Please wait - finding best movies...
While protecting his village from rampaging boar-god/demon, a confident young warrior, Ashitaka, is stricken by a deadly curse. To save his life, he must journey to the forests of the west. Once there, he's embroiled in a fierce campaign that humans were waging on the forest. The ambitious Lady Ebos β¦hi and her loyal clan use their guns against the gods of the forest and a brave young woman, Princess Mononoke, who was raised by a wolf-god. Ashitaka sees the good in both sides and tries to stem the flood of blood. This is met be animosity by both sides as they each see him as supporting the enemy. (Read More)
Subgenre: | sword and fantasychrist allegorydark fantasyadult animationdisneyepictragedycult filmmartial arts |
Themes: | mythologysamuraiprejudicenaturedeceptionherolovefriendship |
Mood: | animegore |
Locations: | japanforest |
Characters: | samurai swordhuman animal relationshipwarrior |
Period: | 15th century16th century |
Story: | nature conservationsword duelwild boartalking wolfwhite wolfenvironmental issuesenvironmental issueanimal allyhuman versus animalanimal protectionhorse chasegiant animalfemale warriorkatana sworddark hero β¦forest protectionhand to hand combatsword fightknife fightcutting off a handthe westutopia questsevered limbferal childterritorypanelkleprosymoral ambiguitydilemmaironshot with a bow and arrowboarfortdeforestationfamous scoremuskettolerancefablekindnessgirl powersuper strengthconservationfolklorekendodaggerenvironmentalpeacedual wieldstrong female leadcompassionblockbusterhuntermutilationheroinebow and arrowwolfspiritstrong female characterprincehatesevered armopening action scenemanipulationcursedueltransformationprincessjourneyfictional wardisarming someoneanimalweapondecapitationshot in the backcombatfightingdemonrifleshowdownswordhorseblood splatterchaseknifetitle spoken by charactercharacter name in titletwo word titlef ratedviolencebloodfightgun (See All) |
Set in the mystical lands of Persia, a rogue prince and a mysterious princess race against dark forces to safeguard an ancient dagger capable of releasing the Sands of Time -- a gift from the gods that can reverse time and allow its possessor to rule the world.
Subgenre: | sword and fantasymartial artssword and sorceryswashbuckler |
Themes: | heromurdermarriagebetrayalescapedeath of fathertime travel |
Locations: | snowdesert |
Characters: | warriorsoldiertough guyaction hero |
Story: | sword duelhand to hand combatsword fightshot with a bow and arrowdaggerdual wieldstrong female leadheroinebow and arrowstrong female characterprinceprincessfictional warcombatshowdown β¦swordhorsechasetitle spoken by characterviolenceflashbackkissexplosionbattlekung fugood versus evilfoot chaseorphanassassinambushaxemountainarmycolon in titlemixed martial artssnakefalse accusationno opening creditsanti heroone man armykingon the runone against manyfugitivebrotherstylized violencedestinycountry name in titleraceassassination attemptspin offreverse footageshieldsandcrossbowseven word titlebased on video gamechaosframe updeceitbounty hunteralternate realitytigerkingdomblack magicframed for murderunclepalaceswordsmanparkourfortresssorcereradopted sonmacguffinrobesword fightingsword and sandaltitle in titleempirecorrupt officialsubterraneanarmageddonpersiandukeostrichsandstormbrother versus brotherhourglasssheikpersiahuntedoasismagical objectheir to the thronewantedchanging the futuredeath of kingtime reversalfrozen timebrother against brotherstreet urchinbrother killing brotherregentprince of persiabrother brother hugbrother betrays brother (See All) |
When a magic scepter accidentally transports April back through time to 17th Century Japan, the boys take-off in hot pursuit, cowabungling their way out of the sewers right into Samurai-O-Rama! Now they must battle the evil Lord Norinaga to reclaim the magic scepter that will bring them back below t β¦he subways of New York City. (Read More)
Subgenre: | cult filmmartial artsindependent filmsuperhero |
Themes: | samuraiherosurrealismmagictime travel |
Mood: | poetic justice |
Locations: | japansewer |
Characters: | samurai swordwarriorteenagertough guyaction hero |
Period: | 1900s1600s |
Story: | sword duelhorse chasekatana swordhand to hand combatsword fightshot with a bow and arrowmusketdual wieldheroinebow and arrowopening action scenefictional wardisarming someonecombatfighting β¦horsechaseviolencefightsequelexplosionfirefistfightbattlebrawlkung fubased on comic bookambushvoice overthird partfive word titleninjatough girlmartial artistmercenaryvigilantearsonbattlefieldpizzamartial arts masterspearelectronic music scoreslow motiontalking animallifting someone into the airroman numeral in titlepart of trilogyaction heroinechop sockycannonanthropomorphic animalturtlearmorsequel to cult favoritestick fightkung fu fightingkung fu classicfemale fighterninjitsuvigilante justiceunsubtitled foreign languageroman numbered sequelwarlordbo staffcavalryliquidanimal that acts humanflintlock rifleflintlock pistolnunchuckslifting male in airreference to clint eastwoodfurryhockey stickteenage mutant ninja turtlesfeudal japanmusketeersaininja turtlemirage comicslampshade (See All) |
A veteran samurai, who has fallen on hard times, answers a village's request for protection from bandits. He gathers 6 other samurai to help him, and they teach the townspeople how to defend themselves, and they supply the samurai with three small meals a day. The film culminates in a giant battle w β¦hen 40 bandits attack the village. (Read More)
Subgenre: | epiccult filmmartial artscult classic |
Themes: | samuraideceptionherofriendshiplovedeathrevengesuicidefeardrunkennessangergriefhopedeath of wifepanic β¦falling in lovecouragestarvation (See All) |
Mood: | rain |
Locations: | japanforestvillagefarmcampfiretown |
Characters: | samurai swordwarriorhusband wife relationshipfather daughter relationshipchildrenhostagethieftough guyaction heroold friendcrying babysamurai warrior |
Period: | 16th century |
Story: | katana swordhand to hand combatsword fightmoral ambiguityshot with a bow and arrowmusketkendobow and arrowdueldisarming someonecombatrifleshowdownswordhorse β¦chaseviolencegunnumber in titlemale rear nuditybare chested malekisssingingfireshot to deathslow motion scenebattlesecretriverorphanold manprisonermapfishingchild in perilold womantrainingfarmerhorse ridingpremarital sextied upmercenarywaterfallflowerlove interestclass differencesarsonbattlefieldspearhappinessmale bondingcrying womanforbidden lovefollowing someonehonorcrying manburialmoralitycelebrationsufferingmisunderstandinghungerdespairensemble castyoung lovearmorsiegeblind mantragic herostick fightmoral dilemmacrowdmudtombbanditswordsmanpeasantkatanastrategyassumed identitystandofffencingoffscreen killingilliteracyhumorvictorybo staffhouse on firevillagerhillman with no namehostage situationstraight razorharvestlootingflintlock rifleweepingchopping woodricekneelingbarricadebarefoot womansicklejidai gekilong black hairstabbed with a swordmillwashing hairelderly womanpracticemockeryoutburstrecruitingshot with a guncaptive womanhead shavinggenealogyelderly manmaster apprentice relationshiproninsabresakecherry blossomnumber 7 in titlefalling off a horsecult favoritestabbed with a spearweeping womandragged by a horseweeping manfalse alarmrice paddywater millsheathplaying flute1570sadmirationrain fightbarleyhot headedcatching fish by handvillage elderdejectionfather hits daughterhorse drawn plow (See All) |
A quest that begins as a personal vendetta for the fierce Cimmerian warrior soon turns into an epic battle against hulking rivals, horrific monsters, and impossible odds, as Conan realizes he is the only hope of saving the great nations of Hyboria from an encroaching reign of supernatural evil.
Subgenre: | sword and fantasyepicmartial artssword and sorceryalternate history |
Themes: | heromurderdeathrevengesuicidekidnappingjealousypregnancytortureescapemagicdeath of fatherbrutalitysupernatural powerdeath of mother β¦crueltydeath of wifevengeancedeath of daughtermurder of fatherdeath in childbirth (See All) |
Mood: | gore |
Locations: | snowboatwoodscastlecampfirewalled city |
Characters: | warriorhusband wife relationshipfather son relationshipfather daughter relationshipboysoldierthieftough guyaction herowitchsingle fatheryounger version of characterdancing girl |
Story: | sword duelhorse chasefemale warriordark herohand to hand combatsword fightshot with a bow and arrowdaggerdual wieldmutilationbow and arrowsevered armprincessfictional wardisarming someone β¦decapitationshot in the backcombatfightingdemonshowdownswordhorseblood splatterchaseknifecharacter name in titlefightviolencebloodfemale nuditymale nudityflashbackbare chested malesex sceneexplosionthree word titlefireshot to deathfistfightshot in the chestremakeshot in the headrescueslow motion scenebattlefalling from heightmaskbased on comicinterrogationgood versus evilfoot chaseassassinbound and gaggedbased on comic bookambushname in titleaxemassacremountaindisguisethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headnunno opening creditsanti heroone man armychild in perilritualunderwater scenekingcreatureshot in the legdrowningone against manybeaten to deathstabbed in the backkeyperson on fireattackevil mankicked in the facetough girlscarchildbirthexploding bodyneck breakingpremarital sextied upthreatened with a knifemercenarywaterfallbattlefieldfreeze framesingle parenthenchmanpirateburned alivekilling an animalhead buttspearassassination attempteggcatfightslaverykicked in the stomachjumping from heightmonkanimal attackgoatinterracial friendshipcrushed to deathback from the deadslavecelebrationdamsel in distressadventurer3 dimensionalchaosgash in the faceresurrectionfalling to deathprophecystabbed in the headstabbed in the legpunched in the chestdungeoncapturedisfigurementeye patchpassionate kissdemonic possessionblack magicburned to deathstick fightpipe smokingpalaceswordsmandriftermonasterymusclemanstrongmanfireballhuman sacrificeworld dominationshot with an arrowmegalomaniacadventure herosorcerertaverntentacletestcrushed headsword fightingsword and sandalslingshothammockchainedbarbarianprehistoric timesarcherfacial scarrighteous rageclawsubterraneanblacksmithwarlordarm wrestlingavalanchesorceresscavalryhouse firebonefetusman hits a womanincestuous desiresailing shipstarts with narrationwagonsuit of armoraxe fightbattle axenewbornstabbed in the footbuilding collapseone eyed manboulderserpentcatapultwoman in laborstudent teacher relationshiprite of passagestabbed with a swordoraclepulp fictionstone ageancientfalling through icerope bridgepoisonedevil sorcererremake of cult filmmurder of a pregnant womananvilspyglasschained to a wallwarrior womanmaster apprentice relationshipcaesarean birthrun overbound in chainsstabbed with a speartasting bloodsandmanshackledsevered noseslave girlburning villagetwo on a horsegiant octopushorse drawn wagonrobert e. howardbased on pulp magazinefreed slavecaesarean sectionmolten metalchild warriortrebuchetswallowing a keyjumping off cliffpaleolithic ageseeing father murderedvolley of arrowsfall through floor10000 b.c.100th century b.c.four against onehyborian agenatural bridgetied to a wagon wheelsword forging (See All) |
Subgenre: | sword and fantasychrist allegorydark fantasymartial artscoming of ageblack comedysupernaturalsword and sorceryrevisionist history |
Themes: | mythologydeceptionfriendshipmurderdeathrevengesurrealismkidnappingmoneybetrayaljealousyprisonfearescapefuneral β¦monstermagicrobberyangerdeath of fatherbrutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrifice (See All) |
Mood: | rainnightmaredarkness |
Locations: | forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipbrother sister relationshipprostitutesoldierhostagethieftough guyaction herolittle boy β¦maidwitchuncle nephew relationshipmermaidself doubt (See All) |
Story: | giant animaldark herohand to hand combatsuper strengthfolkloredual wieldblockbusterbow and arrowwolfsevered armopening action scenemanipulationtransformationfictional wardisarming someone β¦decapitationshot in the backcombatfightingdemonshowdownswordhorseblood splatterchaseknifetitle spoken by charactercharacter name in titlebloodfightviolenceflashbackdogbare chested maleexplosionsurprise endingfirebased on bookbeatingcorpseshot to deathfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightinterrogationprostitutionbritishislandriversubjective cameragood versus evilspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagethroat slittingbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chestmapsnakenonlinear timelinesevered headanti heroone man armychild in perilritualunderwater scenekingcreaturefemme fataleshot in the legon the runtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackfugitivepoisoncharacter's point of view camera shotevil manknocked outshot in the shoulderscarexploding bodyloss of fatherratthreatened with a knifewaterfallloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairscaptainsabotagedestructionburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedgiantpoolrebeljumping from heightrebellionknightmind controlcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveeaten aliveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on faceresistancehatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistmedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownbag over headmusclemanstrongmanscene before opening creditstowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
The tyrant Gedren seeks the total power in a world of barbarism. She attacks and kills the keepers of a powerful talisman just before it is destroyed. Gedren then uses the power of the talisman in her raid of the city Hablac. Red Sonja, sister of the keeper, sets out with her magic sword to overthro β¦w Gedren. The talisman's master Kalidor follows to protect her. Of course they fall in love - however Red Sonja's power bases on the oath to never give herself to any man... (Read More)
Subgenre: | sword and fantasycult filmmartial artssword and sorceryalternate historyswashbuckler |
Themes: | loverapewrestling |
Locations: | castlesea monster |
Characters: | warriorfemale protagonisttough guyaction hero |
Story: | sword duelfemale warriorhand to hand combatsword fightgirl powerkendobow and arrowsevered armduelfictional wardisarming someonedecapitationcombatfightingshowdown β¦swordhorseblood splattercharacter name in titlebloodviolencefightfemale nuditybare chested malekissblondebattlemaskcleavagewomanmixed martial artsstabbed in the chesttough girlscarunderwaterdismembermentbattlefieldspearlifting someone into the airvillainessaction heroinecrushed to deathguardcrossbowpsychotronicsiegeteleportationbeheadingswordsmanmusclemanstrongmanstandoffadventure heroredheaded womanfencingbarbarianprehistoric timeslesbian subtextgiant spiderkiller robotbattle axetalismanstone agenipple sliphyborian agelava stream (See All) |
In 19th century Qing Dynasty China, a warrior gives his sword, Green Destiny, to his lover to deliver to safe keeping, but it is stolen, and the chase is on to find it. The search leads to the House of Yu where the story takes on a whole different level.
Subgenre: | cult filmmartial artsmelodramawuxia |
Themes: | deceptionherolovemurderdeathrevengekidnappingbetrayalpoliticsescapeweddinginvestigationrobberytheftbrutality β¦unrequited lovevengeance (See All) |
Mood: | ambiguous ending |
Locations: | forestrestaurantdesertvillagewoodsrooftopcavechinarooftop chase |
Characters: | warriorfather daughter relationshippolice officerhostagesister sister relationshiptough guylove triangleaction heroteacher student relationshipdaughterchinesedeath of hero |
Period: | 18th century17th century |
Story: | sword duelfemale warriorkatana sworddark herohand to hand combatsword fightknife fightkendodual wieldheroinedueldisarming someonecombatshowdownsword β¦horsechaseknifetitle spoken by characterf ratedfightviolencebloodbased on novelflashbackkissfingeringsingingsurprise endingfistfightrescuepunched in the facebattlebrawlkung fufoot chasemountaindisguisebridgeimpalementfour word titlemixed martial artspoliticiannunno opening creditsunderwater scenepolice officer killedflash forwardone against manytreewidowerfugitivepoisonundercoverninjatentkicked in the facetough girlpursuitmartial artistloss of fatherpremarital sextied upfirst partunderwaterwaterfallmagical realismstylized violencerunawayfalling down stairsmartial arts masterflyingspearheavy raincatfightkicked in the stomachvillainessservantjumping from heighthonormonkaction heroinebald manguardarranged marriageintriguemercilessnessmentorpunched in the chestbathingoutlawdeceitundercover coptigermustachetragic heropolice inspectorsecret identitychallengemain character diesbanditswordsmanhistorical fictionparalysismonasterylost lovegovernortavernforeplaydruggedfemale martial artistmacguffinresponsibilityfemale villaintragic pastwoman fights a mantied up while barefootaristocracybo staffbaldwanted posternew agewu shusecret lovebeijing chinamentor protege relationshipdojo19 year oldhorse drawn carriagemercywing chunantidotebuddhist monkwire fuman fights a womangovernessfemale ninjahouseguestfemale thiefprotegebambooolder woman younger woman relationshipbare midriffcalligraphywuxia fictionswordswomanabbeydowrycombmaster apprentice relationshippoison dartchopsticks the eating utensilunspoken lovebald herobelly buttonex lover ex lover relationshiphorseback chaseknife in shoeqing dynastybuddhist nunjumping from a bridgesheathmountaintop monasteryopening creditstaskmastermale dragtai chi sworddefying gravity (See All) |
A Journeyman ninja by name of Jubei stumbles upon a plague, an evil clan of demons, a national crisis, and a beautiful ninja girl.
Subgenre: | dark fantasyadult animationepictragedycult filmmartial artssupernatural |
Themes: | samuraimythologyherolovemurderdeathrevengesurrealismrapemonstermagicseductiontravelangersupernatural power β¦unrequited lovecrueltyblindnessjusticenear death experiencerape and revengesupernatural powers (See All) |
Mood: | animegoreneo noirpoetic justice |
Locations: | japanforestboatwatervillageshipblood in waterdeath at sea |
Characters: | samurai swordtattoojapanese womanaction herojapanesenear deathblood revengedeath of a girl |
Story: | sword duelfemale warriorkatana sworddark herosword fightdaggeropening action scenedueltransformationdecapitationdemonshowdownswordhorseblood splatter β¦chaseviolencebloodgunfemale nuditynuditybare breastsflashbackbondagebare chested malesex scenekissfemale rear nudityfirelickingcryingbreast suckingrescuepunched in the facekissingfalling from heightrunningswimminggood versus evilspycandleambushold manstabbingbridgearmymapsnakeunderwater scenecontroversycreatureone against manytreescreamingelectrocutionattackpoisonmissionninjascreammartial artistgovernmenthorse ridingunderwatersacrificeespionageblood spatterpowerstylized violencegoldmartial arts masterdestructionhead buttwoundquestsexual abuserageenemybuttockscrying womanbuttfaked deathhonornaked womanchop sockypromiseseriessevered fingerblood on faceteamresurrectionevacuationimmortalityeye gougingstabbed in the eyeblind manbroken armarrowchallengeblindtorso cut in halfheroismbisexualitysaving a lifeswordsmanelectricitykatanaviolence against womenbandagekung fu classicrunning awayschemelong hairsexual violencemegalomaniacponytailclimbingmessageninjitsuforeplaypoisoningfinger cut offtravelingaction violenceextreme violencetreacherygraphic violencetragic loverighteous ragebloodshedjumpinggrassimmortalcut into piecesspitting bloodbloody violencearm cut offcoughing bloodwoman undressingviolent deathtreesdeath of loverscreaming womanloinclothepic battlejumpdirtarm ripped offcutscrollantidotedrinking bloodhaydark heroineshurikenangryheadbandfemale ninjawaspcompanionmagical swordninja warriorfireflylife and deathstabbedbamboomass deathninja masterriding a horsedeath of main charactergory violencepoisonedtouching breastsfake deathviolence against a womanblood on mouthfeudal japantribalbloody sprayangry mandoomed loveflamescryelectrocutedbloodlustcut in halfdeath by firehole in wallwoman undressing for a mantoxinbloodystabbreast squeezingbreaking through a wallwoman electrocutedjapanimationviolenttasting bloodclimbing a wallcompanionshipancient timestragic deathbroken dreamlicking someoneblood spurtclimbdeath by swordkiss of deathlife savingcoughing up blooddeath of womanenemieshorse riderbloody liplong fingernailsbloodthirstyfaking a deathrock monstersnake womanblood dripbloody messbreaking through walldecapitatedultraviolencebamboo forestbloody waterchase scenetownspeoplejapanese governmentancient japanburn to deathnear death survivorsnakesanimated violenceclimbing a cliffdestroyed wallinsane violencetraveling companionburning shipcutting off fingerfingers cut offgushing bloodheroic deathmale companionpoisonerspit blood (See All) |
The lead character, called 'The Bride,' was a member of the Deadly Viper Assassination Squad, led by her lover 'Bill.' Upon realizing she was pregnant with Bill's child, 'The Bride' decided to escape her life as a killer. She fled to Texas, met a young man, who, on the day of their wedding rehearsal β¦ was gunned down by an angry and jealous Bill (with the assistance of the Deadly Viper Assassination Squad). Four years later, 'The Bride' wakes from a coma, and discovers her baby is gone. She, then, decides to seek revenge upon the five people who destroyed her life and killed her baby. The saga of Kill Bill Volume I begins. (Read More)
Subgenre: | epictragedycult filmmartial artsindependent filmblack comedypost modernallegory |
Themes: | samurailovemurderdeathrevengerapebetrayalpregnancytortureweddingpsychopathdeath of fatherbrutalitydeath of motherforgiveness β¦self sacrificemurder of father (See All) |
Mood: | goreneo noirpoetic justice |
Locations: | japanhospitalchurchsnowmotorcycleairplanenightclubairportkitchenwheelchairbaseballrooftopstormschool bus |
Characters: | samurai swordteenagermother daughter relationshiptattoofemale protagonistgirlnursedancerbabybullyjapanesepolice detectivevillainsnipersheriff β¦frenchself mutilationchinese american (See All) |
Period: | 1980s1990s2000s20th century21st century |
Story: | sword duelfemale warriorkatana sworddark herohand to hand combatsword fightmoral ambiguitycompassionheroinehatesevered armopening action scenedueljourneydisarming someone β¦weapondecapitationcombatshowdownswordblood splatterknifecharacter name in titlef ratedfightbloodgunviolencesexflashbackdancingphotographsurprise endingpistolfirevoice over narrationcell phoneshootoutbeatingcorpsefistfightslow motion scenegunfightbrawlfalling from heightshootingheld at gunpointkung fuf wordsubjective camerawinemassacrestabbingwomanimpalementmixed martial artssnakenonlinear timelineapologysevered headdream sequenceanti herodrawingchild in perilfemme fatalepainlimousineone against manyorganized crimecharacter repeating someone else's dialoguebeaten to deathdangermini skirtcharacter's point of view camera shotevil mantough girlattempted rapelong takescarmartial artistsplit screentraploss of fatherfirst partloss of mothervigilantedismembermentsubtitled scenefreeze framecrime bosstraitorteamartial arts masterbullethypodermic needlescene during opening creditscomacowboy hatmobstervillainesssevered handcovered in bloodbrideparking garagehonoraction heroinefemale killerbroken legmasked mangun battlepresumed deadcelebrationpromisetokyo japanmisunderstandinganimated sequencementorensemble castblack and white sceneatticblood on shirteye gougingdisfigurementknife throwingeye patchtragic herosevered legdead woman with eyes openwilhelm screamshot multiple timesbullet timereflectionblood on camera lensimperative in titlehead blown offfemale psychopath17 year oldfemale spybullet balletknocked unconsciousrhyme in titlewhistlingfemale herogun dueldripping bloodcrushed headkimonorespectfemale villainextreme violencehiding under a bedbechdel test passedoverhead camera shotferrarione woman armyretributionsevered footbludgeoninghatchetdying wordstragic villainknife in the chestmercytranslationmangamosquitodark heroinepocket knifeorderlyfrying panscreaming in painenglish subtitles in originalwomen fightperson in car trunkfemale bare feetscreaming mancode nametalking to the audiencefalling down a hillexposed brainwoman murders a mansailor uniformpasadena californiableeding from eyespregnant bridereflection in eyeachilles tendon cutfire pokerblood suckingwoman murders a womanfemale snipertragic heroinerationalitydeath spasmkiller teensushi barpregnant woman shotspinning axejapanese gardenobligationreference to charlie brownhiding on the ceilingbleeding from the eyessilent witnessblood on wedding dress (See All) |
The Kingdom of Alagaesia is ruled by the evil King Galbatorix, a former dragon rider that betrayed his mates and his people in his quest for power. When the orphan farm boy Eragon finds a blue stone sent by Princess Arya, he sooner realizes that it is a dragon egg. When the dragon Saphira is born, E β¦ragon meets his mentor Brom, and becomes the dragon rider foreseen in an ancient prophecy that would set his people free from the tyrant Galbatorix. Eragon meets the rebels Varden and together they fight against the evil sorcerer Durza and the army of Galbatorix in a journey for freedom. (Read More)
Subgenre: | sword and fantasyepiccult filmmartial artssword and sorceryswashbuckler |
Themes: | mythologyheromonstermagiccourage |
Locations: | castle |
Characters: | warriorsoldiertough guy |
Story: | sword duelhand to hand combatshot with a bow and arrowdaggerhunterbow and arrowdueljourneyfictional wardisarming someonecombatfightingdemonswordhorse β¦character name in titlefightbased on novelone word titlebased on bookbattlesecretsubjective cameragood versus evilambushdeath of friendmixed martial artskingdragonbattlefieldspeareggknightdwarfwizardsiegekingdomtragic herostick fightelfheroismadventure herofantasy worldsword fightingsword and sandalopen endedchosen onestaffteenage herofictional countrybattle axeteenager fighting adultfire breathing dragonswordplayevil kingevil wizardhaystackflying dragondragon riderdragon featurehuman dragon relationship (See All) |
In Ancient Greece 1200 B.C., a queen succumbs to the lust of Zeus to bear a son promised to overthrow the tyrannical rule of the king and restore peace to a land in hardship. But this prince, Hercules, knows nothing of his real identity or his destiny. He desires only one thing: the love of Hebe, Pr β¦incess of Crete, who has been promised to his own brother. When Hercules learns of his greater purpose, he must choose: to flee with his true love or to fulfill his destiny and become the true hero of his time. The story behind one of the greatest myths is revealed in this action-packed epic - a tale of love, sacrifice and the strength of the human spirit. (Read More)
Subgenre: | christ allegoryepicmartial artsconspiracy |
Themes: | mythologydeceptionherolovemurderdeathrevengesuicidebetrayaltortureescapesupernatural powerdeath of motherunrequited lovehope β¦greek mythology (See All) |
Locations: | forestdesertvillagewoodsshipcastlecavecampfire |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipbrother brother relationshipteachersoldierhostagetough guyaction hero |
Story: | sword duelhand to hand combatsword fightsuper strengthpeacedual wieldbow and arrowspiritprinceopening action sceneprincessdecapitationshot in the backcombatshowdown β¦swordhorsechaseknifecharacter name in titlefightbloodviolencebare chested maleexplosionsurprise endingfirebeatingshot to deathfistfightshot in the chestshot in the headslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightgood versus evilambushaxedeath of friendthroat slittingarmyimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headno opening creditsone man armykingshot in the legskinny dippingattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathstabbed in the backelectrocutionstatuekicked in the facelightningshot in the shoulderhorse ridingneck breakingthreatened with a knifemercenarywaterfallshot in the armwhippingbare chested male bondagequeenbattlefieldstylized violencecaptainspearheavy rainhelmetslaverykicked in the stomachjumping from heightrebellionforbidden loveanimal attackslavefull moonshieldcrossbowfight to the deathstabbed in the throatwhip3 dimensionalegyptstabbed in the legpunched in the chestliondungeonrainstormknife throwingpalacestabbed in the armcommandercheering crowdarenagoddesssword and sandalstabbed in the shoulderarcherbettinggladiatorwarlordforced marriageshot in the crotchanimal killingrock climbinghusband murders wifeman hits a womanbeefcakeancient greecestabbed in the footorigin of heroflaming arrowtyrannybare knuckle fightingspear throwingdeus ex machinahanged by the neckconquestherculeschariotvirtual setdemi godtunicamphitheaterbound in chainsreference to zeusflaming swordbranding ironcliff divingafrican lionfemale gladiatorgolden eagleblood sportarmy on the march (See All) |
1400 B.C., a tormented soul walked the Earth that was neither man nor god. Hercules was the powerful son of the god king Zeus. For this, he received nothing but suffering his entire life. After twelve arduous labors, and the death of his family, this dark, world-weary soul turned his back on the god β¦s finding his only solace in bloody battle. Over the years, he warmed to the company of six similar souls, their only bond being their love of fighting, and the presence of death. These men and women never question where they go to fight, or why, or whom, just how much they will be paid. Now, the King of Thrace has hired these mercenaries to train his men to become the greatest army of all time. It is time for this bunch of lost souls to finally have their eyes opened to how far they have fallen, when they must train an army to become as ruthless and bloodthirsty as their reputation has become. (Read More)
Subgenre: | sword and fantasymartial artsblack comedysword and sorcery |
Themes: | deceptionlovemurderdeathrevengekidnappingbetrayalghostprisondrunkennessescapemonsterredemptionfaithdeath of wife β¦self sacrificemurder of familygreek mythology (See All) |
Mood: | gorenightmaremyth |
Locations: | foresttrainsnowvillageearthwalled city |
Characters: | warriormother son relationshipfather daughter relationshipsoldierhostagetough guyaction herobullyuncle nephew relationshipex soldier |
Story: | giant animalfemale warriordark herohand to hand combatsword fightknife fightdaggerdual wieldbow and arrowwolfprincesevered armopening action sceneprincessfictional war β¦decapitationshot in the backcombatfightingshowdownswordhorseblood splatterknifetitle spoken by charactercharacter name in titlefightbloodviolenceone word titleflashbackdogbare chested malefemale rear nuditypartyfirecorpseshot to deathshot in the chestshot in the headrescueslow motion scenepunched in the facebattlefalling from heightbased on comicjailhallucinationgood versus evilorphanbased on comic bookambushaxemassacremountaindisguisemontagethroat slittingarmyimpalementstabbed to deathprisonerstabbed in the chestmapsnakenonlinear timelinebrunettesevered headno opening creditsone man armychild in perildouble crosskingcreatureshot in the legtraininglegendstabbed in the backperson on fireattackstorytellingstatuetentknocked outkicked in the facetough girllightningfarmershot in the shoulderdeath of sondarkneck breakingthreatened with a knifemercenaryshot in the armgeneralbare chested male bondagekillingbattlefieldstylized violencecivil warrockpiratetraitorgolddestinyhead buttspearhelmetjail cellvandalismfraudlossclubtorchfateaction heroineanimal attackfalse identitycrushed to deathfull moonadventurershieldhaunted by the pasttarget practicesufferingpaststabbed in the throatwhipson3 dimensionalmuteshot in the facegreecestabbed in the headframe uplostswampstabbed in the leghit on the headexploding headlionaerial shotdungeonsoulcaptureknife throwingstabbed in the eyekingdomtragic heropalacecrowdrugged drinkstrongmangiant monstermegalomaniacstabbed in the armadventure herotavernbased on graphic novelsword and sandalstabbed in the shoulderteamworkchainedshot in the throatarcherrighteous ragestabbed in the facetragic pastdeath of familywarlordpsychotronic filmscytheanimal killinglong brown hairdreadlocksathens greeceepic battlestrong manhorse drawn carriageancient greeceaxe fightdouble entendreflaming arrowtyrannygiant creatureambiguitywoman hits a manspear throwingherculeschariotevil kingprecognitionclosing eyes of dead personhead on a stakehurttunictooth ripped outamazon warriorbroken jawfemale mercenaryhydrasoothsayercerberusfemale archeropening creditsheir to thronedark worldgod king (See All) |
A village is attacked by the evil ruler of the Snake Cult, Thulsa Doom ('James Earl Jones' (qv)) and his evil warriors, when Thulsa Doom and his warriors kills his parents, a young boy named Conan ('Jorge Sanz (I)' (qv)) is enslaved. Years later, Conan grows up and becomes a mighty warrior and is tr β¦ained as a fighter. After years as a slave and as a gladiator, Conan is set free. Conan sets out on a quest as he vows to avenge his parents and solve the riddle of steel. Joined by a archer named Subotai ('Gerry Lopez (I)' (qv)), a beautiful thief who falls in love with Conan, Valeria (sandahl Bergman') and a Chinese wizard ('Mako (I)' (qv)), Conan and his companions sets out to rescue Princess Yasmina ('Valerie Quennessen' (qv)), daughter of King Osric ('Max von Sydow (I)' (qv)), from the Snake Cult, and get his revenge on Thulsa Doom and avenge his parents. (Read More)
Subgenre: | sword and fantasychrist allegoryepiccult filmmartial artssword and sorceryalternate history |
Themes: | mythologysamuraifriendshiplovemurderdeathrevengesuicideghosttorturefuneralmagicseductiondeath of fatherbrutality β¦death of mothercannibalismvengeanceself sacrificemurder of fathermurder of mother (See All) |
Mood: | gorepoetic justice |
Locations: | desertseatown |
Characters: | samurai swordwarriorfather son relationshipmother son relationshipboythieftough guyaction herowitchrevenge motiverevenge seeker |
Story: | sword duelkatana swordhand to hand combatsword fightfamous scorekendomutilationbow and arrowwolfprincessfictional wardecapitationcombatdemonshowdown β¦swordblood splattercharacter name in titlefightbloodviolencefemale nudityfemale frontal nuditybare chested malesex scenethree word titlevoice over narrationface slapshot in the headbattlefalling from heightorgykung fugood versus evilname in titleaxethroat slittingarmyimpalementstabbed to deathstabbed in the chestsnakesevered headcultanti heroone man armypart of seriesnarrationkingfemme fataleperson on firefirst of seriesevil manpremarital sexsacrificebattlefieldrunawaytwenty somethingathletekilling an animalspearslaverywitchcraftsevered handpart animationseriesfight to the deathcannibalwizardpsychotronicbooby trapcapturedeath of loved oneblack magiccamelheroismnarrated by characterbreak incrucifixionmusclemannarratorstandoffmegalomaniacsorcererarenahypnotismmasteractual animal killedsword fightingsword and sandalfinal battlehandbarbarianprehistoric timesarcherorchestral music scoregladiatorharemwarlordquotationcounter culturevultureloinclothalternate versionstabbed in the mouthinterspecies sexfuneral pyreserpentdeath of petreference to friedrich nietzscheevil powerstone ageancientgiant snakesteelevil sorcererfilm starts with quoteeating human fleshtwo against onewarrior womanavengerquotewarrior racehead on a stakerevenge killingmongolmuscleskilled by a dogpeplumman beastsymphonic music scorecannibal cultblueberrybroken swordfilm starts with a quoterobert e. howardavengebased on pulp magazinelotusbased on multiple workspaleolithic agesnake pitman versus beast10000 b.c.100th century b.c.hyborian agemute villainsacrificing own lifesword forging (See All) |
A demon who seeks to create eternal night by destroying the last of the unicorns and marrying a fairy princess is opposed by the forest boy Jack and his elven allies in this magical fantasy. Two different versions of this picture feature soundtracks by either Tangerine Dream or Jerry Goldsmith.
Subgenre: | sword and fantasychrist allegorydark fantasycult filmfairy talesword and sorceryswashbuckler |
Themes: | mythologyherobetrayalmonstermagicseductiondevil |
Locations: | forest |
Characters: | warriorboyfriend girlfriend relationship |
Story: | sword duelsword fightshot with a bow and arrowbow and arrowduelprincessfictional wardisarming someonedecapitationcombatdemonshowdownswordsurprise endingfire β¦rescuegood versus evilmissiongothiclifting someone into the airsexual desireshieldreference to satanblack magicelfbrainwashingtemptationadventure herobeastsorcererunderworldsword and sandalgoblinunicornparadiseevil godlifting a male into the aircomfortd box motion codeseductive dancespiritual redemption (See All) |
The wandering barbarian, Conan, alongside his goofy rogue pal, Malak, are tasked with escorting Queen Taramis' virgin niece, Princess Jehnna and her bodyguard, Bombaata, to a mystical island fortress. They must retrieve a magical crystal that will help them procure the horn that legends say can awak β¦en the god of dreams, Dagoth. Along the way, Conan reunites with the wise wizard, Akiro and befriends the fierce female fighter, Zula. Together the heroes face ancient traps, powerful Wizards, plots of betrayal, and even the dream god, Dagoth, himself! (Read More)
Subgenre: | sword and fantasydark fantasycult filmmartial artsindependent filmsword and sorceryalternate history |
Themes: | heromurdermonsterwrestling |
Locations: | desertcastle |
Characters: | warriorthieftough guyaction heroaunt niece relationship |
Period: | 1980s20th centuryyear 1984 |
Story: | sword duelhorse chasefemale warriorhand to hand combatsword fightkendodaggerdual wieldopening action scenetransformationprincessdisarming someonecombatshowdownhorse β¦blood splattercharacter name in titlebloodviolencesequelbare chested malebeatingfistfightmirrorblonderescuepunched in the facebrawlambushname in titlethroat slittingmixed martial artsstabbed in the chestsevered headcultanti heroone man armyvirginkeystatuewaterfallqueenbattlefielddestinyhead buttspearmagicianstabbed in the stomachkicked in the stomachback from the deadchokingguardreverse footagehit in the crotchwizardknife throwingkingdommutationsequel to cult favoritestick fightcamelspittingswordsmanhuman sacrificeadventure herosword fightingsword and sandalbarbarianprehistoric timeschosen onestaffbeefcakekicked in the groinsevered earaxe fighthornbreaking glasslast of seriesgodsasian manstone agespear throwingrenegadejapanese manfoolflying kickscratchchoke holdtwentieth centuryaxe throwingstabbed with a spearstatue comes to lifehall of mirrorsvirgin sacrificerobert e. howardbased on pulp magazinestabbed with knifeenchanted forestplainsfalse promisescratching someone's facepaleolithic agebody slamstabbed with a stickman versus beastwizards' duel10000 b.c.100th century b.c.grabhyborian agebear hugbloody scratches (See All) |
While hunting in the forest, Lord Asano of Ako and his samurai find a young half-breed and take him with them to live in the castle. Several years later, Lord Asano holds a tournament to welcome the Shogun to Ako. The night after the tournament, Lord Asano is bewitched into hurting Lord Kira of Naga β¦to, and is punished into committing seppuku by the Shogun. Realizing that it was a Lord Kira's evil plot, the samurais and the half-breed sets out for revenge against the Shogun's order. (Read More)
Subgenre: | sword and fantasydark fantasyepictragedyconspiracysword and sorcery |
Themes: | samuraideceptionmurderdeathrevengesurrealismsuicidekidnappingghostescapeweddingmonstermagicdeath of fathersupernatural power β¦redemptionunrequited loveritual suicide (See All) |
Locations: | japanforestsnowcemeteryvillagewoodslakeshipcastlecampfire |
Characters: | samurai swordwarriorhusband wife relationshipfather son relationshipfather daughter relationshipsoldierhostagetough guyaction heroteacher student relationshipwitchself mutilationhuman versus monstersamurai warriorhunting party |
Story: | sword dueldark herosword fightmusketbow and arrowmanipulationdecapitationshot in the backcombatdemonshowdownswordhorseblood splatterchase β¦knifetitle spoken by characterbloodviolencenumber in titleflashbackbare chested maleexplosionsurprise endingbased on true storyfirebeatingcorpsedigit in titleshot to deathshot in the chestshot in the headrescuebattlefoot chaseorphancandleambushaxemassacremountaindisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestmapfalse accusationsevered headno opening creditsritualcreatureshot in the legnecklacelegendstabbed in the backprologueperson on fireattackpoisondragonexploding bodyneck breakingtraploss of fatherdirectorial debutshot in the armbare chested male bondagebattlefieldstylized violenceburned alivespearheavy raintempleexploding buildingwitchcraftspidervillainessgiantforbidden lovecgihonortournamentburialslavepresumed deadguardarranged marriagecrossbowfight to the deathstabbed in the throat3 dimensionalshot in the facestabbed in the headmentorexilemeditationsnowingtragic heroburned to deathimprisonmenthorseback ridingbeheadingillusionhistorical fictionstabbed in the handoutcastmysticismfoxgiant monstertemptationtombstoneshot with an arrowfarmhouseyoung version of characterstabbed in the armdrumbeastfortressfilm starts with textman kills a womanhead cut offarchershape shiftercorrupt officialtragic endingshapeshiftingsubterraneanshrinesorceressforced marriageanimal killingarmorypitmagic spelltitle spoken by narratorends with texthorse drawn carriagescrollbanishmenthutsuper speedstabbed in the footchopsticksfire breathingstudio logo segues into filmman wearing a wigjapanese culturetyrannyoil lampopening narrationjidai gekigiant creaturebare knuckle fightingmagical swordgunpowderfire breathing dragontroubled productionwuxia fictionbased on legendbegins with narrationcheeringfeudal japanhalf breedhara kiristabbed through the chinroninshogunslow motion sequencebowingmagical creatureseppukuwooden sworddishonoreyes different colorhyper speedcode of honorcommitting suicidescarsball and chainone year later1 year laterbokkenhuman versus dragonsamurai erainjured manbow the weaponasian dragonsamurai armourwooden bridgebathing in a streamfilm ends with texthonorable deathsold into slavery (See All) |
In New York, the owner of a sophisticated antique shop Russell Edwin Nash is challenged to a sword fight in the parking lot of the Madison Square Garden by a man called Iman Fasil that is beheaded by Russell. He hides his sword and is arrested by the police while leaving the stadium. Russell recalls β¦ his life in the Sixteenth Century in Scotland, when he is Connor MacLeod and is deadly wounded in a battle against another Clan. However he surprisingly survives and his Clan believes he has a pact with the devil and expels him from their lands. Then he meets Juan Sanchez Villa-Lobos Ramirez that explains that he is immortal unless he is beheaded. Further, the immortals dispute a game killing each other and in the end only one survives receiving a price with the power of the other immortals. Russell is released by the police, but the snoopy forensic agent Brenda J. Wyatt is attracted by the case since she founds fragments of an ancient Katana and follows Russell. But the also immortal Kurgan is hunting down MacLeod and Brenda is in the middle of their battle. (Read More)
Subgenre: | sword and fantasydark fantasycult filmmartial artsdark comedysword and sorcery |
Themes: | herofriendshiplovemurderdeathkidnappingrapetortureinvestigationmagicmemorysupernatural powerwrestling |
Mood: | gorerain |
Locations: | foresthospitalnew york citybarbeachchurchhotelhelicoptersnowboatvillagewoodspolice stationpolice carlake β¦castleamerica (See All) |
Characters: | warriorpoliceboyfriend girlfriend relationshipprostitutepolice officerdetectivephotographertough guyaction herolittle girlpolice detectiveteacher student relationshipgermanamerican β¦police arrest (See All) |
Period: | 16th centuryworld war two1980s1940s1500s |
Story: | sword duelkatana sworddark herosword fightelkkindnesskendodaggeropening action sceneduelfictional wardisarming someoneanimalweapondecapitation β¦combatshowdownswordhorsetitle spoken by characterfightbloodviolencesexnudityone word titleflashbackkissphotographsingingcryingbeatingcorpsefistfightmachine gunblondepunched in the facewatching tvcomputercamerabattlebrawlmaskshootingpaintingheld at gunpointtearsrunningrock musicinterrogationhandcuffsrevolvermanhattan new york cityreportergood versus evilgay slurflashlightcandlestabbingbridgearmymixed martial artsfishnunone man armypart of seriesbartendertrainingelectrocutionbuxomevil manlightningtankscreamfirst partkissing while having sexpubnewspaper headlinebattlefieldpoweruzientertainmentdestructionwoundgothictape recordercomic bookhelmetloss of loved onebuttockstimeaudienceknightparking garagehonorpromiseshieldthunderold agescotlandzoopsychotronicimmortalityrowboatmentoraquariumlionsuperstitionevidencetribetragic herobonfirereckless drivingwrestlershaved headrefereeparking lotshowpetenergyswordsmansunsethistorical fictionkatanaalleytelling someone to shut upfortressfencinglatinarenapressaudio cassettemonitorsword fightinghead cut offdocumentmicroscopefemale coprepeated lineboxing ringimmortaladopted daughterantiquehorse and wagoniconbagpipesvalleymortalitychrysler building manhattan new york citymentor protege relationshipex marinescottishflintlock pistolsexual intercoursebanishmentbattle axewrestling matchmetropolisspectatorforceannouncerkiltprocessionwrestling ringrudenessbannerpracticeclanover the topgeesenewsstandalley fighthorsebackreference to mozartrapierhorseshoesiren the alarmlong swordhighlandscitadeloxenhighlandercar collisionstone bridge1530scentury1540s (See All) |
Subgenre: | sword and fantasychrist allegorymartial artscoming of ageabsurdismslapstick comedyfish out of watersteampunkswashbuckler |
Themes: | deceptionherofriendshipmurderdeathrevengesurrealismkidnappingbetrayalfearescapemagicfaithhopecourage β¦near death experience (See All) |
Locations: | forestboatlondon englandwoodsshipouter spacecavecampfirecable car |
Characters: | warriormother son relationshipchildrenboybabyhostagenative americanamerican abroadmermaidship captaincrying boyboy crying |
Period: | world war two1940s1930s |
Story: | sword duelgiant animalfemale warriorhand to hand combatsword fightpandual wieldprincessjourneyfictional warcombatshowdownswordchaseknife β¦title spoken by charactercharacter name in titleviolencefightgunbased on novelone word titleexplosionsurprise endingpistolfirevoice over narrationfistfightface slaprescueslow motion scenepunched in the facebattlebrawlfalling from heightletterheld at gunpointbombriversubjective cameragood versus evilorphanflashlightambushaxemountainmixed martial artsmapnunno opening creditschild in perilunderwater scenecreaturesearchon the runtrainingflash forwardattempted murdertreecharacter repeating someone else's dialogueprologuekeyattackfugitivecharacter's point of view camera shotstatueevil manknocked outkicked in the facetough girlskeletonmartial artistexploding bodytied upthreatened with a knifebattlefieldstylized violencehenchmanflirtingropepiratedestinycaptainflyingspearslaverycowboy hatjail cellkicked in the stomacheccentricgiantjumping from heightirishorphanagetorchaction heroineanimal attacksocial commentarybald manslavecannoneaten aliveguardvisionexplosivechild's point of viewbraveryfairyanimated sequencechild protagonist3 dimensionalfalling to deathprophecyimmortalitystabbed in the head3dpunched in the chestbooby trapmusical numbertribeminekingdomcellarflamethrowerprequelclose up of eyesheroismflagminingfemale fightershipwreckcrocodilecomic reliefadventure herohanging upside downcrystalcrash landingfantasy worldfighter pilotreluctant heroilliteracyaltered version of studio logohumoralligatortrampolineminerhit with a shovelwoman fights a manair raidsubterraneanfart jokejailbreakdogfightcockney accentanachronismfighter planechosen oneexploding airplanepirate shipcomeuppancefalling through the flooraxe fightwoman punches a manhidden roompendantorigin of heronestzero gravityman fights a womanair strikechild herogiant creaturepickaxeslave laboralternate worldblimpuse of bloody as epithetkicked in the buttfighting in the airreference to peter panspyglassair battlecannonballpirate captainroyal air forcewarrior racereference to nirvanainsurrectiongiant birdtinker bellcaptain hookflying boywalking the plankchild slaveryjolly rogertotemaerial battleflying fishflying shipnever neverlandchild slavetribal leaderblackbeardflying boatdelayed gravityhole in floor (See All) |
A 14th century Crusader returns to a homeland devastated by the Black Plague. A beleaguered church, deeming sorcery the culprit of the plague, commands the two knights to transport an accused witch to a remote abbey, where monks will perform a ritual in hopes of ending the pestilence. A priest, a gr β¦ieving knight, a disgraced itinerant and a headstrong youth who can only dream of becoming a knight join a mission troubled by mythically hostile wilderness and fierce contention over the fate of the girl. When the embattled party arrives at the abbey, a horrific discovery jeopardises the knight's pledge to ensure the girl fair treatment, and pits them against an inexplicably powerful and destructive force. (Read More)
Subgenre: | sword and fantasysuspensesword and sorceryb horrorgothic horror |
Themes: | deceptionheroreligion |
Locations: | churchcastlecatholic church |
Characters: | warriorsoldierpriesttough guywitchcatholic priestself flagellationreligious ritual |
Story: | sword duelhand to hand combatsword fightshot with a bow and arrowdaggerbow and arrowwolfcursefictional wardisarming someonecombatfightingdemonshowdownsword β¦horseblood splatterknifebloodfightbattlekissingprayerambushmassacremapritualconfessionhangingbattlefieldcrucifixwitchcraftknightmonkanimal attackshieldmedieval timesbelief in godsnowingswordsmanmonasterywoman cryingplagueadventure herosword and sandaldisillusionmentmiddle agesinfantrymass gravecavalrymaceaxe fightbattle axeshacklescardinal the priestlord's prayertelling a jokestabbed with a swordbattering ramrope bridgebelief in hellexecution by hangingrotting corpse14th centurypossessed girlcrusadercrusade1300sstabbed with a spearbegging for mercybelief in witchessuspected witch (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | martial artsindependent filmblack comedymelodramadystopiaalternate historyzombie apocalypse |
Themes: | prejudicedeceptionfriendshipmurderdeathrevengekidnappingmarriagebetrayalfeardrunkennessescapedanceweddingincest β¦militarytravelbrutalityparanoiaredemptionillnessunrequited lovehopeapocalypsecannibalismwealthcouragenear death experience (See All) |
Mood: | gorerainominous ending |
Locations: | forestcemeterylondon englandvillagewoodsenglandrooftopwalled city |
Characters: | warriorfamily relationshipsfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipfemale protagonistzombiesoldierpriesthostagesister sister relationshiptough guylove triangleaction hero β¦cousin cousin relationshipaunt niece relationshipaunt nephew relationship (See All) |
Period: | 19th century |
Story: | sword duelfemale warriordark herohand to hand combatsword fightdual wieldstrong female leadstrong female charactersevered armtransformationfictional wardisarming someonedecapitationcombatrifle β¦showdownswordhorseblood splatterchaseknifeviolencebloodfightgunbased on novelflashbackdogkissdancingexplosionpartysurprise endingpistolfirevoice over narrationbeatingcorpsefistfightrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heightletterpaintingheld at gunpointhallucinationbritishkung fusubjective cameragood versus evilsurvivalambushaxemassacremansionthroat slittingbridgeimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headanti heroone man armydouble crossmarriage proposaltraininglibrarydangerstabbed in the backprologueattackcharacter's point of view camera shotrace against timetentknocked outtough girllightningscene during end creditslong takescarbodyguardexploding bodypigthreatened with a knifeclass differencesdismembermentsubtitled scenebattlefieldstylized violenceeavesdroppingtraitorcaptaincard gamemartial arts mastergrenadeburned aliverevelationspearheavy rainlooking at oneself in a mirrordiseaseroyaltyjail cellservantrebelsevered handforbidden loveviolinaction heroinecolonelcrushed to deathcannonguarddamsel in distressexplosivecorsetbraverystabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the necklove at first sightballexploding headpunched in the chestsuperstitioninfectionprideaerial shotrainstormdisfigurementknife throwingdark pasteye patchlieutenantmutationtragic herocellarmoral dilemmaroundhouse kickblood on camera lensswordsmanface maskfemale fighterhead blown offepidemicphysicianquick drawmilitiaplagueflypocket watchbritish armywoman kills a manbritainstabbed in the shoulderfight the systemheirbritish soldieropen endedtragic pastwoman fights a manarm cut offaristocracycourtshiparmy basefade to blackanti heroinegrindhouse filmbilingualismthroneoutbreakhigh societygold diggersuitorelopementrich manslow motion action scenehorse drawn carriagesurprise during end creditswoman punches a manlordaxe in the headman fights a womansecret passagewaycountry estatemanor houseshaolinladywoman hits a manstory continued during end creditscliffhanger endingrich womansisterhoodswordswomanblood on mouthabandoned churchenglish countrysidegolddiggercavalry chargehordeman murders a womanfire pokergeorgian eraexploding bridgepeace treatyjourney shown on maprogue soldierends with weddingburning bodymashupregency periodparsoncollapsing bridgehouse flyrace warreference to the four horsemen of the apocalypsetotal warwoman wearing an eye patch (See All) |
Thor is imprisoned on the other side of the universe and finds himself in a race against time to get back to Asgard to stop Ragnarok, the destruction of his homeworld and the end of Asgardian civilization, at the hands of an all-powerful new threat, the ruthless Hela.
Subgenre: | dark fantasyepicmartial artssuperheroabsurdismslapstick comedyscience fantasylive action and animation |
Themes: | deceptionmurderdeathrevengesurrealismkidnappingbetrayalfeardrunkennessescapemonsterbrutalitysupernatural powerredemptioncelebrity β¦sadismalcoholismpanicapocalypsedisabilitycouragerevolutionself sacrificespace travelprison escapenorse mythology (See All) |
Locations: | forestnew york citybarchurchelevatorvillagewoodsouter space |
Characters: | warriorfather son relationshiptattoobrother brother relationshipbrother sister relationshipzombiesoldieralienhostagetough guyaction heroalcoholicvillaincousin cousin relationshipfather β¦alien monster (See All) |
Story: | giant animalfemale warriorhand to hand combatsword fightknife fightdual wieldblockbusterbow and arrowwolfstrong female characterprinceopening action scenemanipulationdueltransformation β¦fictional wardisarming someoneweapondecapitationcombatfightingdemonshowdownswordchaseknifetitle spoken by charactercharacter name in titletwo word titleviolencefightsequelflashbackbare chested maleexplosionsurprise endingfireshootoutbeatingshot to deathfistfightmachine gunshot in the chestrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightbookbased on comicheld at gunpointbeerrivergood versus evilsurvivalfoot chasebased on comic bookambushname in titleaxemassacremountainbasketballbridgearmyimpalementstabbed to deathmixed martial artsprisonerstabbed in the chesttied to a chairsevered headone man armydouble crossspaceshipunderwater scenecreaturefemme fatalethird parttalking to the cameraon the runattempted murderone against manycharacter repeating someone else's dialoguebeaten to deathdangerscreamingelectrocutionfugitivemissiondragonrace against timestatuecover upkicked in the facetough girllightningskeletonbraceletscene during end creditsspeechexploding bodythreatbrotherstagechampionthreatened with a knifemercenarywaterfallfireworkssubtitled sceneundeadbattlefieldstylized violencehenchmanapplausedestinydestructionflyingracehead buttspearelectronic music scoresociopathhelmetbeardhammerspacecraftexploding buildingkicked in the stomachvillainessplaneteccentriccamprebeljumping from heightclubskullrebellionknightlaserhomeaction heroinesocial commentaryback from the deadbald manhaircutreverse footageshieldcameohaunted by the pastvisionbootsbraveryfight to the deathimpostorsonmercilessnesschaosresurrectiondeath threatevacuationprophecyescape attemptscene after end creditshit on the headmarvel comicspunched in the chestjumping through a windowassault riflewisecrack humorhologrambounty huntereye gougingcapturearmorcliffdark pastkingdomstadiumdictatortelekinesissmokegatling gunteleportationcrowdlaser gunsurprise after end creditspalacefemale soldiermale objectificationface maskfinal showdownreturning character killed offdirected by cast memberfemale fighterlong hairgiant monstersuit and tieblonde womanworld dominationcheering crowdstage playmasturbation referencebearded manhanging upside downcrash landingone linermale name in titlegoddessmale protagonistfemale villainfight the systemfinal battlecrotch grabpart computer animationopen endedshape shiftertragic pastwoman fights a manalien planetexploding shiphit with a hammereye shadowcoup d'etatmind readingone woman armypsychotronic filmforce fieldanti heroinealien creaturealien raceepic battlefemale antagonistlong haired maleslow motion action scenesurprise during end creditsblond manhuman aliensuper speedstudio logo segues into filmman fights a womandark heroineone eyed mangiant creaturelong black haircaged humancaught in a netfire breathing dragonmarvel entertainmentnew york city skylinespear throwinggreen bloodmarvel cinematic universesibling relationshipvirtual setfictional planetunderwater fightdirected by co starfighting in the airtalking computerwarrior womanexploding planetwoman murders a manwarrior racered capeman murders a womandemi godwashing someonealien civilizationevil beingfemale sociopathdragging someoneawkward silencelong haired manadopted brothersequel baitingbody suitnorse godchoking someonefacial hairolder sisterreference to penis sizetragic heroinefemale bounty hunteractor reprises previous roleglowing eyethrowing stonesaerial battleevil sisterflying shipopening creditshalf siblingsheir to throneinterspecies friendshipragnarokpost credits scenestan lee cameogladiatorial combatshow offlokithrowing a stoneestranged siblingstrophy roombipedal alienhammer as weaponlong haired womanreference to duran duranship's logthe other sidewar hammerdoctor strangeshared universe (See All) |
Once a mercenary of Queen Elizabeth I fighting Spaniards in Africa, Solomon met the Devil's Reaper and discovered he was bound for hell. Barely escaping, he soon renounced violence to atone for his past sins, seeking out redemption in a life of peace. That is until the followers of sorcerer Malachi β¦kidnap a Puritan girl, Meredith Crowthorn, and brutally slaughter her family before his very eyes, forcing Solomon to take up arms and return to his violent ways once more to rescue her. (Read More)
Subgenre: | sword and fantasychrist allegoryindependent filmb moviesword and sorcerygothic horror |
Themes: | deceptionmurderdeathrevengekidnappingreligionbetrayaltorturedrunkennessfuneralmonstermagicredemptionfaithabduction β¦cannibalismdevilmurder of familycooking over a campfire (See All) |
Locations: | forestchurchsnowcemeteryvillagewoodsenglandshipcastlecavecampfire |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipbrother sister relationshipzombiesoldierpriesthostagebiblewitchself mutilation β¦ex soldiership captain (See All) |
Period: | 16th centurywinter1600s |
Story: | horse chasedark herosword fightdaggerpeaceprincesevered armcursetransformationjourneydecapitationshot in the backfightingdemonshowdown β¦swordhorseblood splatterchaseknifetitle spoken by charactercharacter name in titletwo word titlebloodviolencegunflashbackbare chested maleexplosionsurprise endingfirecorpsemirrorshot in the chestshot in the headrescueslow motion scenebattlefalling from heightmaskbased on comicinterrogationbritishprayerrivergood versus evilambushaxemassacredisguisethroat slittingarmyimpalementstabbed to deathstabbed in the chestsevered headno opening creditsanti herochild in perildouble crosskingshot in the foreheadstabbed in the backprologueperson on firestatuetentknocked outdeath of childscardeath of brotherdeath of sonhorse ridingneck breakingtrapthreatened with a knifemercenaryundeadrevelationheavy rainhatslaverycaptivecrucifixtreasurewitchcraftaccidental deathjumping from heightmind controltorchmonkslaveeaten alivepresumed deadpromisereverse footagecrossbowstabbed in the throatgash in the facestabbed in the legsibling rivalrydead childjumping through a windowdungeonmurder of a childsoulhealingrainstormcliffdisfigurementdark pastaxe murderdemonic possessionsevered legblack magicburned to deathwilhelm screamteleportationcrowmudblood on camera lensillusioncrucifixiondrifterbag over headrobbermonasterygiant monsterevil spiritportalfortresssorcerershot in the eyetavernmercy killingpatricideepiloguedeath of familyinnmasked villainfather son reunionsorceryanimated creditsgrim reaperdreadlocksimmolationlocketpitdeal with the devilfratricidescottish accentlong haired maleknife in the chestflintlock pistolhorse drawn carriagejumping out a windowscrolllordspaniardorigin of heropaganfrozen lakehealerfuneral pyrebrother versus brotherpacifistnorth africahuman skullkidnapped girloutnumberedbritish flagcloakrainy dayabbeystabbed through the chesttravellerclosing credits sequencehanged bodypuritanpushed from heightaxe in the chestcovered wagonhead chopped offunion jacklast wordstrap doorflaming swordburning villageleather maskelizabethan erabrother against brotherscars on backstabbed through backbased on pulp magazinehuman in a cagewitch burningevil versus evildisownedhole in hand1550scloak and daggerpile of goldprison wagonburned villageyear 1600 (See All) |
In 1431, the Kingdom of Ayutthayan conquers the territory of Sukhothai expanding their lands to the East. The noble Lord Siha Decho is betrayed by his Captain, Rajasena, and is murdered together with his wife. However their son Tien is saved by one loyal soldier and left alone in the woods...
Subgenre: | cult filmmartial arts |
Themes: | mythologyherodeathrevengebetrayalyouthvengeance |
Locations: | villagejungle |
Characters: | warriorboytough guyaction herofather |
Period: | 15th century |
Story: | sword duelkatana swordhand to hand combatsword fightterritoryshot with a bow and arrowbow and arrowspiritdisarming someonecombatfightingshowdownblood splatterchaseviolence β¦fightbloodnumber in titlesequelflashbackbare chested malebeatingdigit in titlefistfightslow motion scenebattlebrawlsecond partnumbered sequelkung fuorphanambushmixed martial artsone man armyone against manymissionmartial artistbare chested male bondagestylized violencemartial arts masterelephantcaptivechop sockyslavebuddhistfight to the deathmeditationmedieval timesoutlawbuddhismstick fightbanditkung fu fightingkatanafighterkung fu classiccrocodiletestoutlaw gangyoung manmiddle agesbo staffmuay thaibuddhayoung boybeefcake martial artssequel by name only1400s (See All) |
Disney's animated classic takes on a new form, with a widened mythology and an all-star cast. A young prince, imprisoned in the form of a beast, can be freed only by true love. What may be his only opportunity arrives when he meets Belle, the only human girl to ever visit the castle since it was enc β¦hanted. (Read More)
Subgenre: | dark fantasydisneytragedycoming of agefairy taleslapstick comedyfish out of waterbased on fairy tale |
Themes: | mythologydeceptionloverevengesurrealismkidnappingjealousyfearescapedancemonstermagicobsessionsupernatural powerdeath of mother β¦blackmailredemptionpoetryunrequited lovehome invasionhopedeath of wifepanic (See All) |
Mood: | poetic justice |
Locations: | forestbarsnowparis francebathtubvillagewoodsfrancelakecastlerooftop |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipsingerfemale protagonistbabyhostageartistlove trianglelittle boymaidwitchgrandmother grandson relationship β¦single fatherex soldier (See All) |
Story: | sword fightfamous scoremusketfolklorestrong female leadcompassionblockbusterhunterheroinewolfprincemanipulationcursetransformationshot in the back β¦rifleshowdownswordhorsechasetitle spoken by charactercharacter name in titlefightflashbackdogbare chested malekissdancingphotographexplosionsingingpartysurprise endingpistolfirevoice over narrationbeatingcorpsemirrorshot in the chestremakerescueslow motion scenepunched in the facebattlekissingbrawlfalling from heightpaintingheld at gunpointbedpianobedroomcandlemountaindisguisewomanmontagebridgefour word titlemapfalse accusationno opening creditsbirddrawingcontroversykingcreaturebartenderflash forwardattempted murderlibrarydangerprologuewidowerrace against timeknocked outlightningwigtied upgardencabinloss of motherlove interestreference to william shakespearequeensingle parentchesswerewolficeropefalling down stairsfireplacedressheavy raintalking animalloss of wifeeccentriccomposerservantjumping from heightculture clashcgitorchanimal attackclockfull moonanthropomorphismfight to the deathinventorfalling to deathescape attemptballensemble castbutlerrosebookstoreaerial shotmusical numberrainstormdisfigurementmustachekingdomasylumowlaristocratteleportationimprisonmentclose up of eyesspellhappy endingsidekickfinal showdownhuman monsterspiral staircasemarkettowerlibrariancomic reliefplagueyoung version of charactertrue lovebeastbased on cartoonnarcissismtavernsoupilliteracyaltered version of studio logoopera singervanitystar crossed loverswindmillclawopposites attractfrenchmansorceressreclusecockney accenthermitmagic spellfirecrackerballroomsuitorglobeflintlock rifleangry mobflintlock pistolhorse drawn carriagehorndinner tablefantasiesstudio logo segues into filmstrong femalefrozen lakecountry estatecandelabraleft for deadnarcissistred rosegay subtextreference to walt disneywardrobeanimal loverfamous songdeus ex machinasuperficialityremake of cult filmwoman in perilchauvinismlock pickerased memoryharpsichordteapotcrossdressingman with a ponytailchauvinistbeauty and the beastwhimsicallove for animalspottercandlestickinanimate object comes to lifelive action remakefeather dusterunconventional romanceteacupwolvesmoulin rougebibliophiliahorse cartcogenchantressmagic mirrorpetalglass jarmantle clockbeast's heartreference to romeo and juliet (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk β¦s at a terrible cost. (Read More)
Subgenre: | christ allegorytragedy |
Themes: | mythologydeceptionlovemurderdeathrevengesurrealismsuicidekidnappingbetrayalfearbrutalitysupernatural powerdeath of motherhope β¦death of wifeself sacrificenear death experience (See All) |
Locations: | forestchurchlondon englandwoodscastlecave |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipsoldierhostagetough guyvampireaction heroself mutilationex soldierself healingblood lust |
Period: | 15th century |
Story: | dark herohand to hand combatsword fightsuper strengthbow and arrowwolfprincesevered armcursetransformationcombatdemonshowdownswordhorse β¦blood splatterchaseknifecharacter name in titleviolencebloodflashbackbare chested maleexplosionsurprise endingfirevoice over narrationbeatingcorpserescueslow motion scenepunched in the facebattlefalling from heightrunningriversubjective cameragood versus evilcandleambushaxemassacremountainthroat slittingarmyimpalementstabbed to deathstabbed in the chestmapno opening creditsanti heroone man armychild in perilon the runflash forwardattempted murderone against manylegendstabbed in the backscreamingperson on firecharacter's point of view camera shottentevil manlightningskeletonshot in the shoulderscarcrossthreatened with a knifedirectorial debutgeneralbare chested male bondagerefugeesubtitled scenebattlefieldfreeze framestylized violencemaniacdestinyburned alivehead buttspeargothicheavy rainhelmetcrucifixloss of wifespiderskulltorchmonkburialanimal attackback from the deadcannonshieldhaunted by the pastreincarnationinvasionstabbed in the throatanimated sequencehatredresurrectionevacuationfalling to deathimmortalitythunderstormstabbed in the legmedieval timesrainstormdeerarmorknife throwingsiegekingdomtragic heroblack magicburned to deathpigeonprequelbatyellingdraculamonasteryromaniatowerstreet marketworld dominationcrownhearing voicesfall from heightbitten in the neckeastercaperighteous rageturkishimmortalshapeshiftingwarlordvampirismmountain climbingarmy baseglowing eyesarmorydeal with the devilthronex rayed skeletonregenerationhorse drawn carriagescrolltarantulasuit of armordecomposing bodysuper speedstabbed in the foottransylvaniadrinking bloodchild soldierflaming arrowmessengercoming out of retirementfall to deathfangssunlightoutnumberedsilversultanturkbegins with narrationfangcrucifix pendanttunicwooden stakebuilding firex ray visionheat visionfaustianwater wheelsilver coinsupervillian originswarm of batsarmy on the march (See All) |
The murderous Bride is back and she is still continuing her vengeance quest against her ex-boss, Bill, and taking aim at Bill's younger brother Budd and Elle Driver, the only survivors from the squad of assassins who betrayed her four years earlier. It's all leading up to the ultimate confrontation β¦with Bill, the Bride's former master and the man who ordered her execution! (Read More)
Subgenre: | cult filmmartial artsblack comedy |
Themes: | samurailovemurderdeathrevengemoneybetrayalpregnancybrutalityredemptionguiltexecutiondyingblindnessvengeance β¦justicephilosophyforgivenessregret (See All) |
Mood: | goreneo noirbreaking the fourth wallpoetic justice |
Locations: | barrestaurantcemeterydesertstrip clubmexicocampfirebrothel |
Characters: | samurai swordwarriorfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipprostitutefemale protagonistteacherpriesthitmanteacher student relationshipemployer employee relationship β¦pimpuncle niece relationshipsuper herogirl fightwedding singer (See All) |
Period: | 2000s |
Story: | sword duelfemale warriorkatana swordhand to hand combatsword fightmoral ambiguitykindnesskendoheroinehatedisarming someonecombatrifleshowdownsword β¦blood splattertitle spoken by charactercharacter name in titlef ratedgunbloodfightviolencesequelflashbackcigarette smokingsurprise endingpistolfirevoice over narrationcryingcell phonecorpsefistfightshot in the chestblondeshotgunwatching tvbrawlshootingtearssecond partdead bodycafebathroomclassroomstripperkung fuflashlightassassinmassacrewomancocaineinternetsnakenonlinear timelineno opening creditsanti herocoffinassassinationfemme fatalegraveyardracial slurpaintrainingflash forwardgravepoisontough girlinjectionmartial artistsplit screenvigilantesyringemartial arts masterloyaltyhead buttbridehonormonkaction heroinepresumed deadretirementpromisesufferinghit in the crotchmentoreye gougingwedding dresseye patchtragic herosurprise after end creditsfemale assassinkatanacartoon on tvreturning character killed offburied aliveparalysisimperative in titlestuffed animalhomageflutepregnancy testtrailer homegoldfishpoisoningrhyme in titlefemale heroeyeballrespecttreacherytragic lovebouncerrighteous ragebloodsheddeath of title characterdigging a graveone woman armyreference to supermanretributionshot through a doorsnake bitereference to batmanneo westernmentor protege relationshiptragic villainmacericehitwomancobrapretending to be deadchopsticksdark heroineshaolinorganistheadstonedeath of petshot in the kneebuddhist templerenegadewinkwuxia fictioncode namevenomtoilet bowlcantonesefemale murdererreference to spidermanglass of waterwarrior womanmaster apprentice relationshipspit in facepoison dartstraight edge razortruth serumhelplessnesspregnant brideeye ripped outholding head underwaterhead in toiletblindedsnake charmermother child reunionperth australiael paso texasduologymagpieshaolin templetragic heroinecostumerintentional goofwedding rehearsalroll callwedding chapelsheathshot back to backhitlistswordsmanshipbarstow californiadeath by snakebitewoman wearing an eyepatchgasping for airblack mambahattori hanzoreference to annie oakley (See All) |
Subgenre: | sword and fantasydark fantasymartial artsblack comedysuspensesupernaturalfairy talesword and sorcerybased on fairy tale |
Themes: | deceptionherolovemurderdeathrevengesurrealismkidnappingmarriagebetrayalfearescapemonstermagicanger β¦obsessionsupernatural powerredemptionguiltinsanitygriefevilunrequited loveexecutionhopegreedpaniccouragenear death experienceregretmurder of family (See All) |
Locations: | forestchurchsnowvillagewoodscastlecampfire |
Characters: | warriorsoldierbabyhostagesister sister relationshipthieftough guyaction herolittle girllittle boy |
Story: | female warriorhand to hand combatsword fightknife fightelkdual wieldbow and arrowwolfmanipulationtransformationfictional wardisarming someonecombatshowdownsword β¦horsechaseknifecharacter name in titlebloodviolencefightsequelflashbackbare chested malekissexplosionsurprise endingvoice over narrationbeatingcorpsefistfightmirrorshot in the chestface slapshot in the headrescueslow motion scenepunched in the facebattlebrawlsecond parthallucinationriversubjective cameragood versus evilorphancandleambushaxemassacremountainmontagebridgearmyimpalementmixed martial artsstabbed in the chestsnakefalse accusationno opening creditsanti herobirdone man armychild in perildouble crosskingcreaturefemme fatalenecklaceon the runtrainingflash forwardskinny dippingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backprologuescreamingattackfantasy sequencefugitivemissionkicked in the facedeath of childtough girlscene during end creditsthreatened with a knifedirectorial debutwaterfallflowerprofanitylove interestqueenmonkeybattlefieldpowerstylized violencechessiceeavesdroppingtraitorgoldfireplaceburned aliverevelationhead buttspearassassination attemptheavy rainlooking at oneself in a mirrorquestcatfighthelmetspin offkicked in the stomachvillainessjumping from heightfrogirishfaked deathmind controlforbidden lovetorchaction heroineanimal attackback from the deadbar fightpresumed deadguarddwarfreverse footageshielddiamondvisiontarget practicebraverycrossbowfight to the deathfairymercilessnessresurrectiondark humorsuper villainimmortalityrowboattime lapse photographypunched in the chestengagementbooby trapaerial shotdeerpassionate kisskingdomblack magicburned to deathowltelekinesisstick fightprequelpalacetelepathyimprisonmentheroismhappy endingfemale soldierfinal showdownworld dominationcomic reliefshot with an arrowmegalomaniacyoung version of characterarcherycrownfortresshearing voicesnarcissismtavernreluctant herotentacleman kills a womanmacguffinwoman kills a manaltered version of studio logogoblinstabbed in the shoulderbleeding to deathevil womanarchertragic lovedeath of familywoman fights a manwarlordsorceresscoup d'etatwoman slaps a manmind readingone woman armybo staffimprovised weaponchainsanimal killingrock climbinghalf brotheranti heroineglowing eyeschild abductionsecret lovethronepower strugglescottish accenthorse drawn carriagenetbanishmentsuit of armoraxe fightsurprise during end creditsorigin of herochild soldierflaming arrowstudio logo segues into filmdukeman fights a womantrackercoronationnarcissistmohawk haircutcaught in a netfemale thieftailrope bridgethrown from heightcloakevil laughterreference to snow whitefreeze to deathevil queenbackflipsentenced to deathmagical mirrormeltingsororicidemagical creatureaxe throwingbrothers grimmtunicprequel and sequelblack bloodsnow queen (See All) |
The next installment in the blockbuster franchise, UNDERWORLD: BLOOD WARS follows Vampire death dealer, Selene (Kate Beckinsale) as she fends off brutal attacks from both the Lycan clan and the Vampire faction that betrayed her. With her only allies, David (Theo James) and his father Thomas (Charles β¦ Dance), she must stop the eternal war between Lycans and Vampires, even if it means she has to make the ultimate sacrifice. (Read More)
Subgenre: | dark fantasymartial artsconspiracysupernatural |
Themes: | deceptionlovemurderdeathbetrayalfeartortureescapeseductionangerdeath of fatherbrutalitysupernatural powerparanoiaredemption β¦surveillanceunrequited lovepanicself sacrificenear death experience (See All) |
Mood: | goredarknesspoetic justice |
Locations: | trainsnowmotorcyclewatercastlelaboratorytunneltrain stationcar motorcycle chasemotorcycle chase |
Characters: | warriorfather son relationshipfemale protagonistsoldierhostagetough guyvampireaction herosecurity guardsniperself healing |
Story: | female warriorhand to hand combatsword fightsuper strengthdual wieldstrong female leadblockbustersevered armopening action scenemanipulationtransformationfictional wardisarming someonedecapitationshot in the back β¦combatfightingshowdownswordhorseblood splatterchaseknifef ratedviolencefightbloodsequelflashbackbare chested maleexplosionpartysurprise endingpistolvoice over narrationshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightheld at gunpointbombinterrogationspysurvivalflashlightassassinambushstrangulationmassacremountainthroat slittingbridgearmyimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestsubwayfalse accusationsevered headno opening creditsdouble crossfemme fataleshot in the legshot in the foreheadon the runtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backfugitivepoisonevil manknocked outkicked in the facetough girllightningringshot in the shoulderbodyguardinjectionneck breakingloss of fatherthreatened with a knifedirectorial debutshot in the armhandgunbattlefieldpowerstylized violencehenchmanak 47werewolficetraitoruzifalling down stairsbulletburned aliverevelationspearassassination attempthypodermic needlegothicheavy rainsecurity camerakicked in the stomachvillainesspooljumping from heightcovered in bloodaction heroinemexican standofffemale killergun fuback from the deadambitionguardreverse footageshieldhaunted by the paststealing a cartarget practiceexplosivecrossbowfight to the deathconfrontationstabbed in the throatmercilessnessstabbed in the neckresurrectionshot in the facestabbed in the headframe upstabbed in the legpunched in the chestjumping through a windowassault rifleaerial shothologramrainstormknife throwingraidsnowingstabbed in the eyedark pastfemale directorfifth partburned to deathframed for murderbullet timetorso cut in halftracking devicefemale assassindesert eaglefemale soldierbreak infinal showdownreturning character killed offstabbed in the handfemale fighterpistol whipsubway stationstabbed in the armfemale spyfemale vampirebroken mirrorfortresshanging upside downunderworldreluctant heroblizzardman kills a womanmacguffinwoman kills a manstabbed in the shoulderbullet woundfinal battleheirburnt bodyevil womanshot in the throatshot in the footopen endedfur coatrighteous ragestabbed in the facecorrupt officialtragic pastwoman fights a mandistrustshooting rangemind readingone woman armyanti heroineglowing eyesknocked out with a gun buttarmoryhummersurveillance footageregenerationfemale antagonistslow motion action scenesecret doorwoman punches a mansuper speeddrinking bloodman fights a womandark heroinecage fightingsecret passagewayharpoonman punches a womansunlightcouncilwoman hits a manalbinohybridsilverhenchwomancrisis of consciencespear throwingsecret laboratorycovenfeature film directorial debutcage fightrailyardmachine pistolbloodlettingcomplotlatex catsuiturban gothicburning bodytragic heroinewoman breaks man's neck50. caliber machine gunstrapped to a tablerecap segmentstabbed through the backclemencytwin handguns (See All) |
Set, the merciless god of darkness, has taken over the throne of Egypt and plunged the once peaceful and prosperous empire into chaos and conflict. Few dare to rebel against him. A young thief, whose love was taken captive by the god, seeks to dethrone and defeat Set with the aid of the powerful god β¦ Horus. (Read More)
Subgenre: | sword and fantasychrist allegoryepictragedymartial artsblack comedyaustralian fantasyaustralian science fictionaustralian horrorscience fantasy |
Themes: | mythologydeceptionlovemurderdeathrevengesurrealismkidnappingbetrayalfearescapemonsterseductiondeath of fatherbrutality β¦supernatural powerredemptionfaithhopeapocalypseblindnesscourageself sacrificenear death experienceafterlifeunlikely heroegyptian mythology (See All) |
Mood: | darknesspoetic justiceaustralian supernatural |
Locations: | desertelevatorshipouter spacecavejungleaustralian space travel |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipbrother brother relationshipsoldierhostagethieftough guyaction heroex husband ex wife relationshipdeath of girlfriend |
Story: | dark herohand to hand combatsword fightknife fightsuper strengthdaggerbow and arrowsevered armopening action scenetransformationfictional wardecapitationcombatdemonshowdown β¦swordhorsechaseknifebloodviolencefightflashbackbare chested malekissexplosionsurprise endingfirevoice over narrationbeatingcorpsefistfightshot in the chestrescueslow motion scenepunched in the facebattlebrawlfalling from heightbedorgygood versus evilsurvivalbedroomassassinambushold manaxemassacremountainbridgearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsnakesevered headno opening creditsanti heroone man armydouble crossunderwater scenekingcreaturenecklaceone against manylibrarycharacter repeating someone else's dialoguedangerstabbed in the backprologueattackmissiondragonrace against timestatueevil manlightningskeletonbraceletdeath of husbandtraploss of fatherthreatened with a knifewaterfalllove interestclass differencesqueenbattlefieldstylized violencehenchmancivil wareavesdroppinggolddestinysabotagedestructionburned aliveflyingspearassassination attemptbreaking and enteringquesthelmetslaveryelephantloss of loved onetempletreasureexploding buildingkicked in the stomacharchitectgiantservantmind controlwomanizertorchend of the worldfateanimal attackfemale killercrushed to deathback from the deadslaveguardreverse footageshieldhaunted by the pastburglarvisiontelescopebraveryburglarystabbed in the throatmercilessnessegyptchaosstabbed in the neckresurrectionimmortalityswampexilestabbed in the legsibling rivalrypunched in the chestsunbooby trapheartaerial shotwisecrack humoryoung loveeye gougingdark pasteye patchkingdomloss of husbandtragic herosevered legburned to deathdictatorloss of brotherstick fightbrainteleportationgeniuspalacetelepathytorso cut in halffemale assassintombnarrated by characterprayingdirector cameoface maskfinal showdowneyegiant monstersex slaveparkourportaltwo man armyworld dominationshot with an arrowmegalomaniaccrowncheering crowdcrash landingscorpionpyramidreluctant heropatricideman kills a womanseductresshumorsword and sandalfinal battlecapeheirsole black character dies clichedecadencerighteous ragetragic pastvaultwarlordarm cut offriddlecoup d'etatphilosopherancient egyptanimal killingrock climbinghusband murders wifeimmolationglowing eyesthronefratricidewingsstarts with narrationbeetleslow motion action scenehorse drawn carriagescrollgold coindouble entendrefall to deathone eyed manegyptianloss of girlfriendcollapsing buildingtrackercoronationsandstormgiant creaturefire breathing dragongiant snakehenchwomanoutrunning explosionout of body experiencesphinxchariotstabbed through the chestfighting in the airmegalomaniaaustralian creaturestunicblindedfloating in spaceslave girlflaming swordfalling into a poolsedan chairduplicateobeliskwoman changing clothesegyptian godhieroglypheyes gouged outaustralian monstersheir to throneofferingback hand slapland of the deadwalking across desertpile of goldegyptian goddessriver nile (See All) |
In this case, a group of archaeologists and combat experts led by Paul Walker and Frances O'Connor use a "3-D fax machine" (so much for technobabble!) to time-travel back to France in 1357, in hopes of retrieving Walker's father and returning safely to the present. No such luck! Fending for themselv β¦es against marauding hordes of medieval French warriors at war with the invading British, these semi-intrepid travelers find their body count rising, and the deadline for their return home is rapidly approaching. (Read More)
Subgenre: | sword and fantasycult filmfish out of waterswashbuckler |
Themes: | deceptionherofriendshiplovemurderdeathrevengesurrealismdrinkingescapetime travel |
Locations: | hospitalmotorcycleairplanevillagefrancecastlerooftoptunnelcave in |
Characters: | warriorfather son relationshippolicefrienddoctorteacherstudentpolicemantough guyteacher student relationshipprofessor |
Story: | sword duelhand to hand combatsword fightshot with a bow and arrowbow and arrowopening action sceneduelfictional wardisarming someonecombatshowdownswordhorsefightviolence β¦bloodbased on novelone word titlekissexplosiontelephone callfirecell phonerescuecomputerdrinkbattlefalling from heightbeerambushaxestabbingstabbed to deathstabbed in the cheststabbed in the backlocker roomstatuehorse ridingsubtitled scenearsonbattlefieldeyeglassesgrenadespearbeer drinkinghelmetmad scientistknighttorchcannonshieldmobile phonemedieval timescapturesiegekingdomarrowruinsmonasterytime machineshot with an arrowmarinearcheryarcheologyartifactreluctant herotour guidehistorianairfieldman on fireinfantrycavalryburning buildingscientific researchscottish accentmacearchaeologistwormholeflaming arrowsteel helmetbody armorcatapultswordplayaltering historyarcheological digprototypesecret experimentcarvingmagelucky charmelectro shock1300ssecret lablost fatherhundred years warancient swordtrebuchetexperiment on oneselffemale archaeologistmedieval francesilver city new mexico (See All) |
In 1844, the peace of Feudal Japan is threatened by cruel Lord Naritsugu Matsudaira, who is politically rising and getting closer to his half-brother, the shogun. After the harakiri of the Namiya clan leader, samurai Shinzaemon Shimada is summoned by the shogun's advisor Sir Doi of the Akashi Clan t β¦o listen to the tragedy of Makino Uneme, whose son and daughter-in-law have been murdered by Naritsugu. Then Sir Doi shows a woman with arms, legs and tongue severed by Naritsugu and she writes with her forearm a request to Shinza to slaughter Naritsugu and his samurai. Shinza promises to kill Naritsugu and he gathers eleven other samurais and plots a plan to attack Naritsugu in his trip back to the Akashi land. But the cunning samurai Hanbei Kitou that is responsible for the security of his master foresees Shinza's intent. Shinza decides to go with his samurai through the mountain, where they find the hunter Koyata that guides them off the mountain and joins the group. Now the thirteen men prepare an ambush to Naritsugu and his army of two hundred samurai in a suicide mission to stop evil. (Read More)
Subgenre: | tragedymartial arts |
Themes: | samuraideathsuicidegambling |
Mood: | gore |
Locations: | japanvillagerooftopbrothel |
Characters: | samurai swordwarriorjapanesesamurai warrior |
Period: | future19th century1840s |
Story: | sword duelkatana swordhand to hand combatsword fightshot with a bow and arrowkendopeacehunterbow and arrowdueldecapitationcombatshowdownblood splatterblood β¦violencenumber in titleexplosionremakebattlekung fuassassinmassacrestabbingstabbed to deathstabbed in the chestsevered headassassinationfishingstabbed in the backmissionrabbittrapwaterfallbattlefieldloyaltyspearstabbed in the stomachhonorchop sockyexplosiveimmortalityfilm setbooby trapmurder of a childstick fightmudbeheadingswordsmankatanaset upshot with an arrowamputeefilm starts with texttyrantkimonoslingshotimmortalguideimmolationassassination plotends with textdojoalternate versionjumping from a rooftoppolitical assassinationlordbuilding collapseemaciationjidai gekiflesh eatingbordellosuicide missionrecruitingbloody sprayhara kirironinshogunseppukuwading in watermultiple versionscode of honornumber 13 in titlecat housesheathbonsai treefalling into mudnon humansamurai eraforeign versionmultiple amputeerunning on roofyear 1844 (See All) |
In AD 922, Arab courtier Ahmad Ibn Fadlan accompanies a party of Vikings to the barbaric North. Ibn Fadlan is appalled by the Vikings customs-- their wanton sexuality, their disregard for cleanliness, their cold-blooded human sacrifices. And then he learns the horrifying truth: he has been enlisted β¦to combat a terror that slaughters the Vikings and devours their flesh. (Read More)
Subgenre: | epiccult filmsword and sorceryfish out of waterswashbucklerrevisioniststonepunk |
Themes: | deceptionlovemurderdeathreligiondrinkingfearfuneraltravelsupernatural powercannibalismmurder of brothernorse mythology |
Mood: | gorerain |
Locations: | forestboatwoodscavecampfire |
Characters: | warriorfamily relationshipsfather son relationshipmother son relationshiptattooboyreference to godfacial tattoo |
Story: | hand to hand combatsword fightshot with a bow and arrowdaggermutilationbow and arrowprincesevered armfictional warcombatdemonswordhorsefightviolence β¦bloodbased on novelnumber in titledogthree word titlefirevoice over narrationcorpsedrinkbattlevomitingdead bodyswimminggood versus evilaxesnakesevered headunderwater scenekingcreaturelegendpoisonmissiontenthangingdeath of brotherhorse ridingwaterfallpoetbearsleepingcowdismembermentbattlefieldspearhelmetsevered handskulltorchshieldinvasioncannibalexilearabeye patchkingdomfortune tellerfast motion scenecameltranslatorprayinggreekcremationalarmvikingdigginglanguage barrierambassadorrespectsword and sandalheirperfumebarbarianfacial scarmiddle agesprophetdiplomatfleeingretreatbanishmentnoblemanflaming arrowhoneybonesadaptation directed by original authorreference to allahsword and shieldangel of deathgonghordemarauderancient times10th centurybeowulfends with funeralirish wolfhoundvisceralcannibal cultflying debrisviking shipodinviking funeralblowing one's nosemohammadvalhallapaupercaliphwashing one's handsarabian horseseastorm (See All) |
An American teenager who is obsessed with Hong Kong cinema and kung-fu classics makes an extraordinary discovery in a Chinatown pawnshop: the legendary stick weapon of the Chinese sage and warrior, the Monkey King. With the lost relic in hand, the teenager unexpectedly finds himself traveling back t β¦o ancient China to join a crew of warriors from martial arts lore on a dangerous quest to free the imprisoned Monkey King. (Read More)
Subgenre: | martial artscoming of agewuxia |
Themes: | heromurderrevengedrunkennessrobberytime travelvengeancephilosophy |
Locations: | forestdesertvillagerooftopcavechinacampfire |
Characters: | warriorteenagertough guyaction herobullyvillainwitchamerican |
Story: | hand to hand combatsword fightshot with a bow and arrowbow and arrowdueldisarming someoneweaponshot in the backcombatfightingshowdownswordhorsechasetitle spoken by character β¦violencebloodfightbased on novelflashbackbeatingdreamfistfightshot in the chesturinationbattlebrawlfalling from heightshootingkung fuorphanflashlightwinestrangulationmountainambulancestabbingmixed martial artsbirdlegendkaratestatuemartial artistwaterfallwhippingstylized violencemartial arts masterspearquesttemplevillainessmonkchop sockykickboxinginterracial romancewhipboston massachusettsprophecyimmortalitymentorbounty hunterkarate chopswordsmankatanaalleyhairparkourshot with an arrowarcherywelldrumparamedicartifactpotionresponsibilitypawnshopinnmiddle ageswarlordbo staffcavalrystaffrelicwu shusecret loveslow motion action sceneshaolinsandstormteenager fighting adultturned to stoneoutnumberedprotectorwuxia fictionfighting in the airelixirsparrowunspoken lovemagical weaponburning villagemonkey kingrice paddysagecrescent mooncherry treereferring to oneself in the third person (See All) |
A number of fighters are invited to DOA, an invitational martial arts contest. They travel to the tournament island by plane, until they have to jump out mid-flight with parachutes, and then have until sundown to reach the main island to be entered into the tournament. Fighters are then pooled again β¦st one another in a knock-out style tournament, with the loser of a battle sent home, and the winner progressing to the subsequent round. The plot revolves around four female fighters who begin as rivals, but subsequently find themselves teaming up against another force. (Read More)
Subgenre: | martial artsteen comedy |
Themes: | friendshipwrestlinginheritance |
Mood: | rain |
Locations: | beachhotelboatwater |
Characters: | samurai swordwarriorfemale protagonist |
Story: | sword duelfemale warriorkatana swordhand to hand combatsword fightgirl powerkendoheroineduelprincessdisarming someoneswordviolencefightfemale nudity β¦leg spreadingpistolfistfightcomputerbikinibrawlheld at gunpointislandcompetitionkung fuassassinacronym in titlelatex gloveskarateninjatough girlmartial artistglassesrunawaynerdpiratemartial arts masterexploding buildingtournamentaction heroinechop sockykickboxingburglarybased on video gamesafeparachutewilhelm screamwrestlerkung fu fightingneedlekung fu classickung fu masterfemale fighterlegsraftspreadeagleclimbingninjitsuvolleyballfemale martial artistkickboxerbuddhajumpparadisehidden roomacupunctureantonyms in titlebeach volleyballswordswomanpro wrestlingpurple hairdishonorpanty shot (See All) |
The second "Highlander" movie, again with Christopher Lambert and Sean Connery. It's the year 2024 and all the ozone above Earth has gone. To protect people from dying, MacLeod helped in the construction of a giant "shield", several years ago. But, since there isn't left anyone Immortal after MacLeo β¦d's victory in the previous film, he has stopped being an Immortal himself. Now he is just an old man, until one day some other Immortals arrive on our planet. You see, the Immortals come from another planet... (Read More)
Subgenre: | sword and fantasycult filmmartial artsindependent filmblack comedyconspiracydark comedyb moviesword and sorcerydystopiafish out of watercyberpunkswashbucklercorporate conspiracy |
Themes: | deceptionheromurderdeathrevengedrunkennesspsychopathsupernatural powerterrorismsurveillanceself sacrificefuture war |
Mood: | gorerain |
Locations: | new york citybartrainchurchairplanedeserttaxielevatorapartmentpolice carouter spacecavetaxi drivertrain accident |
Characters: | samurai swordwarriordoctoralienactortough guyaction herosecurity guardengineerself healing |
Period: | 1990sfuturenear future2020s |
Story: | sword duelfemale warriorkatana sworddark herosword fightkendofictional wardisarming someonedecapitationcombatshowdownswordblood splatterchaseblood β¦violencenumber in titlesequelflashbackkisscigarette smokingphotographexplosionsurprise endingpistolfirepunctuation in titleshootoutcorpseshot to deathfistfightmachine gunshot in the chestblondepunched in the facebattlegunfightfalling from heightsecond partrevolverscientistgood versus eviloperaassassinambushterroristdeath of friendmontagemixed martial artssubwaysnakeexploding carsevered headanti heroone man armypolice officer killednews reportbartendertrainingflash forwardtheaterlimousineone against manyprologueelectrocutionfugitivestatuecover upevil mantough girlbodyguardexploding bodyneck breakingmercenarygenerallove interestbattlefieldfreeze framehenchmanflyinghead buttassassination attemptsociopathfaintingsecurity cameraroman numeral in titleexploding buildingplanetfaked deathsocial commentaryback from the deadold ageresistanceresurrectionfalling to deathimmortalitymentorbooby trapsequel to cult favoriteteleportationlaser gunsatellitebeheadingextraterrestrialyellingswordsmanterrorist groupkatanareturning character killed offfemale fighterspiral staircasejournalcomputer crackerworld dominationurban decayfencingexploding truckhead cut offfight the systemexperiment gone wrongcrotch grabreference to shakespeare's hamletimmortalwarlordtailorfreedom fighterresistance fightersocial decayevil corporationalien raceregenerationmentor protege relationshipglobescotmegacorporationbanishmentcorporate crimehuman aliencorrupt businessmanopera houseamazing grace hymntroubled productiondehydrationfighting in the airancient astronautnight vision binocularsdiving suitastral projectionboardroomlong swordbeheadedhoverboardinsurrectionsolar flareelevator crashozone layerhighlandershot with a laser gunamazing grace the hymn (See All) |
After the Dragon leaves the Lonely Mountain, the people of Lake-town see a threat coming. Orcs, dwarves, elves and people prepare for war. Bilbo sees Thorin going mad and tries to help. Meanwhile, Gandalf is rescued from the Necromancer's prison and his rescuers realize who the Necromancer is.
Subgenre: | sword and fantasyepicmartial artssword and sorceryhigh fantasy |
Themes: | deceptionlovemurderdeathrevengebetrayalghostescapeobsessioninsanitygreedself sacrifice |
Mood: | poetic justice |
Locations: | forestsnowboatdesertcastlecavewalled city |
Characters: | warriorfather son relationshipfather daughter relationshipbrother brother relationshipbrother sister relationshipsoldiertough guyaction heromayor |
Story: | female warriorhand to hand combatsword fightelkdual wieldblockbusterbow and arrowsevered armopening action scenefictional wardecapitationshot in the backcombatdemonshowdown β¦swordhorseknifeviolencefightbased on novelsequelflashbackdogexplosionsurprise endingfirecorpseshot to deathshot in the chestshot in the headrescueslow motion scenepunched in the facebattlefalling from heightdead bodyhallucinationgood versus evilsurvivalambushaxemountaindeath of friendthroat slittingbridgearmystabbed to deathstabbed in the chestmapsevered headno opening creditschild in perilkingcreaturethird partnecklacedrowningstabbed in the backperson on firefantasy sequencedragonstatuetentknocked outrabbittough girlringdeath of brotherpigmercenarybearrefugeesubtitled scenebattlefieldstylized violencecivil wariceropegolddestinydestructionhead buttspearcagehelmetloss of friendloss of loved onetreasurehammercrying womangiantjumping from heightpart of trilogyfaked deathknightforbidden lovehonorburialaction heroineanimal attackgoatcrushed to deathpresumed deadbarefootdwarfshieldstabbed in the throat3 dimensionalchaosevacuationfalling to deathwizardstabbed in the headstabbed in the legsexy womandeath of loved oneloss of brothermoral dilemmaprequelpipe smokingauctionbatelfinvisibilityanti warreturning character killed offruinsapparitionwoman cryingfemale fightertoweramputeearcherycrownstabbed in the armeaglewoman kills a manfriends who live togethergoblinstabbed in the shoulderfinal battlecowardarcherraveneight word titleshape shifterstabbed in the facecorrupt officialexploding housewoman fights a manshapeshiftinghit with a hammersorceressinfantryjewelcockney accentanimal killingarmorytear on cheekcity hallepic battlescottish accentadaptationbanishmentgold coinjail breaksuit of armorfranchisestabbed in the footcousinarsenalliterary adaptationsecret passagewayhidden doorgiant creaturecatapultanti villainman dressed as a womanmultiple cameosoutnumberedfalling through icebridge collapsebell towerballadeerorchobbitmiddle earthacorngiant wormtunicgemstonescepterprequel and sequelgiant birdhogsinger offscreenminstrelrock throwinglive action remakebare foot womansmoking a pipecollapsing bridgefemale archergiant batpeace negotiationgold ringstone bridgewhite magicblack bloodpile of goldarmy on the march (See All) |
John Carter, a Civil War veteran, who in 1868 was trying to live a normal life, is "asked" by the Army to join, but he refuses so he is locked up. He escapes, and is pursued. Eventually they run into some Indians, and there's a gunfight. Carter seeks refuge in a cave. While there, he encounters some β¦one who is holding some kind of medallion. When Carter touches it, he finds himself in a place where he can leap incredible heights, among other things. He later encounters beings he has never seen before. He meets a woman who helps him to discover that he is on Mars, and he learns there's some kind of unrest going on. (Read More)
Subgenre: | sword and fantasychrist allegorymartial artssword and sorcerysteampunkswashbucklerspace operascience fantasy |
Themes: | deceptionherodeathkidnappingmarriageescapeweddingmonstersupernatural powerspace travel |
Locations: | new york citybardesertouter spacecavewedding partyspace battle |
Characters: | warriorfather daughter relationshipsoldieralienhostagelawyertough guyaction heronative americanex soldieralien love |
Period: | 19th century1860s1870s |
Story: | horse chasefemale warriorhand to hand combatsword fightdual wieldbow and arrowprinceopening action sceneprincessfictional warshot in the backcombatrifleshowdownsword β¦horsechaseknifetitle spoken by charactercharacter name in titletwo word titleviolencefightbased on novelflashbackbare chested maleexplosionsurprise endingpistolvoice over narrationshootoutfistfighturinationrescuebattlearrestgunfightbrawlheld at gunpointrevolverscientistgood versus evilmassacredisguisemansionarmymixed martial artsnonlinear timelineno opening creditsone man armyspaceshipkingcreaturebartendertough girlskeletondiarybare chested male bondagesubtitled scenebattlefieldcivil wargoldcaptainsabotagespearheavy rainquesttold in flashbackjail cellspacecraftgiantimpersonationsevered handfaked deathmind controllasercolonelbar fightindianu.s. army3 dimensionalescape attemptbutlerjumping through a windowarizonatitle at the endlens flarewar veterantelekinesisteleportationchallengelaser gunpalacetelepathytombfemale fighterworld dominationmegalomaniacplane crashraftamerican civil warleadervirginiachainedtelegramsuperhuman strengthgladiatorjumpingexploding shipshapeshiftingmarsdigging a gravereturning homeaerial combatforced marriagechosen oneforce fieldpitalien raceloinclothmedallionjail breaksolar systembrandinghuman alienhuman versus aliensuper speedsword and planetsandstormmartianmorphingminionpulp fictionwalking in the raingreen bloodbare chested male fightingspace westernbegins with narrationgold barfighting in the airspyglassu.s. civil warchained to a wallair battleshape shifting alienchest hairwarrior racearizona territorycivil war veteranescape from jailfighting womenblue bloodarmy captainu.s. cavalrylocked in jailpaddle boattwo on a horsehatching eggbranding ironarmy colonelcease fireapache tribebased on pulp magazineearthlingurinating on the groundsilver dollarhuman malemale nipplefighting arenacity statesmack upside the headstealing a horsesword held to throatyear 1881egg hatchingurinating on the floorex army officerlow gravitytroop transportcaged maleyear 1868 (See All) |
Throughout history, tales of chivalry have burnished the legends of brave, handsome knights who rescue fair damsels, slay dragons and conquer evil. But behind many a hero is a good-for-nothing younger brother trying just to stay out of the way of those dragons, evil and trouble in general. As two pr β¦inces on a daring mission to save their land, they must rescue the heir apparent's fiancee before their kingdom is destroyed. Thadeous (McBride) has spent his life watching his perfect older brother Fabious (Franco) embark upon valiant journeys and win the hearts of his people. Tired of being passed over for adventure, adoration and the throne, he's settled for a life of wizard's weed, hard booze and easy maidens. But when Fabious' bride-to-be, Belladonna (Zooey Deschanel), gets kidnapped by the evil wizard Leezar (Justin Theroux), the king gives his deadbeat son an ultimatum: Man up and help rescue her or get cut off. Half-assedly embarking upon his first quest, Thadeous joins Fabious to trek across the perilous outlands and free the princess. Joined by Isabel (Natalie Portman)-an elusive warrior with a dangerous agenda of her own-the brothers must vanquish horrific creatures and traitorous knights before they can reach Belladonna. If Thadeous can find his inner hero, he can help his brother prevent the destruction of his land. Stay a slacker, and not only does he die a coward, he gets front row seats to the dawn of an all-new Dark Ages. (Read More)
Subgenre: | sword and fantasymartial artsblack comedysword and sorcery |
Themes: | deceptionheromurderdeathrevengekidnappingdrugsbetrayaltorturedrunkennessescapeweddingmonstermagicsupernatural power |
Mood: | gorespoofparody |
Locations: | forestwoodscastlecampfire |
Characters: | warriorfather son relationshipbrother brother relationshipsoldierhostageaction herowitch |
Story: | horse chasefemale warriorhand to hand combatsword fightknife fightdaggerstrong female leadbow and arrowstrong female characterprincesevered armprincessdecapitationcombatsword β¦horseblood splatterchaseknifetwo word titlebloodfightviolencefemale nuditymale nuditybare chested maleexplosionpartyfirecorpsefistfightrescuebattlebrawlf wordgood versus evilfoot chaseambushaxearmyimpalementstabbed to deathmixed martial artsstabbed in the chestsevered headanti herobirdritualkingcreatureskinny dippingvirginstabbed in the backmissiondragonrace against timetough girlattempted rapeexploding bodycharacter says i love youthreatened with a knifewaterfallfireworksbare chested male bondagebattlefieldtraitorkilling an animalquesttied to a bedgiantknighttorchaction heroineanimal attackbar fightfull moondamsel in distressdwarfreverse footagesevered fingercrossbowcannibalwizardprophecystabbed in the headstabbed in the legsibling rivalrydungeonslackercapturetribekingdomrescue missionsevered legblack magiccrude humorswearingteleportationpipe smokingpalacetorso cut in halfpractical jokemazefemale fighterscene before opening creditsgiant monsterhuman sacrificeworld dominationmegalomaniacstonersorcerertavernkiss on the lipskidnappershapeshiftinganimated creditsriddletwo brothersone woman armycompassthronelong haired malehorse drawn carriageeclipsesuit of armordouble entendrestabbed in the footwarlockgiant creatureinterrupted weddingstabbed with a swordscalpingroyal weddingminotaurswordplaybest manoutnumberedwedding daybad singingevil sorcererchastity beltseerheir to the throneclothes torn offmaking facesstorybookman woman fightmanservantspeared to deathwhipping someonemagical staffthong bikinimechanical birdthrowing a speartackled to the groundsaying booarm chopped offspear in chest (See All) |
Martial arts legend Huo Yuanjia became the most famous fighter in all of China at the turn of the 20th Century. Huo faced personal tragedy but ultimately fought his way out of darkness and into history, defining the true spirit of martial arts. His self-discovery, and the choices he made, inspired h β¦is nation. The son of a great fighter who did not wish for his child to follow in his footsteps, the bullied Huo Yuanjia resolves to teach himself how to fight - and win. Years of training enable him to ace match after match in his home region of Tianjin. But as his fame as a martial arts master grows, so does his pride. After an ill-advised fight leads to another master's death, members of Huo's family are slain in revenge. Grieving and ashamed, Huo wanders the country in shock. Near death, he is rescued by women from an idyllic village, and is offered simple kindness and generosity that help him heal and regain his equilibrium over a period of several years. Huo realizes that the future of martial arts lies in sportsmanship and not brutality, and he rejoins society to apply what he has learned. Returning to Tianjin, Huo takes steps to come to terms with his past and restore his family's name. His evolving, graceful Mizong (Missing) Fist method of fighting brings Huo renewed success, and he forms the progressive Jingwu Sports Federation. Taking note, duplicitous members of the Foreign Chamber of Commerce engineer a Shanghai tournament pitting Huo against four fighters, each represβ¦ (Read More)
Subgenre: | christ allegorytragedycult filmmartial arts |
Themes: | herofriendshipmurderrevengeadulteryredemptiongamblinghopechildhood |
Mood: | archive footage |
Locations: | restaurantrural settingchina |
Characters: | warriorfather son relationshipmother son relationshiptough guyaction herobest friendlittle girlchinese |
Story: | sword duelkatana swordhand to hand combatsword fightkindnesscompassionspiritopening action scenedueldisarming someonecombatfightingshowdownswordblood splatter β¦character name in titlefightbloodviolencesurprise endingbased on true storybeatingfistfightbrawlkung fumixed martial artsone man armycoffinone against manygravekaratebusinessmanwidowerfantasy sequencepoisonmartial artistcontestunderwaterloss of mothergrandmotherchild murderstylized violenceteamartial arts masterspearboxerchop sockykickboxingfight to the deathexiledeath of protagonistpridebettragic herostick fightpatriotismblindmain character diespeasantkung fu classickung fu masterflutebeggarloss of daughteridealismasthmafencingwagerresponsibilityvanitykickboxerbo staffwu shumartial arts tournamentfinancial crisisshanghaimessiahturn of the centuryswordplaydisciplecalligraphywuxia fictionlancerapierrice fieldhousehold servantbirthday dinnergodsontai chi swordtianjin chinachamber of commercewooden platform (See All) |
Set in the kingdom of Ehb, the story follows Farmer ('Jason Statham' (qv)), who was adopted by his village. When Farmer's wife, Solana ('Claire Forlani' (qv)), and his son leave to sell vegetables at the town of Stonebridge, Farmer's farm is attacked by creatures called Krugs. With the help of his f β¦riend and neighbor Norrick ('Ron Perlman (I)' (qv)), he travels to Stonebridge where his wife and son are. Before he arrives, the Krugs, controlled by the wizard Gallian ('Ray Liotta' (qv)), kill his son and capture his wife. Farmer, with the help of Bastian ('Will Sanderson' (qv)), his brother-in-law, and Norrick sets out to find and rescue his wife. The King's nephew Fallow ('Matthew Lillard' (qv)) is conspiring with the wizard Gallian to take over the kingdom led by King Konreid ('Burt Reynolds'). (Read More)
Subgenre: | sword and fantasyepictragedycult filmmartial artssword and sorcery |
Themes: | deceptionherofriendshiplovemurderdeathrevengekidnappingpregnancytortureescapeweddingmonstermagicmemory β¦death of fathersupernatural powerdeath of mothergriefgreedadoptiondyingvengeancecourage (See All) |
Mood: | rain |
Locations: | forestvillagewoodsfarmlakecastle |
Characters: | warriorfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipfriendboybrother sister relationshipsoldiertough guyaction herovillainuncle nephew relationshipgrandfather grandson relationship β¦grandmother grandson relationship (See All) |
Story: | sword duelhand to hand combatsword fightshot with a bow and arrowdaggerbow and arrowduelprincessfictional wardisarming someonecombatshowdownswordhorseblood splatter β¦chaseknifebloodviolencefightflashbackkissexplosionfirecryingfoodrescueslow motion scenebattlefalling from heightbooktearsrunningneighborsubjective cameragood versus evilsurvivalwinecandleaxemassacremountainstabbingthroat slittingbridgeeatingarmymixed martial artsprisonermapkingnecklacegravelibraryattackpoisonninjapassionreadinglightningfarmerhangingpursuitdeath of sonhorse ridingpigneck breakingtrapgeneralbattlefieldchild murderdestinyspearmachetecaptivestabbed in the stomachwitchcraftgenocidehonorburialslavepresumed deadrampagetelescopethunderbraveryloss of sonbased on video gameshovelwizardmedieval timespridedungeoncapturearmorraidsiegelieutenantkingdomblack magictelekinesissmokeimprisonmentcrowheroismpeasantlevitationfarmingstandoffshot with an arrowcommanderhanging upside downsorcererfantasy worldsword and sandalheirclimbing a treetitle in titleflamearcherdeath of grandmotherfacial scarsorceryman on firehorse and wagondeath of parentscavalrystaffimmolationvalleydeath of grandfatherthronetear on cheekbrother in lawstrawberryretreatchopping woodmistsuit of armorflaming arrowrunning for your lifedukeboomerangfuneral pyrecatapultransackingconcubinemissing sonpickaxesuicide contemplationaudio flashbackhanged by the neckkidnapped childlong lost fatherforced laborbell towerfalling off horsewarrior womandefiancegrapesmarketplacehayloftlong lost sonbell ringingfalling into a riverallyheir to the throneclimbing a ropegorgeamazon womanturniprope around neckdeath of grandsonshroudblackbirdpet pigpeasant armyreunited with parentupward camera shotburning barndeath of nephewpillageblack blooddeath of a kingswinging on a vinewizards' duelrain of arrows (See All) |
Diana, princess of the Amazons, trained to be an unconquerable warrior. Raised on a sheltered island paradise, when a pilot crashes on their shores and tells of a massive conflict raging in the outside world, Diana leaves her home, convinced she can stop the threat. Fighting alongside man in a war t β¦o end all wars, Diana will discover her full powers and her true destiny. (Read More)
Subgenre: | sword and fantasydark fantasyepicmartial artscoming of agesuperherofish out of watersteampunk |
Themes: | mythologydeceptionlovemurderdeathrevengesurrealismbetrayaldrinkingfeartorturedrunkennessescapemilitaryanger β¦corruptionpsychopathbrutalityobsessionsupernatural powerparanoiainsanitysadismhopepanicjusticecourageself sacrificegreek mythology (See All) |
Mood: | darknessgreek myth |
Locations: | forestbeachtrainchurchsnowmotorcycleairplaneparis franceboatlondon englandvillagewoodsshipcastlecave β¦campfirelaboratorytrain stationairplane chase (See All) |
Characters: | warriorfamily relationshipsmother daughter relationshipsingerfemale protagonistsoldierdancerphotographersister sister relationshiptough guyaction heronative americansingle motheralcoholicsniper β¦secretarygermanamerican abroadsniper rifleaunt niece relationshipfemale scientistamerican in the uk (See All) |
Period: | 2010s1910syear 1918 |
Story: | female warriorhand to hand combatsword fightgirl powersuper strengthdual wieldstrong female leadblockbusterbow and arrowprincessdisarming someoneshot in the backcombatfightingrifle β¦showdownswordhorsechaseknifecharacter name in titletwo word titlef ratedviolencefightnuditymale nuditysequelflashbackbare chested malecigarette smokingdancingphotographexplosionsingingpartysurprise endingpistolfirevoice over narrationshootouttitle directed by femalebeatingcorpseshot to deathfistfightmachine gunshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facedrinkbattlegunfightbrawlsecretfalling from heightpaintingbased on comicheld at gunpointbeerbombinterrogationpianoislandrevolverscientistgood versus evilspybased on comic bookaxemassacredisguisemontagearmystabbed to deathmixed martial artspoliticianstabbed in the chestmapnonlinear timelinefalse accusationno opening creditsanti heroscantily clad femalepart of seriesdouble crossunderwater scenevanshot in the legtrainingflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguebeaten to deathdangercostumescreamingelectrocutionfantasy sequencefactorypay phonepoisonmissionundercoverrace against timestatueevil manknocked outkicked in the facetough girllightningtankbraceletscardeath of brotherexploding bodylaptopsuspicionworld war onethreatened with a knifewaterfallshot in the armgeneralsecret agentlove interestpubqueennewspaper headlinesubtitled scenebattlefieldstylized violenceeavesdroppingropedestinycaptainhand grenadesabotagefireplacedestructionbulletrevelationspearassassination attemptwarehousesociopathhelmettold in flashbackmad scientistexploding buildingkicked in the stomachcaucasianvillainesswristwatchphone boothpooldesperationjumping from heightculture clashfollowing someonehonorfateaction heroinebar fightcannongas maskshieldbraveryinvasioncynicismfight to the deathanimated sequencehatredimpostormercilessnesschaossuper villainpost traumatic stress disorderimmortalitymentorpunched in the chestdynamitejumping through a windowdeath of sisteraerial shotsuperheroinee mailtitle at the endundercover agentarmordisfigurementgasolinekingdomfemale directorsecret identitydc comicsloss of brothertelekinesissmokegatling gunprequelteleportationpipe smokingbullet timeclose up of eyesheroismfemale soldiertranslatormale objectificationface maskhistorical fictionlevitationalleyanti warfinal showdownnotebookfemale fighterassumed identityeiffel tower parisfake identitytoweramerican indianworld dominationcomic reliefsailboatshot with an arrowmegalomaniacyoung version of characterarcherycrownidealismamazonno title at beginningsmugglerdepartment storebelgiumcrash landingexploding truckbehind enemy linesfemale herobayonetsaving the worldwoman kills a manhumorsuper powerfinal battlegurneyhijackingloss of sisterevil womanflamebomberarcheropen endedsuperhuman strengthwoman fights a manvaultimmortaldistrustgodhuman experimenttalking about sexanecdoteone woman armyflashback within a flashbackottoman empirearmy basebiplanechosen oneexploding airplanehalf brotherforce fieldfake accentbilingualismmad doctorfratricidetrenchrevolving doorearth viewed from spaceoverhead shotepic battlescottish accentparadisehorse drawn carriagesexual innuendopayphonesuit of armorwoman kills mandouble entendrescotsmanwoman punches a mansuper speedgerman armyinvulnerabilityorigin of heroflaming arrowbig ben londonman fights a womansharpshooterwalking stickevil scientistgalachemistdisobeying ordersgas grenadepoison gasstudent teacher relationshipgunpowdersultanbritish intelligencemass deathspear throwingthrown from heightturkwatchtowerantique dealermatriarchybell towergreek godbackfliptrench warfareevil godwartimealley fightbowler hatdeath of auntflameswarrior womancostumed heroescalationamazon tribeend of waralliteration in titlemoroccanwarrior racechemical weaponsfeztower bridge londonmachine gun nestaxe throwingdc extended universesuperhuman speedcasualty of warchemical weapontough womanprequel and sequelwestern frontwonder womanarmisticereference to zeuslightning boltamazon warriorhydrogenintelligence officeramazon womanfemale superheromilitary jeepdeath of mentorfemale archergas attackarescyanide pillmustard gasfemale talking about sexgerman spyamazon queenloss of auntmagic swordreturning actress with different character (See All) |
In stifling Edwardian London, Wendy Darling mesmerizes her brothers every night with bedtime tales of swordplay, swashbuckling, and the fearsome Captain Hook. But the children become the heroes of an even greater story, when Peter Pan flies into their nursery one night and leads them over moonlit ro β¦oftops through a galaxy of stars and to the lush jungles of Neverland. Wendy and her brothers join Peter and the Lost Boys in an exhilarating life--free of grown-up rules--while also facing the inevitable showdown with Hook and his bloodthirsty pirates. (Read More)
Subgenre: | sword and fantasymartial artsswashbuckler |
Themes: | herofriendshipmurderdeathbetrayaljealousyfearmagicangerlonelinesstheftadoptioncouragefirst love |
Locations: | schoolsnowbathtublondon englandwatershipcastlejunglestormcity of children |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendbrother brother relationshipboybrother sister relationshipteachergirlstudentthief β¦tough guynative americanvillainaunt niece relationshipaunt nephew relationshipmermaidboy hero (See All) |
Period: | 1900s |
Story: | sword duelhand to hand combatsword fightpanshot with a bow and arrowmusketheroinebow and arrowdueldisarming someoneweaponcombatfightingshowdownsword β¦title spoken by charactercharacter name in titleviolencefightgunbased on noveldogkissvoice over narrationcryingrescueslow motion scenebattlelettershootingbedislandclassroombound and gaggedgangambushmixed martial artsman with glassesno opening creditschildone man armydrawingattempted murderone against manydangerpoisonstorytellingtough girlskeletonglassestrapunderwaterclassrecord playericepirategoldcaptainflyinghead buttlifting someone into the airhattreasurehidinggossipteddy bearfemale tied upcannonbarefoottelescopechild's point of viewfairychild protagonistrowboatlostrivalshadowyoung lovegrowing upparrotwilhelm screamnannyclose up of eyesflagswordsmangatecrocodiletween girladventure heroboy with glasseshanging upside downbankerfencingcloudwhistlingfeathersiblingsewingcomettop hathookflintlock riflenightgownflintlock pistolsolar systemwire fubig ben londonchild heromale tied upreference to cinderellapleadingchild in dangerteepeehook for handplay fightvictrolamake believepirate captainnightshirtwooden swordsaint bernard dogpulling hairflying boygirl in dangerwalking the plankjolly rogerskull and crossbonesboy in dangerfantasy landflying shipblushingmagical dustthimblecrowingfairy dustbarefoot boy (See All) |
Two mutant brothers, Logan and Victor, born 200 years ago, suffer childhood trauma and have only each other to depend on. Basically, they're fighters and killers, living from war to war through U.S. history. In modern times, a U.S. colonel, Stryker, recruits them and other mutants as commandos. Loga β¦n quits and becomes a logger, falling in love with a local teacher. When Logan refuses to rejoin Stryker's crew, the colonel sends the murderous Victor. Logan now wants revenge. (Read More)
Subgenre: | martial artssuperhero |
Themes: | heroloverevengeescape |
Mood: | gore |
Characters: | samurai swordwarriorsoldiertough guyaction hero |
Story: | sword duelkatana swordhand to hand combatsword fightdueldisarming someonedecapitationcombatshowdownswordblood splattercharacter name in titlebloodviolencemachine gun β¦animal in titlekung fubased on comic bookmixed martial artsanti heroone man armyon the runone against manyfugitivewaterfalldismembermentstylized violencemutantmarvel comicswar veteransuper powersdamhead cut offrighteous rageclawimmortalarm cut offspin off from filmx menclaw fightwolverine the character (See All) |
A young Hobbit named Frodo (Guard) is thrown on an amazing adventure, when he is appointed the job of destroying the one ring which was created by the dark lord Sauron. He is assigned with warriors including Gandalf (Squire), Aragorn (Hurt) and Boromir (Cox). It's not going to be an easy journey for β¦ the Fellowship of the Ring, on the ultimate quest to rid Middle-Earth of all evil. (Read More)
Subgenre: | sword and fantasydark fantasyepiccult filmsword and sorcery2d animation |
Themes: | herosurrealismmonstermagicself sacrificeend of mankind |
Mood: | gore |
Locations: | castle |
Characters: | warriorvillaindeath of hero |
Story: | horse chaseshot with a bow and arrowbow and arrowjourneyfictional warcombatdemonshowdownblood splatterchasebloodviolencebased on novelsequelshot to death β¦rescuebattlegood versus evilfoot chaseambushbridgeno opening creditsmissionringfirst partcult directorbattlefieldquestwitchcraftback from the deaddwarfhungersuper villainfalling to deathwizardsiegekingdomelfgroupsidekickwar violencestandofffortresssorcererfantasy worldmacguffinfriends who live togethersword and sandalgoblinstabbed in the shoulderprehistoric timescavalrystaffstarvinglast standfictional countryaxe fightbattle axeprehistoryemaciationrotoscopingmultiple cameosorchobbitcavalry chargemiddle earthenchantmentright hand manwizardryhalflingpsychadelic image (See All) |
A poetic guitarist Eric Draven is brought back to life by a crow a year after he and his fiancee are murdered. The crow guides him through the land of the living, and leads him to his killers: knife thrower Tin-tin, drugetic Funboy, car buff T-Bird, and the unsophisticated Skank. One by one, Eric gi β¦ves these thugs a taste of their own medicine. However their leader Top-Dollar, a world-class crime lord who will dispatch his enemies with a Japanese sword and joke about it later, will soon learn the legend of the crow and the secret to the vigilante's invincibility. (Read More)
Subgenre: | dark fantasycult filmmartial artsblack comedyallegory |
Themes: | heromurderdeathrevengerapedrunkennessincestpsychopathbrutalitysupernatural powerjusticeafterlife |
Mood: | gorerainneo noirpoetic justice |
Locations: | churchcemeterybathtuburban settingrooftopinner cityrooftop fighthelicopter chase |
Characters: | warriorpolicemother daughter relationshipaction herowaitressfiance fiancee relationshipmysterious villain |
Story: | sword duelkatana sworddark herohand to hand combatsword fightkendodual wieldduelshot in the backcombatshowdownswordblood splatterknifetitle spoken by character β¦character name in titleviolencebloodfightgunfemale nudityflashbackfemale rear nudityshowerfirevoice over narrationshootoutcorpseshot to deathshot in the chestshot in the headslow motion scenecatgunfightfalling from heightshootingbombrock musicreference to jesus christguitarkung fusubjective cameragood versus evilhalloweenbased on comic bookconcertmontagethroat slittingimpalementstabbed to deathmixed martial artsstabbed in the chesttied to a chairexploding caranti heroone man armychild in perilgraveyardmarriage proposalgunshotone against manycharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotfirst partdirectorial debutshot in the armvigilanteundeadarsonfreeze framecrime bossoccultfalling down stairssyringebulletgothicloss of loved onedrug abusesergeantexploding buildingvillainessskateboardgun fubreakfastback from the deadgun battledrug overdosenostalgiastabbed in the throatironyjunkiethrown through a windowgang rapedead maneye gougingslaughterbody landing on a carknife throwingtragic herolasersightmain character diesengagement ringjewelrystabbed in the handdetroit michiganfencemegalomaniacstabbed in the armhot dogbullet balletbased on graphic novelnihilismgun duelguitar playerraveshot in the handpawnshoptragic loverighteous ragedeath of title characterfart jokerock musicianblack copfade to blackrebirthoverhead shotstairwellexit woundlong haired malefalling off a roofjeet kune doorigin of herogrungehot dog standgun katadrinking gamegun saustar died before releasecold casefalling off a balconyabandoned churchlead actor's last filmindustrial musiccalling parent by first nameknife in handdeath of cast membercrowd surfingurban gothicnocturnaldark angelreference to amelia earhartsmashing guitarhole in handmusician in castflashback montagerain fightslow motion shootoutcharred bodyeyes pecked outdevil's nighteve of weddingmurder of fiance (See All) |
Folklore collectors and con artists, Jake and Will Grimm, travel from village to village pretending to protect townsfolk from enchanted creatures and performing exorcisms. They are put to the test, however, when they encounter a real magical curse in a haunted forest with real magical beings, requir β¦ing genuine courage. (Read More)
Subgenre: | dark fantasycult filmblack comedysupernaturalfairy taleslapstick comedy |
Themes: | mythologynaturedeceptionmurderdeathrevengesurrealismkidnappingmoneybetrayalghostprisondrinkingfeartorture β¦drunkennessescapemonstermagicmilitarydeath of fathersupernatural powerparanoiayouthsadismdyingself sacrificemissing childunlikely hero (See All) |
Mood: | rainnightmare |
Locations: | forestchurchsnowcemeterysmall townvillagewoodscastlecavegermany |
Characters: | warriormother son relationshipfather daughter relationshipfriendbrother brother relationshipboyprostitutegirlsoldierdanceractorpriesthostagesister sister relationshiplove triangle β¦witchmayorfrench soldier (See All) |
Period: | 19th century1810s |
Story: | female warriorfolkloredaggerbow and arrowwolfsevered armcursetransformationanimalweapondecapitationshot in the backrifleswordhorse β¦knifetitle spoken by charactercharacter name in titlegunviolencefightbloodflashbackdogkissdancingexplosionthree word titlepistolfirecorpseunderwearfoodmirrorshot in the chestshot in the headrescuecatdrinkbattlearrestfalling from heightbookrunningbedinterrogationhallucinationbound and gaggedwinecandleold manaxestabbingwomaneatingarmystabbed to deathprisonerstabbed in the chestmapsnakesevered headman with glassestrialanti herodrawingchild in perildouble crossritualkingcreaturefemme fatalegunshotflash forwardattempted murdergravetreestabbed in the backprologuepossessionstorytellingrace against timerabbittough girlwigcrosswitnesspighauntingrattied upgeneralfireworksqueencowtrustwerewolfitalianropemedicineflyingwoundgothiccagelifting someone into the airhatbarnfraudtorchgoatstreet lifeback from the deadapplecannonfull moonguardreverse footagecrossbowresurrectioninsectstairscon artistdungeonshadowarmorsnowinglanternhorse and carriagelaughingsevered legexorcismpalacecrowhorseback ridingspelltombshowflagmagic trickharbortablehairtowerbeggarhuman sacrificeplagueselfishnessanimal crueltycrownwelltheatre productiontavernfantasy worldstablevanityhamburg germanymaggotraveninnpitchforkfrenchmansorceressbegginghorse and wagonsnailguidepentagramgrim reaperbanquetliquidpitthronehatchetholy waterwoman in dangervillain turns goodgoosesittingtoadeclipsedecomposing bodytorture chamberinquisitionhand kissingcrutchfrench armycandelabratrackercatapultbook burningroyal weddingdobermanburned at the stakereference to cinderellaone legged manevil queenaccentblobcanonwolfmanrocking horse1790seternal youthrotting corpsela marseillaisereference to little red riding hoodturretbird attackfrankfurt germanyhayloftcobwebgingerbread mananimate treeenchantmenttrapperchild eatendeath of kinglong underwearreference to sleeping beautybrought back to lifereference to hansel and gretelhaunted forestwater wheelgrimm's fairy talesgingerbreadwater millman wearing woman's clothingchalicedragged by horsefemale stuck in sticky substancegingerbread housescrubbing floorspinning axeforeign occupationreference to jack and the beanstalkbody torn in halfhanging from heightreference to rapunzel (See All) |
When the world of the Orcs of Draenor is being destroyed by the evil fel magic that uses life-force, the powerful warlock Gul'dan creates a portal to the world of Azeroth and forms the Horde with members of the Orc clans. He also captures many prisoners to keep the portal open. The king of Azeroth, β¦Llane Wrynn and his brother-in-law, Anduin Lothar are informed by the apprentice of magician Khadgar that he has found fel magic in dead bodies and the king decides to summon the Guardian of Tirisfal, Medivh, to protect his kingdom. Lothar and Khadgar head to Kharazhan to meet Medivh and an ominous shadow points a book out to Khadgar, who takes it and hides. Anduin, Khadgar and Medivh and a group of soldiers are attacked by Orcs and they capture the slave Garona, who is released by King Llane, and she shows them the location of the portal. Garona is contacted by the Orc chief of a clan Durotan that wants to meet King Llane to stop the fel magic. Meanwhile Khadgar learns that the gate was opened with the help of someone in Azeroth. Shall King Llane trust Garona and Durotan, who might be the traitor? (Read More)
Subgenre: | sword and fantasydark fantasyepicsword and sorcery |
Themes: | deceptionfriendshipmurderdeathrevengesurrealismbetrayalghostpregnancyfeardrunkennessescapefuneralmonsterinvestigation β¦magicangercorruptionbrutalitysupernatural powersadismexploitationhopeself sacrificeregret (See All) |
Locations: | forestchurchsnowvillagewoodscastle |
Characters: | warriorhusband wife relationshipfather son relationshipmother son relationshiptattoobrother sister relationshipsoldierbabyhostagetough guyaction herosingle fatherpregnantengineer |
Story: | sword duelhorse chasefemale warriorsword fightdaggerblockbusterwolfprincesevered armmanipulationcursedueltransformationfictional wardecapitation β¦combatdemonshowdownswordhorseblood splatterchaseknifeviolencefightbloodbased on novelone word titlebare chested maleexplosionsurprise endingfirevoice over narrationbeatingcorpseshot to deathfistfightshot in the chestshot in the headrescueslow motion scenepunched in the facebattlearrestbrawlfalling from heightbookinterrogationriversubjective cameragood versus evilsurvivalambushstrangulationaxemassacremountaindeath of friendthroat slittingarmyimpalementstabbed to deathprisonerstabbed in the chestmapsevered headno opening creditsanti herobirdchild in perildouble crossritualunderwater scenekingcreatureone against manytreelibrarycharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologuewidowerelectrocutionattackrace against timestatuetentevil manknocked outkicked in the facetough girllightningskeletonscarchildbirthexploding bodydeath of sondeath of husbandneck breakingsuspicionthreatened with a knifequeensubtitled scenebattlefieldstylized violencesingle parenthenchmaneavesdroppingtraitorloyaltydestructionrevelationhead butthelmetslaverytold in flashbackjail cellmagiciancaptivebeardhammerexploding buildingkicked in the stomachplanetgiantpoolrebelsevered handcovered in bloodsheepskullknightmind controlhonortorchburialaction heroineanimal attackcrushed to deathslavefull moonguardbarefootdwarfreverse footageshieldinvasionfight to the deathloss of soninventorhatredbased on video gamemercilessnesschaosstabbed in the neckshot in the faceevacuationwizardstabbed in the headswamp3dpunched in the chestdisembowelmentvolcanoaerial shotdungeontitle at the endcapturedeerdisfigurementtriberaiddemonic possessionkingdomloss of husbandmutationblack magicwilhelm screamtelekinesisexorcismteleportationpalacetelepathyimprisonmentelfclose up of eyesfemale soldierblood on camera lensnarrated by characteranti warfinal showdownoutcastfemale fighterspiral staircasedoubtgiant monsterhuman sacrificetreasonportalworld dominationmegalomaniaccrowninterracial marriagesorcererhead bashed inreluctant heromercy killingshamanblizzardcolonialismoffscreen killingbitten in the neckcrushed headleaderwoman kills a manstabbed in the shoulderguardianfinal battlepart computer animationcamouflageshape shifterwoman fights a mandistrustjailbreakwarlordhit with a hammersymbolreclusemind readingcavalryanimal killingarmy basefade to blackapprenticedreadlocksforce fieldimmolationrookieanti heroineglowing eyesarmorypower struggleretreatmacehorse drawn carriagebarracksscrollleadershipdecomposing bodytranslationcollapsing buildingmysticwarlockbody armorgiant creaturecribdisobeying orderscouncilcaged humancubebook burninggolemburnt handclancrisis of consciencecolonizationgreen bloodevil sorcererbegins with narrationlegionpyrokinesisorcmagical ringshape shiftingevil wizardmagewarrior racesurroundedgreen skinhordetunicsceptermusclestooth ripped outfloating in spacegiant birdinanimate object comes to lifesecret meetingwar roomfictional languagefloating citytuskchieftainstabbed through the backlife force sucked out (See All) |
In ancient China, before the reign of the first emperor, warring factions throughout the Six Kingdoms plot to assassinate the most powerful ruler, Qin. When a minor official defeats Qin's three principal enemies, he is summoned to the palace to tell Qin the story of his surprising victory.
Subgenre: | christ allegoryepicmartial artswuxia |
Themes: | deceptionherofriendshiplovesurrealismsuicideinfidelitybetrayaljealousyfuneralredemptionexecutionhopevengeancecourage β¦self sacrifice (See All) |
Locations: | schooldesertlakechina |
Characters: | warriortough guyaction hero |
Story: | sword duelhand to hand combatsword fightkindnesscompassionduelcombatfightingshowdownswordbloodviolencefightflashbackmale rear nudity β¦bare chested malesurprise endingvoice over narrationshot in the chestshot in the headslow motion scenebattleorphanassassincandlearmystabbed in the chestone man armyritualkingshot in the legtrainingone against manylibrarylegendstabbed in the backkicked in the facepremarital sexstylized violenceflyingspearassassination attempttold in flashbackfaked deathhonorchop sockyfemale killersocial commentarydeath of protagonistrainstormtragic heroarrowmain character diespalacefemale assassinheroismswordsmanlocal blockbusterlost lovetrue lovearcheryidealismfilm starts with textheritagetyrantresponsibilityrespectredescorttragic lovegreendeath of title characterpatriotundressing someoneflashback within a flashbackman with no namewu shurewardbluemale full back nuditynameless charactercalligraphywuxia fictionancient chinaunreliable narratordouble impalementwarrior womanwalking on waterbody searchunreliable flashbackunreliable narrationthrone roomcolor motif (See All) |
Luke Skywalker battles horrible Jabba the Hut and cruel Darth Vader to save his comrades in the Rebel Alliance and triumph over the Galactic Empire. Han Solo and Princess Leia reaffirm their love and team with Chewbacca, Lando Calrissian, the Ewoks and the androids C-3PO and R2-D2 to aid in the disr β¦uption of the Dark Side and the defeat of the evil emperor. (Read More)
Subgenre: | christ allegoryepictragedycult filmmartial artsslapstick comedystop motion animationspace operacult classic |
Themes: | heroloveghostdancemonstergangsterangerredemptionevilexecutionspace travel |
Mood: | poetic justice |
Locations: | forestdesertwoodsouter spacespacecampfirespace stationspace battle |
Characters: | warriorfamily relationshipsfather son relationshipafrican americanbrother sister relationshipalientough guyaction hero |
Period: | future |
Story: | sword duelhand to hand combatsword fightfamous scorekindnesskendocompassionblockbusterduelprincessfictional wardisarming someoneweaponcombatshowdown β¦swordchaseviolencefightnumber in titlesequelbondagekissdancingexplosionfirelickingpunctuation in titleshootoutrescuecomputerbattlegunfightbikinifalling from heightnumbered sequelrobotsubjective cameragood versus evilcleavageambushstrangulationdisguisemixed martial artsno opening creditsscantily clad femaletonguecreaturetreepuppetelectrocutionattackcharacter's point of view camera shottough girlscreamtrapgeneraltwinfireworksbattlefieldmoondestinylifting someone into the airroman numeral in titlespacecrafttwinscaucasianassaultplanetrebelsevered handpart of trilogyrebellionlasergun fuandroidgun battleslaveeaten alivepromisereverse footagefalling to deathbooby trapmusical numberhologrambounty hunterwilhelm screamtelekinesislaser gunreturning character killed offcremationfemale fighterexotic dancerwar violencegiant monstersex slavefemale spyemperorhugsmugglersorcererpatricidetyrantfriends who live togetherlightsaberbestialityfinal battleoverweightempirechainedflameorchestral music scorefather son estrangementsixth partroman numbered sequelstarshipvictorychainstreeslifting person in airalien creatureslimex rayed skeletonvillain turns goodcrime lordhumantragic villainmessiahsagacult figurefireworkfrozen bodyrescue attempttransportangryhuman in outer spacelaser beamfire fightzoophiliafuneral pyrelifting male in aircollarlifting an adult into the airthe forcejedi knightswordplayfather and sonoutrunning explosionsupervillainjet packpublic executionhumanoid alienfictional planetgalactic warpsychokinesisangry mandroidflamesinvented languageabyssstormtroopertalking robothang glidingdesert planetfraternal twinselectrical torturestorm troopergreen skinhumanoid robotman eating monsterenslavementwarp speedalien civilizationdeath starleather gloveslast wordsmandalorianstarfightermale aliensymphonic music scorefemale humanoid alienchained womansparksparkswookieedeath rayevil empiremausercharacter says i have a bad feeling about thissaved from executionspace navyleitmotifelongated cry of noforce lightninghuman maleat st walkercollar and leashhuman femalemauser c96 pistoltie fighterastromech droidend of trilogyfar far awayfather son fightgladiatorial combatmauser pistolmillennium falconstrangled with a chainfate of the universegold bikinihigh speed chaser2 d2shuttlex wing starfighterhuman alien sexual relationsprotocol droidslave collarstar destroyerstarship battledeep voicefemale green skinned humanoid aliengold robotlong time agoloss of handmistaken for godrebel starshipspacecraft cockpitstarfighter pilotstarship versus starshiptransport starshipblaster pistolchained humangr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperred blade lightsaberspeeder bike (See All) |