamburned aliveanswering machineshot in the armdie hard scenarioexploding bodyshot in the shoulderscarknocked outrace against timeproduct placementone against manypolice officer killedshot in the foreheadbartendershot in the legdouble crosschild in perilhit by a caranti herofalse accusationexploding cardeath of friendmassacreambushshot in the backf wordrevolverinterrogationcar crashbombsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingfemale nuditybare chested malebare breastsdogfightflashbackviolenceblood (See All) |
Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)
| Subgenre: | dark fantasymartial arts |
| Themes: | police brutalitysupernatural powerhome invasioninvestigationmonsterescapekidnappingdeathmurderrevenge |
| Mood: | darknessgore |
| Locations: | police station |
| Characters: | police detectiveself mutilationhostagedetectivedoctormother daughter relationshippolice |
| Story: | animal attackknife in chestknife throwinghole in cheststabbed in the faceopen endedstabbed in the shoulderbitten in the necksuper strengthflamethrowerbody landing on a carmutationpunched in the chestresurrectionstealing a car …explosiveback from the deadsocial commentarykicked in the stomachgothichand grenadeshot in the armsevered armneck breakingexploding bodyshot in the shoulderkicked in the facecharacter's point of view camera shotbeaten to deathattackstabbed in the backone against manyshot in the foreheadshot in the legtransformationcreaturefictional warchild in perilhit by a caranti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationgood versus evilsurvivalsubjective cameradecapitationshot in the backrevolvercar crashhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightswordbattlepunched in the facerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographbare chested malebloodviolence (See All) |
Despite his tarnished reputation after the events of The Dark Knight, in which he took the rap for Dent's crimes, Batman feels compelled to intervene to assist the city and its police force which is struggling to cope with Bane's plans to destroy the city.
| Subgenre: | christ allegorysuspensecult filmmartial arts |
| Themes: | murder of a police officerself sacrificehopehome invasionredemptionparanoiabrutalitypsychopathdeceptioninvestigationescapetorturebetrayalkidnappingsuicide …murderdeathrevenge (See All) |
| Locations: | cavepolice stationcemeterybarhospital |
| Characters: | police detectivepolice shootoutshooting a police officertough guyhostagepriestdetectivepolice officertattoodoctorpolice |
| Story: | jail cellhuman monsterfoot chasepolice vigilantismknocked out with a gun buttfight the systemarmorysubterraneanpolice officer shot in the chestoffscreen killingsuper strengtharmored carfight to the deathsiegebooby trap …punched in the chestchaosmercilessnessstealing a carexplosivepresumed deadsocial commentarymasked manpress conferenceswat teamkicked in the stomachexploding buildingsociopathhand grenadedestructionak 47newspaper headlinebattlefieldvigilantedie hard scenarioneck breakingexploding bodykicked in the faceknocked outcharacter's point of view camera shotevil manrace against timeproduct placementstatuebeaten to deathstabbed in the backscreamingone against manypolice officer killedshot in the leggraveyardfictional wardouble crosschild in perilanti herofalse accusationexploding carstabbed in the chestmixed martial artsimpalementbridgemassacrestrangulationambushgood versus evilsubjective camerashot in the backhallucinationinterrogationcar crashhand to hand combatbombheld at gunpointrifleshowdownfalling from heightbrawlgunfightbattlewritten by directorwatching tvpunched in the facerescueshotgunshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographbare chested maleflashbackfight (See All) |
"Some people lose their faith because Heaven shows them too little," says Thomas Daggett. "But how many people lose their faith because Heaven showed them too much?" Daggett nearly became a priest; now he's a cop. He may want to put religion behind him, but one morning a weird, eyeless, hermaphrodit …ic corpse turns up. Suddenly he is on a path that will put him right in the middle of a war in Heaven. And once again, Heaven will show him too much: gore, blood, charred flesh, living corpses and much worse. Even more central to the heavenly war effort is a young girl. This American Indian child has something Gabriel wants. And Gabriel is willing to kill her and anyone in his path - or even reanimate a corpse or two - to get it. (Read More)
| Subgenre: | dark fantasysuspenseblack comedycult filmindependent film |
| Themes: | supernatural powernear death experiencemurder of a police officerhopefaithinsanityparanoiabrutalitypsychopathdeceptioninvestigationescapefearbetrayalkidnapping …surrealismdeathmurder (See All) |
| Mood: | darknessgore |
| Locations: | police carpolice stationcemeteryhospital |
| Characters: | police detectivecoronerbiblehostagepriestdetectivepolice officernursepolice |
| Period: | 1990s |
| Story: | bible quoteperson on fireface burninvulnerabilityshamanburnt facesuper strengthburned to deathkilling spreebody landing on a careye gougingtribepunched in the chestprophecyresurrection …mercilessnessvisioncrime sceneback from the deadskullmorguesociopathgothicburned alivepickup truckmaniacnewspaper headlineundeadexploding bodyskeletonknocked outevil manrace against timestatuepolice officer killedshot in the foreheadgraveyardfictional wardouble crosschild in perilhit by a carcoffinimpalementgood versus evilsurvivalshot in the backrevolverhallucinationdemonsunglassesheld at gunpointshowdownfalling from heightbrawlwritten by directorpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingfiresurprise endingknifeexplosiontitle spoken by characterphotographcigarette smokingviolencebloodflashbackfight (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
| Subgenre: | supernaturalblack comedycult film |
| Themes: | police brutalitysupernatural powernear death experiencemurder of a police officerredemptionparanoiabrutalitypsychopathdeceptionescapefearbetrayalkidnappingrevengesurrealism …murderdeathlove (See All) |
| Mood: | gore |
| Locations: | motelpolice carpolice stationcemetery |
| Characters: | police detectivehostagepriestdetectivepolice officerserial killertattooboyfriend girlfriend relationshippolice |
| Period: | 1990s |
| Story: | mass murdererhomicidal maniaccar set on fireknife throwingdumb policeinnocent person killedstupid victimhit by a truckburnt faceabuse of powerframed for murderwisecrack humordisfigurementbooby trapframe up …gash in the faceresurrectionpresumed deadback from the deadskullspiderragesociopathgothicmaniacnewspaper headlineexploding bodyscarknocked outskeletonrace against timestabbed in the backscreamingpolice officer killedgraveyarddouble crosshit by a cardrawingcoffinfalse accusationexploding cartied to a chairstabbed in the chestthroat slittingimpalementbridgemontagestrangulationambushf wordtelephonerevolvercar crashheld at gunpointshowdownwatching tvslow motion scenerescueshot in the chestcar accidentblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifephotographcigarette smokingbare chested maleviolencebloodfight (See All) |
Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t …rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)
| Subgenre: | supernaturalblack comedyindependent film |
| Themes: | police brutalitysupernatural powerunlikely heronear death experiencehome invasionredemptionparanoiadeceptioninvestigationescapefearghostkidnappingdeathmurder …revengesurrealism (See All) |
| Mood: | darknessnightmare |
| Locations: | motelpolice carhospital |
| Characters: | police shootouttough guyhostagepolice officernursetattoodoctorboyfriend girlfriend relationshipmother daughter relationshippolice |
| Story: | animal attackperson on firefoot chaserunning for your lifeinnocent person killedanimal killingbullet woundoffscreen killinghit by a truckframed for murderburned to deathshot multiple timesblood on shirtkilling spreewisecrack humor …frame upstealing a carexplosivevisioncrime scenemasked manskullspidersociopathburned alivedestructionshot in the armsevered armexploding bodyshot in the shoulderknocked outrace against timeproduct placementscreamingpolice officer killedcreaturedouble crosschild in perilhit by a carfalse accusationsevered headexploding carmontagemassacregood versus evilshot in the backrevolverdemoncar crashbombheld at gunpointshowdownbrawlgunfightarrestbattlewritten by directorpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsedreambeatingshootoutfirepistolsurprise endingchaseknifeexplosiontitle spoken by characterphotographcigarette smokingbased on novelfightbloodflashbackdogviolence (See All) |
After the Kingsman headquarters are blown up by a psychotic criminal named Poppy Adams. The surviving agents find their way to an allied secret organisation based in Kentucky, named Statesman. The two agencies must now work together in order to save the world and take down the so called 'Golden Circ …le'. (Read More)
| Subgenre: | black comedymartial arts |
| Themes: | near death experienceself sacrificeparanoiabrutalitydeceptionescapedrunkennesstorturefearbetrayalkidnappingrevengedeathmurder |
| Mood: | gore |
| Locations: | police carbarhospital |
| Characters: | tough guyhostagesingertattooboyfriend girlfriend relationshipmother daughter relationship |
| Story: | knife fightthreatened with a knifecaged humanknocked out with a gun buttfight the systemlandmineanimal killingimprovised weaponarmoryarmored carabuse of powerstuffed animalburned to deathmoral dilemmafight to the death …body landing on a carsiegewisecrack humorpunched in the chestresurrectionmercilessnessreverse footageexplosivepresumed deadback from the deadsocial commentaryredneckrocket launcherkicked in the stomachexploding buildingsociopathhand grenadedestructionmaniacbattlefieldsevered armneck breakingexploding bodyshot in the shoulderscarkicked in the faceknocked outcharacter's point of view camera shotrace against timeproduct placementstatuebeaten to deathone against manyshot in the foreheadbartenderdouble crossanti herofalse accusationexploding cartied to a chairdeath of friendmixed martial artsimpalementmontagestrangulationambushgood versus evilsubjective camerashot in the backf wordrevolverhallucinationinterrogationcar crashhand to hand combatbombsunglassesheld at gunpointrifleshowdownbrawlgunfightarrestbattlewatching tvpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathbeatingshootoutpistolsurprise endingchaseknifeexplosiontitle spoken by characterphotographcigarette smokingbare chested maleflashbackbloodfightdogviolence (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god … Horus. (Read More)
| Subgenre: | christ allegoryblack comedymartial arts |
| Themes: | supernatural powerunlikely heronear death experienceself sacrificehopefaithredemptionbrutalitydeceptionmonsterescapefearbetrayalkidnappingrevenge …deathsurrealismlovemurder (See All) |
| Mood: | darkness |
| Locations: | cave |
| Characters: | tough guyhostageboyfriend girlfriend relationship |
| Story: | animal attackknife fightoutrunning explosionthreatened with a knifestabbed through the chestglowing eyesanimal killingsuper strengthburned to deathtombeye gougingwisecrack humorbooby trappunched in the chestimmortality …resurrectionchaosmercilessnessreverse footagevisionback from the deadkicked in the stomachexploding buildingburned alivedestructiondestinybattlefieldsevered armskeletonevil manrace against timestatueattackstabbed in the backone against manytransformationcreaturefictional wardouble crossanti herosevered headsnakestabbed in the cheststabbed to deathmixed martial artsimpalementbridgemassacreambushgood versus evilsurvivaldecapitationdemonhand to hand combatshowdownfalling from heightbrawlswordbattlepunched in the faceslow motion scenerescueshot in the chestfistfightcorpsebeatingfiresurprise endingchaseknifeexplosionbare chested maleflashbackbloodviolencefight (See All) |
The highly skilled Federale Machete is hired by some unsavory types to assassinate a senator. But just as he's about to take the shot, he notices someone aiming at him and realizes he's been set up. He barely survives the sniper's bullet, and is soon out for revenge on his former employers, with the … reluctant assistance of his brother Cheech Marin, who has become a priest and taken a vow of nonviolence. If you hire him to take out the bad guys, make sure the bad guys aren't you! (Read More)
| Subgenre: | black comedycult filmmartial arts |
| Themes: | police brutalitymurder of a police officerhome invasionpsychopathdeceptioninvestigationescapedrunkennesstorturebetrayalkidnappingrevengemurder |
| Mood: | gore |
| Locations: | hospital |
| Characters: | shooting a police officertough guyhostagepriestpolice officernursetattoodoctormother daughter relationship |
| Story: | knife throwingtopless female nuditythreatened with a knifepolice vigilantismtortured to deathhand through chestimprovised weaponstabbed in the facestabbed in the shoulderpolice officer shot in the chestframed for murderflamethrowerbody countbody landing on a carpunched in the chest …frame upgash in the facestealing a carreverse footageexplosivesocial commentarymasked manrocket launcherpress conferencegrindhousekicked in the stomachmachetebattlefieldcult directorvigilanteshot in the armshot in the shoulderkicked in the faceevil manstabbed in the backshot in the foreheadshot in the legcigar smokingdouble crosshit by a cardrawinganti herosevered headexploding carstabbed in the cheststabbed to deaththroat slittingimpalementtoplessstrangulationdecapitationshot in the backrevolverinterrogationcar crashhand to hand combatbombheld at gunpointrifleshowdownvomitingfalling from heightgunfightarrestswordbattlepunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpseshootoutshowerpistolchaseknifeexplosiontitle spoken by characterphotographnipplescigarette smokingfemale nuditybare chested maleone word titlebare breastsfightflashbacknuditybloodviolence (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | suspenseblack comedymartial artsindependent film |
| Themes: | supernatural powerself sacrificeparanoiabrutalitypsychopathmonsterescapefearmurderdeath |
| Mood: | gore |
| Characters: | villaintough guydoctorboyfriend girlfriend relationship |
| Story: | mass murdererhuman monsterknife throwingthreatened with a knifestabbed through the chestface ripped offstupid victimarmorystabbed in the shoulderdisembodied headoffscreen killingpsychopathic killershot multiple timesblood on shirtmasked killer …wisecrack humordisfigurementslaughterresurrectionpresumed deadback from the deadrampagemasked mankicked in the stomachexploding buildingmacheteundeadsevered armneck breakingexploding bodykicked in the faceevil manrace against timebeaten to deathstabbed in the backshot in the legtransformationcreaturesevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushsurvivaldecapitationshot in the backhand to hand combatheld at gunpointrifleshowdownfalling from heightpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosionnipplesfemale nuditybare chested malebloodfightviolenceflashback (See All) |
| Subgenre: | dark fantasysupernaturalsuspenseblack comedymartial arts |
| Themes: | supernatural powermurder of familynear death experiencehopeinsanityredemptionangerdeceptionmonsterescapefearbetrayalkidnappingmurdersurrealism …deathrevengelove (See All) |
| Characters: | tough guyhostage |
| Story: | animal attackrope bridgeknife fightthreatened with a knifebanishmentglowing eyesanimal killingimprovised weaponstabbed in the shouldertentacleburned to deathfight to the deathbooby trappunched in the chestimmortality …resurrectionmercilessnessreverse footagevisionpresumed deadback from the deadkicked in the stomachburned alivebattlefieldkicked in the facebeaten to deathattackstabbed in the backscreamingone against manytransformationcreaturefictional wardouble crosschild in perilanti herofalse accusationsnakestabbed in the chestmixed martial artsimpalementbridgemontagemassacreambushgood versus evilsubjective camerahallucinationhand to hand combatshowdownbrawlswordbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestfistfightcorpsebeatingsurprise endingchaseknifeexplosionbare chested malefightflashbackviolenceblood (See All) |
| Subgenre: | suspenseblack comedycult filmindependent film |
| Themes: | near death experiencemurder of a police officerhome invasioninsanityparanoiabrutalitypsychopathescapetorturefearkidnappingdeathmurderrevenge |
| Mood: | gore |
| Locations: | gas stationcavepolice car |
| Characters: | self mutilationhostagepolice officerboyfriend girlfriend relationship |
| Story: | human monsterperson on firethreatened with a knifefoot chaseclimbing out a windowstupid victimstabbed in the shoulderoffscreen killingblood on shirtbody countdisfigurementbooby trapmercilessnessstealing a carredneck …mutantmachetepickup trucknewspaper headlinesevered armstabbed in the backscreamingpolice officer killedshot in the leghit by a carsevered headexploding carstabbed in the cheststabbed to deathdeath of friendambushsurvivaldecapitationshot in the backcar crashrifleshowdownfalling from heightslow motion scenerescueshot in the headshotguncar accidentblood splattershot to deathcorpsebeatingfirepistolsurprise endingchaseknifeexplosioncigarette smokingviolenceblood (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
| Subgenre: | black comedycult filmmartial arts |
| Themes: | supernatural powermurder of a police officerangerdeceptiondrunkennesstorturefearbetrayalkidnappingmurderdeathrevenge |
| Mood: | gore |
| Locations: | gas stationmotelbar |
| Characters: | tough guyhostagepriestpolice officer |
| Period: | 1990s |
| Story: | person on firetopless female nudityhand through chestfalling through the floorbitten in the necksuper strengthburned to deathsunsetslaughterimmortalityvisionskullexploding buildingburned alivepickup truck …undeadcult directorshot in the armneck breakingexploding bodyshot in the shoulderknocked outcharacter's point of view camera shotstabbed in the backshot in the foreheadshot in the legtransformationcigar smokinganti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacregood versus evilsubjective cameradecapitationshot in the backrevolverinterrogationcar crashheld at gunpointshowdownpunched in the faceslow motion scenerescueshotgunshot in the chestcar accidentmachine gunblood splattershot to deathcorpsebeatingfirepistolchaseknifeexplosiontitle spoken by characterphotographcigarette smokingfemale nudityone word titlebased on novelbare breastsbloodviolencenudity (See All) |
Small-town stoner Mike Howell ('Jesse Eisenberg' (qv)) spends most of his time getting high and writing a graphic novel about a superhero monkey. What Mike doesn't know is that he was trained by the CIA to be a lethal killing machine. When the agency targets him for termination, his former handler a …ctivates his latent skills, turning the mild-mannered slacker into a deadly weapon. Now, the utterly surprised Mike must use his newfound abilities to save himself and his girlfriend from getting wasted by the failed test subjects that are sent after him by the CIA. (Read More)
| Subgenre: | black comedymartial artsindependent film |
| Themes: | unlikely heronear death experiencehome invasioninsanityredemptionparanoiabrutalitypsychopathdeceptionescapefearbetrayalkidnappingmurderrevenge …deathlove (See All) |
| Mood: | gore |
| Locations: | gas stationpolice carpolice station |
| Characters: | police shootouthostagepolice officertattooboyfriend girlfriend relationshippolice |
| Story: | jail cellcar set on firethreatened with a knifepoison gasfight the systemimprovised weaponjailbreakpolice officer shot in the chestarmored carabuse of powerblood on shirtkilling spreelasersightsiegepunched in the chest …gash in the facereverse footagepresumed deadsocial commentaryswat teamexploding buildinghand grenadenewspaper headlineshot in the armdie hard scenarioneck breakingknocked outrace against timeproduct placementbeaten to deathstabbed in the backone against manypolice officer killedshot in the foreheaddouble crossdrawinganti heroexploding carstabbed in the chestmixed martial artsimpalementbridgemontagemassacrestrangulationambushsurvivalshot in the backf wordrevolvercar crashhand to hand combatheld at gunpointshowdownvomitingbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionbare chested malebloodviolencefightflashback (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the …mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
| Subgenre: | creature featureblack comedycult filmindependent film |
| Themes: | police brutalitynear death experiencemurder of a police officerexploitationparanoiabrutalitymonsterescapefearkidnappingsuiciderevengedeathmurder |
| Mood: | gore |
| Characters: | police shootoutvillaintough guyhostagepriestpolice officerdoctorboyfriend girlfriend relationshippolice |
| Story: | car set on fireperson on fireknife throwingthreatened with a knifedumb policepolice vigilantismscalpinggraphic violencetommy gunvending machinewalking deadbitten in the neckoffscreen killingmercy killinghit by a truck …spiral staircaseburned to deathbad guyblood on shirtmoral dilemmabody countmutationsiegedisfigurementslaughterpunched in the chestchaosmercilessnessstealing a carsocial commentaryredneckgrindhousekicked in the stomachswat teamsociopathmacheteburned alivehand grenadechild murderundeadcult directorshot in the armsevered armdie hard scenarioscarkicked in the faceknocked outcharacter's point of view camera shotattackstabbed in the backscreamingone against manypolice officer killedshot in the foreheadshot in the legcigar smokingcreaturehit by a carsevered headexploding carstabbed in the cheststabbed to deathdeath of friendbridgemontagemassacreambushgood versus evilsubjective camerasurvivaldecapitationshot in the backrevolversunglassesheld at gunpointriflevomitingfalling from heightgunfightswordbattlewritten by directorwatching tvpunched in the facerescueshot in the headshotgunshot in the chestmachine gunblood splattershot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested maleviolencefightdogblood (See All) |
During an operation of a Mexican Cartel, Machete Cortez and Sartana Rivera intercept the criminals alone, but another group arrives and a masked man kills Sartana. Machete is arrested, accused of killing his beloved Sartana and Sheriff Doakes hangs Machete. But the President of the USA Rathcock pard …ons and recruits Machete to kill the revolutionary Marcos Mendez that has threatened the USA with a missile with a bomb. Machete goes to San Antonio to meet the Miss San Antonio Blanca Vasquez that will be the liaison between Machete and President Rathcock. Then Machete goes to the brothel of Madame Desdemona to seek out the prostitute Cereza that is Mendez's mistress. Machete meets Mendez and learns that his heart is connected to the missile and only the arm dealer Luther Voz is capable to disarm the bomb. Now Machete needs to bring Mendez to the USA in less than twenty-four hours and save his new country in a dangerous journey with betrayals. (Read More)
| Subgenre: | black comedymartial artsindependent film |
| Themes: | police brutalityself sacrificeexploitationinsanitypsychopathdeceptionescapetorturebetrayalkidnappingrevengedeathmurdersurrealism |
| Mood: | gore |
| Locations: | gas stationpolice stationbar |
| Characters: | tough guyhostagepriestnursetattoodoctormother daughter relationshippolice |
| Story: | person on fireknife fightknife throwingthreatened with a knifefoot chasepolice vigilantismopen endedhit by a truckburnt facesuper strengtharmored carfight to the deathflamethrowerbody countwisecrack humor …disfigurementstealing a carmasked mangrindhouseswat teamexploding buildingmacheteburned aliveak 47battlefieldshot in the armsevered armneck breakingexploding bodyshot in the shoulderskeletonrace against timestabbed in the backone against manypolice officer killedshot in the foreheadbartendershot in the legdouble crossanti herosevered headexploding cartied to a chairstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacreambushdecapitationshot in the backf wordrevolvercar crashhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightarrestswordbattlepunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathshootoutpistolsurprise endingchaseknifeexplosiontitle spoken by characterphotographbare chested maleviolencefightbloodflashback (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
| Subgenre: | black comedymartial artsindependent film |
| Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapedrunkennessfearbetrayalkidnappingdeathmurderrevenge |
| Mood: | nightmaregore |
| Locations: | police carpolice stationbar |
| Characters: | police detectivehostagedetectivepolice officerserial killerboyfriend girlfriend relationshippolice |
| Period: | 1990s |
| Story: | wrongful arrestknife throwingthreatened with a knifefoot chasestupid victimimprovised weaponstabbed in the shoulderblood on shirtmasked killerkilling spreebooby trappunched in the chestframe upmercilessnesscrime scene …presumed deadmasked mankicked in the stomachsociopathfalling down stairsanswering machinecult directorexploding bodyshot in the shoulderkicked in the faceknocked outrace against timebeaten to deathstabbed in the backscreamingshot in the foreheadshot in the legdouble crosscoffinfalse accusationtied to a chairstabbed in the cheststabbed to deaththroat slittingstrangulationambushsurvivalshot in the backf wordrevolverhallucinationcar crashsunglassesheld at gunpointshowdownfalling from heightbrawlwatching tvpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightshot to deathcorpsebeatingshowerpistolsurprise endingchaseknifephotographcigarette smokingbare chested malefightviolencedogblood (See All) |
PRIEST, a post-apocalyptic sci-fi thriller, is set in an alternate world -- one ravaged by centuries of war between man and vampires. The story revolves around a legendary Warrior Priest from the last Vampire War who now lives in obscurity among the other downtrodden human inhabitants in walled-in d …ystopian cities ruled by the Church. When his niece is abducted by a murderous pack of vampires, Priest breaks his sacred vows to venture out on a quest to find her before they turn her into one of them. He is joined on his crusade by his niece's boyfriend, a trigger-fingered young wasteland sheriff, and a former Warrior Priestess who possesses otherworldly fighting skills. (Read More)
| Subgenre: | christ allegorymartial arts |
| Themes: | self sacrificehome invasionredemptiondeceptionmonstertorturebetrayalkidnappingrevengedeathmurder |
| Mood: | darknessnightnightmaregore |
| Locations: | cavecemeterybar |
| Characters: | biblevillaintough guyhostagepriesttattooboyfriend girlfriend relationshipmother daughter relationship |
| Story: | animal attackjail cellknife in chestperson on fireknife throwingthreatened with a knifefight the systemsubterraneanstabbed in the shoulderbitten in the neckblood on shirtmutationpunched in the chestdynamitegash in the face …presumed deadsocial commentaryskullkicked in the stomachmutantmachetevigilantesevered armneck breakingexploding bodyscarkicked in the facerace against timestatuebeaten to deathattackstabbed in the backone against manytransformationcreaturefictional warcoffinanti herosevered headstabbed in the cheststabbed to deaththroat slittingimpalementmassacreambushgood versus evilsurvivaldecapitationinterrogationhand to hand combatheld at gunpointshowdownfalling from heightbrawlbattlepunched in the facerescueshotgunshot in the chestmachine gunblood splatterfistfightcorpsebeatingshootoutfiresurprise endingchaseknifeexplosiontitle spoken by characterphotographcigarette smokingbare chested maleone word titlebased on novelbloodviolencefightflashback (See All) |
| Subgenre: | suspenseblack comedyindependent film |
| Themes: | self sacrificehome invasionfaithredemptionparanoiabrutalityangerdeceptionescapefearbetrayalkidnappingrevengedeathmurder |
| Locations: | motelpolice carbar |
| Characters: | tough guyhostagetattooboyfriend girlfriend relationshippolice |
| Story: | modern westernlandminepolice officer shot in the chesthit by a truckmoral dilemmabooby trapmercilessnessstealing a carpresumed deadredneckbarnsociopathhand grenadepickup truckak 47 …exploding bodyshot in the shoulderscarknocked outcharacter's point of view camera shotevil manrace against timeproduct placementbeaten to deathpolice officer killedshot in the foreheadbartendershot in the legdouble crossdrawinganti herodeath of friendmontageambushsurvivalsubjective camerashot in the backf wordtelephonerevolversunglassesheld at gunpointrifleshowdownbrawlgunfightarrestwatching tvpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathbeatingshootoutpistolsurprise endingchaseknifeexplosionphotographbare chested malebased on novelfightviolenceblood (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
| Subgenre: | suspenseblack comedycult film |
| Themes: | near death experiencemurder of a police officerinsanityparanoiapsychopathdeceptioninvestigationescapedrunkennessfearbetrayalmurderlovedeathrevenge |
| Mood: | gore |
| Locations: | police carpolice stationhospital |
| Characters: | police detectivehostagedetectivepolice officerserial killerboyfriend girlfriend relationshippolice |
| Period: | 1990s |
| Story: | threatened with a knifefoot chasecut armclimbing out a windowstupid victimstabbed in the facestabbed in the shoulderoffscreen killingmasked killerkilling spreebody countmercilessnesscrime scenepresumed deadsocial commentary …masked manpress conferencefalling down stairscult directorshot in the armscarkicked in the faceknocked outproduct placementstatueattackstabbed in the backscreamingpolice officer killedshot in the foreheadshot in the legdouble crosshit by a carfalse accusationstabbed in the cheststabbed to deathdeath of friendthroat slittingimpalementstabbingambushgood versus evilsurvivalf wordtelephonehallucinationcar crashsunglassesheld at gunpointshowdownbrawlwatching tvpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentblood splattershot to deathcorpsebeatingpistolsurprise endingchaseknifecigarette smokingbare chested malebloodviolence (See All) |
When the White House (Secret Service Code: "Olympus") is captured by a terrorist mastermind and the President is kidnapped, disgraced former Presidential Secret Service Agent Mike Banning finds himself trapped within the building. As our national security team scrambles to respond, they are forced t …o rely on Banning's inside knowledge to help retake the White House, save the President and avert an even bigger disaster. (Read More)
| Subgenre: | martial arts |
| Themes: | unlikely heromurder of a police officerdeceptionescapetorturebetrayalkidnappingmurderdeath |
| Mood: | gore |
| Locations: | hospital |
| Characters: | shooting a police officertough guyhostagenurse |
| Story: | knife fightthreatened with a knifefoot chaseanimal killingpolice officer shot in the chestarmored carshot multiple timesbody countwisecrack humorgash in the facechaosmasked manrocket launcherpress conferenceswat team …exploding buildingfalling down stairshand grenadeak 47battlefieldshot in the armsevered armdie hard scenarioneck breakingexploding bodyshot in the shouldercharacter's point of view camera shotevil manrace against timebeaten to deathstabbed in the backone against manypolice officer killedshot in the foreheadshot in the legfictional warchild in perilanti heroexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingbridgemassacrestrangulationsubjective camerashot in the backf wordinterrogationcar crashhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolchaseknifeexplosiontitle spoken by charactercigarette smokingbare chested malebloodflashbackfightviolence (See All) |
| Subgenre: | suspensemartial arts |
| Themes: | near death experiencehome invasioninsanityparanoiabrutalitypsychopathdeceptioninvestigationescapetorturefearbetrayalkidnappingmurderdeath |
| Locations: | police carbarhospital |
| Characters: | police detectivepolice shootouttough guyhostagedetectivepolice officerdoctorboyfriend girlfriend relationshippolice |
| Story: | knife throwingfoot chasecaged humancityscapewoman in lingerieoffscreen killingarmored carframed for murderyellingdisfigurementbooby trappunched in the chestframe upmercilessnessexplosive …crime scenemasked manrocket launcherkicked in the stomachmutantsociopathgothichand grenadeak 47newspaper headlinevigilantekicked in the faceknocked outcharacter's point of view camera shotrace against timestatuebeaten to deathattackscreamingone against manypolice officer killedshot in the foreheadcigar smokingdouble crosshit by a caranti heroexploding carmixed martial artsambushgood versus evilsubjective camerarevolverinterrogationcar crashhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malebloodfightflashbackviolence (See All) |
This is the origin story of former Special Forces operative turned mercenary Wade Wilson, who after being subjected to a rogue experiment that leaves him with accelerated healing powers, adopts the alter ego Deadpool. Armed with his new abilities and a dark, twisted sense of humor, Deadpool hunts do …wn the man who nearly destroyed his life. (Read More)
| Subgenre: | black comedymartial arts |
| Themes: | supernatural powerredemptionbrutalitydeceptionescapetorturebetrayalkidnappingmurderdeathrevenge |
| Mood: | gore |
| Locations: | bar |
| Characters: | self mutilationtough guyhostagetattoodoctorboyfriend girlfriend relationship |
| Story: | knife in chestperson on fireknife fightknife throwingtopless female nuditythreatened with a knifestabbed through the chestinvulnerabilitygraphic violencestabbed in the shoulderoffscreen killingone linersuper strengthstuffed animalburned to death …blood on shirtkilling spreebody countbody landing on a carmutationwisecrack humordisfigurementpunched in the chestimmortalitymercilessnesshatredpresumed deadrampagemasked manmutantsociopathburned alivehand grenadedestructionvigilanteshot in the armneck breakingexploding bodyscarkicked in the faceevil manrace against timebeaten to deathstabbed in the backone against manyshot in the foreheadbartendershot in the legtransformationdouble crossdrawinganti herosevered headexploding carstabbed in the cheststabbed to deathmixed martial artsimpalementmontagemassacrestrangulationambushgood versus evildecapitationshot in the backf wordrevolverinterrogationcar crashhand to hand combatsunglassesheld at gunpointshowdownvomitingfalling from heightbrawlgunfightswordbattlepunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolchaseknifeexplosionphotographbare chested maleone word titlebare breastsbloodflashbackviolencefight (See All) |
Orin Boyd (Seagal) is a Detroit cop who doesn't follow rules. After he saved the Vice President by violating every order he received he is transferred to one of the worst precincts in the city. There he quickly encounters some corrupt cops selling heroin to drug dealers. The problem is, it's very di …fficult to tell who is the bad guy and who you can trust. (Read More)
| Subgenre: | black comedymartial arts |
| Themes: | police brutalitybrutalitydeceptioninvestigationescapebetrayalkidnappingdeathmurder |
| Mood: | gore |
| Locations: | police carpolice stationbar |
| Characters: | police detectivepolice shootoutpolice sergeanttough guyhostagedetectivepolice officerpolice |
| Story: | knife fightthreatened with a knifefoot chasepolice vigilantismimprovised weaponvending machinepolice captainhit by a truckframed for murderbad guyfight to the deathbody landing on a carwisecrack humorpunched in the chestframe up …mercilessnessstealing a carexplosiveswat teamkicked in the stomachrageshot in the armshot in the shoulderkicked in the faceknocked outevil manproduct placementbeaten to deathfactorypolice officer killedshot in the foreheadbartendershot in the legdouble crosshit by a caranti heroexploding carmixed martial artsimpalementbridgeambushshot in the backf wordjailcar crashhand to hand combatbombsunglassesheld at gunpointshowdownbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathbeatingshootoutfirepistolchaseknifeexplosionfemale nuditybased on novelviolencefightblood (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
| Subgenre: | creature featuresuspenseblack comedycult filmindependent film |
| Themes: | supernatural powernear death experiencehome invasionparanoiadeceptionmonsterescapedrunkennessfearkidnappinglovemurderdeathsurrealism |
| Mood: | night |
| Locations: | police carpolice stationbar |
| Characters: | hostagepriestpolice officerboyfriend girlfriend relationshipmother daughter relationship |
| Period: | 1980s |
| Story: | jail cellspikeclimbing out a windowglowing eyesstupid victimimprovised weaponsuper strengthburned to deathmutationsiegechaosmercilessnessstealing a carreverse footagesocial commentary …redneckbarnburned alivedestructionpickup truckexploding bodyknocked outcharacter's point of view camera shotrace against timescreamingpolice officer killedbartendercreaturechild in perilimpalementambushsurvivalsubjective cameratelephonerevolvercar crashbombheld at gunpointriflecatwatching tvslow motion scenerescueshotgunshot in the chestcar accidentblood splattershot to deathcorpsefiresurprise endingknifeexplosiontitle spoken by characterphotographcigarette smokingone word titlebloodviolence (See All) |
After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)
| Subgenre: | suspensemartial arts |
| Themes: | near death experiencehopeexploitationparanoiadeceptionescapefearbetrayalkidnappingmurderdeathsurrealismloverevenge |
| Locations: | cave |
| Characters: | tough guyhostagetattooboyfriend girlfriend relationship |
| Story: | jail cellfoot chasepoison gasknocked out with a gun buttfight the systemcityscapearmoryjailbreaksubterraneanopen endedstabbed in the shoulderoffscreen killingspiral staircasearmored carbad guy …moral dilemmalasersightdisfigurementpunched in the chestgash in the facechaosreverse footageexplosivesocial commentarykicked in the stomachfalling down stairsdestinybattlefieldscarkicked in the faceknocked outcharacter's point of view camera shotevil manrace against timebeaten to deathattackone against manyshot in the foreheaddouble crossfictional warchild in perilanti heroexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementambushgood versus evilsubjective camerasurvivalshot in the backrevolverhallucinationhand to hand combatbombheld at gunpointshowdownfalling from heightbrawlgunfightarrestbattlepunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunfistfightshot to deathcorpsebeatingshootoutshowerpistolsurprise endingchaseknifeexplosiontitle spoken by characterfemale nuditybare chested malebased on novelone word titlefightviolenceblood (See All) |
Since the dawn of civilization, he was worshiped as a god. Apocalypse, the first and most powerful mutant from Marvel's X-Men universe, amassed the powers of many other mutants, becoming immortal and invincible. Upon awakening after thousands of years, he is disillusioned with the world as he finds …it and recruits a team of powerful mutants, including a disheartened Magneto, to cleanse mankind and create a new world order, over which he will reign. As the fate of the Earth hangs in the balance, Raven with the help of Professor X must lead a team of young X-Men to stop their greatest nemesis and save mankind from complete destruction. (Read More)
| Subgenre: | suspensemartial arts |
| Themes: | supernatural powernear death experienceself sacrificehopeangerdeceptionescapedrunkennessfearbetrayalkidnappingrevengedeathmurdersurrealism |
| Mood: | nightmare |
| Locations: | cavebar |
| Characters: | tough guyhostagemother daughter relationshippolice |
| Period: | 1980s |
| Story: | factory workeroutrunning explosionthreatened with a knifefoot chaseinvulnerabilitysubterraneanoffscreen killingshamansuper strengthburned to deathoutcasttombkilling spreebody landing on a carmutation …punched in the chestimmortalityresurrectionchaosmercilessnessstealing a carreverse footagecamera shot of feetvisionback from the deadrampagekicked in the stomachexploding buildingmutantburned alivedestructionak 47battlefieldneck breakingkicked in the faceskeletonknocked outcharacter's point of view camera shotrace against timeproduct placementbeaten to deathfactoryscreamingone against manypolice officer killedtransformationfictional wardouble crosssevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementmassacrestrangulationambushgood versus evilsurvivalsubjective cameradecapitationshot in the backrevolverhand to hand combatsunglassesheld at gunpointshowdownfalling from heightbrawlswordbattlewatching tvpunched in the faceslow motion scenerescuemachine gunblood splatterfistfightcorpsebeatingfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingbare chested malebloodviolencefightdogflashback (See All) |
The gangster Nino has a gang who call themselves Cash Money Brothers. They get into the crack business and not before long they make a million dollars every week. A cop, Scotty, is after them. He tries to get into the gang by letting an ex-drug addict infiltrate the gang, but the attempt fails miser …ably. The only thing that remains is that Scotty himself becomes a drug pusher. (Read More)
| Subgenre: | black comedycult filmmartial artsindependent film |
| Themes: | police brutalitynear death experiencehome invasionparanoiabrutalityangerdeceptioninvestigationescapetorturefearbetrayalrevengemurderdeath |
| Mood: | gore |
| Locations: | police stationcemeterybar |
| Characters: | police detectivepolice shootouttough guyhostagepriestdetectivepolice officersingertattooboyfriend girlfriend relationshippolice |
| Period: | 1990s1980s |
| Story: | threatened with a knifepolice vigilantismtommy gunpolice captainlasersightwisecrack humorbooby trappunched in the chesthatredexplosiveswitchbladegrindhouseswat teamkicked in the stomachsociopath …falling down stairsak 47vigilantecharacter's point of view camera shotevil manbeaten to deathpolice officer killeddouble crosschild in perildrawinganti herofalse accusationtied to a chairstabbed in the chestdeath of friendthroat slittingmontagemassacrestrangulationambushsubjective camerashot in the backf wordtelephonerevolverinterrogationhand to hand combatbombsunglassesheld at gunpointriflefalling from heightbrawlgunfightarrestpunched in the faceslow motion sceneshot in the headshotgunshot in the chestmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosiontitle spoken by characternipplesfemale nuditybare chested maleflashbackbloodviolencefight (See All) |
When John Connor ('Jason Clarke (I)' (qv)), leader of the human resistance, sends Sgt. Kyle Reese ('Jai Courtney' (qv)) back to 1984 to protect Sarah Connor ('Emilia Clarke' (qv)) and safeguard the future, an unexpected turn of events creates a fractured time-line. Now, Sgt. Reese finds himself in a … new and unfamiliar version of the past, where he is faced with unlikely allies, including the Guardian ('Arnold Schwarzenegger' (qv)), dangerous new enemies, and an unexpected new mission: To reset the future... (Read More)
| Themes: | murder of a police officerself sacrificehopedeceptionbetrayalmurderdeath |
| Locations: | police stationhospital |
| Characters: | police detectivetough guypolice officerdoctor |
| Story: | person on fireoutrunning explosionfoot chasehand through chestinvulnerabilityknocked out with a gun buttfight the systemarmorysubterraneanstabbed in the shoulderhit by a trucksuper strengthbody landing on a carwisecrack humordisfigurement …booby trappunched in the chestgash in the facestealing a carsocial commentaryrocket launcherpress conferencekicked in the stomachexploding buildingdestinybattlefieldshot in the armsevered armexploding bodyshot in the shouldercharacter's point of view camera shotrace against timeproduct placementbeaten to deathfactorystabbed in the backshot in the foreheadshot in the legtransformationfictional warchild in perilhit by a carsevered headexploding carstabbed in the cheststabbed to deathimpalementambushgood versus evilsubjective camerasurvivaldecapitationshot in the backrevolverinterrogationcar crashhand to hand combatbombheld at gunpointbrawlarrestbattlepunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestmachine gunfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingknifeexplosionphotographbare chested maleflashback (See All) |
The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)
| Subgenre: | suspenseblack comedymartial arts |
| Themes: | home invasionparanoiabrutalitydeceptioninvestigationescapedrunkennesstorturefearbetrayalkidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | police carbar |
| Characters: | police shootoutcoronerhostagepolice officertattoomother daughter relationshippolice |
| Period: | 1980s |
| Story: | car set on fireknife in chestknife fightknife throwingtopless female nuditythreatened with a knifefoot chasegraphic violencegarroteknocked out with a gun buttimprovised weaponstabbed in the faceblood on shirtfight to the deathbody landing on a car …punched in the chestmercilessnessstealing a carkicked in the stomachmorguefalling down stairsneck breakingscarkicked in the faceknocked outrace against timeproduct placementbeaten to deathattackstabbed in the backone against manypolice officer killedshot in the foreheadbartendershot in the legdouble crosshit by a carexploding carstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementbridgemontagemassacrestrangulationambushsurvivalshot in the backf wordtelephonerevolverinterrogationcar crashhand to hand combatsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion scenerescueshot in the headshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingfemale nuditybare chested malebased on novelbare breastsflashbackbloodviolencefight (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
| Subgenre: | christ allegory |
| Themes: | supernatural powernear death experienceself sacrificehopebrutalitydeceptionfearbetrayalkidnappingsuicidedeathmurderlovesurrealismrevenge |
| Locations: | cave |
| Characters: | self mutilationtough guyhostage |
| Story: | animal attackperson on fireknife throwingthreatened with a knifedrinking bloodsunlightglowing eyesarmorybitten in the necksuper strengthburned to deathyellingsiegeimmortalityresurrection …hatredback from the deadskullspidergothicburned alivedestinymaniacbattlefieldsevered armshot in the shoulderscarskeletoncharacter's point of view camera shotevil manstabbed in the backscreamingone against manytransformationchild in perilanti herostabbed in the cheststabbed to deaththroat slittingimpalementmassacreambushgood versus evilsubjective camerademonhand to hand combatshowdownfalling from heightswordbattlepunched in the faceslow motion scenerescueblood splattercorpsebeatingfiresurprise endingchaseknifeexplosionbare chested malebloodflashbackviolence (See All) |
| Subgenre: | suspensemartial artsindependent film |
| Themes: | paranoiabrutalityangerdeceptioninvestigationescapefearbetrayalkidnappingsuiciderevengedeathmurder |
| Characters: | psychiatristhostagedoctorboyfriend girlfriend relationship |
| Story: | threatened with a knifefoot chaseinnocent person killedimprovised weaponmercy killingsuper strengthmoral dilemmafight to the deathkilling spreemutationpunched in the chestgash in the facestealing a carpresumed deadrampage …kicked in the stomachmutantfalling down stairsneck breakingshot in the shoulderkicked in the faceknocked outbeaten to deathstabbed in the backshot in the foreheaddouble crossstabbed in the cheststabbed to deathdeath of friendmixed martial artsimpalementstrangulationambushshot in the backf wordinterrogationhand to hand combatheld at gunpointrifleshowdownbrawlpunched in the facerescueshot in the headshot in the chestcar accidentblood splatterfistfightcorpsebeatingshowerpistolsurprise endingchaseknifetitle spoken by characterbare chested maleone word titlebloodviolencefightflashback (See All) |
| Subgenre: | suspenseblack comedymartial arts |
| Themes: | exploitationparanoiabrutalitydeceptionescapefearbetrayalsuicidemurderdeathrevenge |
| Mood: | gore |
| Locations: | cavebar |
| Characters: | self mutilationtough guypolice officer |
| Story: | knife fightthreatened with a knifefoot chasearmoryopen endedsecret societyspiral staircaseblood on shirtfight to the deathbody countbody landing on a carpunched in the chestmercilessnessstealing a carrocket launcher …kicked in the stomachfalling down stairsshot in the armneck breakingshot in the shoulderkicked in the faceproduct placementstabbed in the backone against manyshot in the foreheadshot in the legcigar smokingdouble crosshit by a caranti herostabbed in the cheststabbed to deathmixed martial artsthroat slittingmontagemassacrestrangulationambushsurvivalshot in the backf wordcar crashhand to hand combatheld at gunpointshowdownfalling from heightbrawlgunfightpunched in the faceslow motion sceneshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpseshootoutfirepistolsurprise endingchaseknifeexplosionphotographcigarette smokingdogviolencefightbloodflashback (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
| Subgenre: | black comedymartial artsindependent film |
| Themes: | near death experienceprejudicehoperedemptionparanoiabrutalitydeceptionescapedrunkennessfearbetrayalkidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | cemetery |
| Characters: | tough guyhostagepriestmother daughter relationship |
| Story: | jail cellknife throwingthreatened with a knifefight the systemopen endedstabbed in the shouldermilitiamoral dilemmamutationdisfigurementpunched in the chestmercilessnesshatredexplosiveburned alive …battlefieldsevered armexploding bodyscarknocked outcharacter's point of view camera shotrace against timeattackstabbed in the backtransformationdouble crossfictional waranti herosevered headstabbed in the cheststabbed to deathmixed martial artsthroat slittingimpalementbridgemassacreambushgood versus evilsurvivalsubjective cameradecapitationhallucinationhand to hand combatheld at gunpointrifleshowdownfalling from heightbrawlswordbattlewritten by directorpunched in the faceslow motion scenerescueblood splatterfistfightcorpsebeatingfirepistolsurprise endingchaseknifeexplosionbased on novelfightflashbackviolenceblooddog (See All) |
Air travel is the safest, the FAA says. But the FAA never figured the risk with Charles Rane on board. "The Rane of Terror" has masterminded four terrorist attacks. Soon there will be a fifth -- and that's bad news for the passengers on Flight 163. But there's good news too: the man in seat 57! Wesl …ey Snipes plays John Cutter, an undercover security operative who enters the lavatory and exits to find Rane (Bruce Payne) and his gang have taken over. Cutter's next move is clear. Do. Or be done to. (Read More)
| Subgenre: | suspenseblack comedycult filmmartial arts |
| Themes: | police brutalityunlikely heroparanoiabrutalitypsychopathdeceptionescapefearbetrayalkidnappingdeathrevengemurder |
| Mood: | gore |
| Locations: | police carhospital |
| Characters: | police shootouttough guyhostagepolice officerpolice |
| Period: | 1990s |
| Story: | threatened with a knifefoot chaseinnocent person killedimprovised weaponone linerfight to the deathwisecrack humorpunched in the chestmercilessnessreverse footageredneckswat teamkicked in the stomachhand grenadedie hard scenario …neck breakingkicked in the faceknocked outevil manrace against timebeaten to deathone against manyshot in the foreheaddouble crosschild in perilanti herofalse accusationexploding carmixed martial artsthroat slittingstrangulationambushgood versus evilsurvivalshot in the backhand to hand combatsunglassesheld at gunpointshowdownfalling from heightbrawlgunfightarrestpunched in the faceslow motion scenerescueshot in the headshotgunshot in the chestcar accidentmachine gunblood splatterfistfightshot to deathcorpsebeatingshootoutpistolsurprise endingchaseknifeexplosiontitle spoken by characterflashbackbloodfightviolence (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com