Please wait - finding best movies...
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
| Subgenre: | psycho thrillerpsychological horroramerican horrorsuspensecult filmindependent film |
| Themes: | madnessunrequited lovemental illnessdatinginsanityguiltpsychopaththeftdivorcevoyeurismdeceptionfuneralfearmoneymarriage …murderdeath (See All) |
| Mood: | breaking the fourth walldarknessslasherrain |
| Locations: | car in watermotelpolice carrural settingdesertbathtubsmall townhotelchurch |
| Characters: | slasher killerserial murdererserial killerterrorsheriffsecretarypsychiatristvillainkillerthiefsister sister relationshippolicemanfriendmother son relationshipfamily relationships |
| Period: | year 19601960s |
| Story: | phone boothpsycho terrorpsycho killerarizona desertwoman in brashower curtainhorror movie remadephoenix arizonapsycho next doorvictim invited to dinnerpsycho filmgrindhouse filmfemale victimhomicidal maniacmotel owner …motel clerkspurned womanjealous womanvillain played by lead actormissing womanmurder of a nude womandead woman on floorfemale in branaked dead womanpsychopathic killerbra removingdead woman with eyes openblack brasadistic psychopathold womandriving in the rainbloody corpsehidden corpserotting corpsescreaming in fearhidden moneystolen moneymurdered in a showerfemale in showerslashed to deathmurder weaponfalse accusation of murderlistening to classical musicbedridden mothersweeping floorcovering a dead bodyscreaming in horrorfamous twistalone in houseposing as husband and wifeused car dealerhouse of horrorsstopped by policemislaid trustbased on ed geinfamous opening themecleaning updissociative identity disorderboothoedipal complexcult favoriteirony of fatemutilated bodyjealous manhighway patrollooking through a windowinsanecarrying a dead bodynight drivingslip the undergarmentdragging a dead bodyalimonylicense platelifting an adult into the airlifting a female into the airdrive in classicseclusionstabbed with a knifelooking in a windowbad motherloss of girlfriendmurder spreeneon signremadefollowingbloody violencedisturbingtaxidermywife leaves husbandbroken engagementknife murderweirdothreat to killdeeply disturbed persontalking to oneselfmysterious strangerhardware storesafe sexidentity crisisdisturbed individualmurder suspectred herringworking outcrime spreeenvelopestairwellcurtainfade to blackpeep holebutcherysilhouetteoverhead camera shotreclusematriciderealtorfamous scoresleeping in a carloss of sisterembezzlementrole reversalhearing voicessplit personalityfoot closeupdomineering motherdisposing of a dead bodyflyserial murderabandoned housefemale removes her dressslashingtwist endingtemptationhuman monsterold dark housedirector cameomysterious manbad guyfemale stockinged feetmadmanimpotencecharacters killed one by onedead mothernervous breakdownpsychoticbloodbathphonebody countcellarmeetingextortiondeath threatrainstormarizonaswampgash in the facebutcherimpostorcamera shot of feetapartment buildingpeeping tomdriving a carskullvictimgrindhousepsychoimpersonationblockbusterlifting someone into the airlooking at oneself in a mirrormutilationbreaking and enteringfaintingfalling down stairsfemale stockinged legseyeglassesprivate detectivemaniaccross dressingkillingthreatened with a knifefirst partmurderertrapbasementfemale removes her clotheswitnesscountrysidelong takescreammissing personcharacter's point of view camera shotmistaken identityfirst of serieswidowerstalkerbathbirdstabbed in the cheststabbed to deathtoiletwidowwomanstabbingdisguisecaliforniabranewspapergood versus evilsubjective cameravoyeurhallucinationjailbathroomsecretundressingarrestunderwearcorpsevoice over narrationtelephone callshowersurprise endingphotographbare chested malebased on novelone word titleinterviewviolencebloodflashback (See All) |
Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?
| Subgenre: | psycho thrilleramerican horrorcult filmbody horrorindependent horrorsadistic horror |
| Themes: | insanitypsychopathdeathmurdertorturebrutalitysupernatural powersadismevil |
| Mood: | breaking the fourth wallslashergoreblood and gore |
| Locations: | hospitalsex in showersex in a bathroom |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipteenage girlteenage boymysterious villainmysterious killer |
| Period: | 1980s |
| Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacmurder of a nude womannaked dead womanpsychopathic killersadistic psychopathmutilated bodylifting a female into the airdrive in classicmurder spreedisturbingbloody violenceknife murder …deeply disturbed persondisturbed individualcrime spreebutcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebody countbutchergrindhousepsycholifting someone into the airmutilationmaniackillingmurderercharacter's point of view camera shotstabbed to deathsubjective cameraunderwearcorpsesurprise endingviolencebloodsexfemale nuditynumber in titlemale nuditybare breastssequelfemale frontal nuditymasturbationmale rear nudityfemale rear nuditypantiesblood splattermasklow budget filmdecapitationstrangulationimpalementsevered headchild in perillooking at the cameraskinny dippingstabbed in the backevil manstalkingpremarital sexcabinloss of motherobscene finger gesturesexual attractionragemorguefourth parttowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carkilling spreemasked killercar troublestabbed in the handkillsummer campshot in the eyehillbillymeat cleaverextreme violencegraphic violencestabbed in the facemasked villaindeformitylunaticvillain not really dead clichehockey maskruraltorturergiallo esquesequel to cult filmstabbedboogeymanskull crushinggory violenceeast coastgruesomejason voorheeshead shavingcorkscrewfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmindependent horror |
| Themes: | insanitypsychopathdeathmurderdrugsrapetortureincestbrutalityevilexploitationmurder of family |
| Mood: | slashergore |
| Locations: | chicago illinois |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerbrother sister relationshipprostitutemysterious villainmurder of a prostitute |
| Period: | 1980s |
| Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacvillain played by lead actormurder of a nude womandead woman on floornaked dead womanpsychopathic killersadistic psychopathmutilated bodymurder spreeknife murderdisturbed individualcrime spree …butcherymatricideserial murderslashinghuman monstermysterious manbad guymadmanbody countbutcherpsychomutilationfemale stockinged legsmaniackillingstalkerstabbed in the cheststabbed to deathstabbingsurprise endingviolencebloodfemale nuditycharacter name in titlenuditybare breastsgunshot to deathblood splattershot in the chestlow budget filmmarijuanacriminaldecapitationbisexualstrangulationvideo cameradrug dealerchild abusesevered headcontroversypantyhoseevil manattempted rapestalkingneck breakingdismembermentsplatterragestabbed in the stomachrapistrampagelow budgetdark humorpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepervertkillsexual violenceextreme violencevideo footagecut into piecesoff screen murderchild rapebroken neckexploitation filmcreepwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersgraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F …ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmb horrorindependent horror |
| Themes: | insanitypsychopathfearmurderdeathbrutalityevilexploitation |
| Mood: | darknessslashergore |
| Locations: | police carwoodswheelchairlakecampfirebackwoodsrunning through the woodschase in the woods |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipmysterious villainmysterious killer |
| Period: | 1980ssummeryear 1984 |
| Story: | phone boothpsycho terrorpsycho killerhorror movie remadegrindhouse filmhomicidal maniacmurder of a nude womanpsychopathic killersadistic psychopathlifting a female into the airdrive in classicmurder spreedisturbingbloody violenceweirdo …knife murdercrime spreebutcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onepsychoticbody countbutchervictimgrindhousepsycholifting someone into the airmutilationmaniackillingmurderercharacter's point of view camera shotstalkerbrasubjective cameracorpsetelephone callsurprise endingviolenceflashbackbloodsexfemale nuditynumber in titlesequelfemale frontal nuditykissfightnipplespantiesdigit in titleblood splatterblondeslow motion scenecatbikinimasksecond partdead bodynumbered sequelswimmingdecapitationstrangulationmassacrethroat slittingimpalementjokesevered headcontroversyskinny dippingprologueevil manopening action sceneconvertiblestalkingobscene finger gesturelove interestkissing while having sexsplatterchesschainsawfireplacespearnipples visible through clothingmass murdergothicmacheteragevillainessmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headslaughterbetrefrigeratorlens flarekilling spreemasked killernude swimmingcar troublereturning character killed offsummer campfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainpitchforksole survivorlunaticpsychotronic filmdying during sexvillain not really dead clichecreepkilled during sexmystery killershackmultiple homicidetrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymaneast coastsickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmslasher flickholiday horror |
| Themes: | madnessinsanitypsychopathvoyeurismfeardeathmurderjealousytorturememoryseductionbrutalityobsessionparanoiablindness …traumamurder investigationmurder of a police officerpsychological trauma (See All) |
| Mood: | darknessslashergorenight |
| Locations: | police carsmall townhospitalcarwheelchairhospital fire |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemanpoliceteenagerboyfriend girlfriend relationshipteenage girlpolice officernursedetective |
| Period: | 1970syear 1978 |
| Story: | psycho terrorpsycho killerpsycho filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killerdead woman with eyes opensadistic psychopathold womandrive in classicmurder spreedisturbingbloody violenceknife murder …deeply disturbed personbutcherysilhouetteserial murderslashinghuman monstermysterious manbad guyfemale stockinged feetmadmancharacters killed one by onebloodbathbody countbutchercamera shot of feetdriving a carvictimgrindhousepsycholifting someone into the airmutilationmaniacmurderertrapwitnessscreamcharacter's point of view camera shotstalkerbathstabbed to deathstabbinggood versus evilsubjective cameravoyeursecrettelephone callviolencebloodsexfemale nuditynuditynumber in titlemale nuditybare breastssequelmale rear nuditytwo word titlekissfemale rear nuditycigarette smokingnipplesexplosionknifechasefirecryingblood splattercar accidentshot in the chestblondewatching tvkissingbrawlmaskshootingsecond partneighborrevolverhalloweenflashlightold manstrangulationambulancethroat slittingaccidentbrunettepart of serieshit by a carsearchpantyhosenews reportnecklaceattempted murderstrippingbeaten to deathstabbed in the backprologuescreamingperson on fireuniformpoisonproduct placementcollege studentinjectionstalkingglassessplattertv newssyringedestructionelectronic music scorehypodermic needlesexual attractioncowboy hatwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolpsychologistbuttdead womantowelback from the deadhomicidemasked manpresumed deadrampagestabbed in the throatmanhuntmercilessnessmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastnude woman murderedlightneighborhoodsmokemasked killerflat tiredead girlconfusioncar troublestoreneedlemedical masksurgical maskdark secretbandagelighteralonesuit17 year oldearringnurse uniformdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelbutcher knifeman on firepool of bloodscarenude bathingvillain not really dead clichezippo lighterdying wordssinisterescaped mental patientburningcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidemidwestsmall town sheriffsearchingmichael myerscalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeyman21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Marion Crane steals a lot of cash from a man whom her boss is in business with. On the way to see her boyfriend, she stops off by an old motel, run by the odd Norman Bates. She is murdered in the shower. Her sister, boyfriend, and a private investigator try to find out where she is, while we learn m …ore about Norman Bates. (Read More)
| Themes: | mental illnessinsanityguiltpsychopathdeceptionmoneymurder |
| Mood: | rain |
| Locations: | motelsmall towncarstorm |
| Characters: | serial killersheriffpsychiatristthiefmother son relationship |
| Period: | 1990s |
| Story: | motel ownervillain played by lead actormissing womanbra removingold womanstolen moneymurdered in a showerbased on ed geinlifting an adult into the airhardware storereclusefamous scoreembezzlementsplit personalitydomineering mother …disposing of a dead bodyold dark housecellarswampgash in the facedriving a carpsycholifting someone into the airfalling down stairsprivate detectivecharacter's point of view camera shotbirdstabbed in the cheststabbed to deathtoiletdisguisenewspapervoyeurbathroomsecretcorpsetelephone callshowersurprise endingone word titlebased on novelbloodmale nuditymasturbationmale rear nudityfemale rear nuditykniferemakehousecontroversystabbed in the backcabinthundernude woman murderedtransvestismhitchcockianbutcher knifelifting female in airmultiple personality disorderinvalidwoman removes her clothescontemporary settingcolor remake of black and white filmstormy nighttoilet flushgreen braremake of hitchcock filmshot for shot remakedilated pupilpressure from motherscared by a mirror image (See All) |
Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.
| Subgenre: | psycho thrilleramerican horrorcult filmsupernaturalparanormal phenomenaslasher flickteen horror |
| Themes: | insanitypsychopathdeathmurderprisonmonstersupernatural powerevilmurder of a police officer |
| Mood: | breaking the fourth walldarknessslashergorecar chase |
| Locations: | small townforestcemeteryboatwoodslakeamerica |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillerpoliceteenagerzombie |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerpsycho filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathmutilated bodylifting a female into the airdrive in classicmurder spreebloody violenceknife murderbutcheryserial murder …slashingbad guymadmanbloodbathbody countbutchervictimpsycholifting someone into the airmutilationmaniackillingmurdererstabbed to deathstabbingsurprise endingflashbackviolencesexcharacter name in titlenumber in titlesequelblood splattermasknumbered sequeldemondecapitationflashlightmassacreambulancesevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingunderwatersevered armdismembermentundeadblood spattersplattermass murdergothicmacheteback from the deadmasked manrampagenew jerseyshovelstabbed in the headslaughtersevered legsequel to cult favoritekilling spreemasked killerbeheadingkillsummer campactual animal killedsixth partstabbed in the facemasked villainrecreational vehiclecut into piecesheart ripped outoff screen murdervillain not really dead clicheghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey maskdemonicdark and stormy nightgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementfriday the thirteenthstabcamaromachete mutilationviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
| Themes: | insanitypsychopathfeardeathmurderrevengebrutalitysadismevilexploitationpolice investigation |
| Mood: | darknessslasherraingorenightmarenight |
| Locations: | small towncemeterywoodsamericabackwoods |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillermother son relationshippoliceteenagerbrother brother relationshipmysterious villainmysterious killercountry boy |
| Period: | 1980s |
| Story: | psycho terrorpsycho killergrindhouse filmfemale victimhomicidal maniacmurder of a nude womanpsychopathic killersadistic psychopathdrive in classicmurder spreebloody violenceknife murderweirdodisturbed individualcrime spree …butcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onepsychoticbody countbutchervictimgrindhousepsycholifting someone into the airmutilationmaniackillingmurderercharacter's point of view camera shotstalkersubjective camerasurprise endingviolencebloodsexfemale nuditynumber in titlebare breastssequelfemale frontal nuditykissdancingchasepantiesdigit in titleblood splatterdead bodylow budget filmnumbered sequeldecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgraveevil mandeath of brotherstalkingdeath of sonobscene finger gesturekissing while having sexchainsawmachetebarnstabbed in the stomachmasked manmental institutionrampagerednecknew jerseyitalian americanpsychotroniceye gougingslaughterstabbed in the eyeaxe murderfifth partsequel to cult favoritemasked killercar troublelaundrydefecationsummer campcomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villaincut into pieceslunaticpsychotronic filmdeath of grandfatherreturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidesmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightcandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent filmslasher flickteen moviemurder mysteryteen horror |
| Themes: | insanitypsychopathvoyeurismfearmurderdeathrevengecorruptionbrutalityhumiliationsadismevilcrueltytraumamysterious death |
| Mood: | darknessslashergorenightblood and gore |
| Locations: | police carrural settingcarmotorcycleboatwaterwoodslaketruck |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillerpolicemanfriendpoliceteenagerteenage boypolice officerartistmother …truck drivermysterious villain (See All) |
| Period: | 1970s1950ssummer |
| Story: | psycho terrorpsycho killerpsycho filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathdrive in classicmurder spreeremadedisturbingbloody violenceweirdoknife murder …crime spreecurtainbutcheryfamous scoreserial murderslashinghuman monstermysterious mancharacters killed one by onepsychoticbody countbutchervictimgrindhousepsychomaniackillingfirst partmurdererfirst of seriesstabbed to deathwomanstabbingbrasubjective cameravoyeurhallucinationcorpsesurprise endingbare chested maleviolencesexfemale nuditynumber in titlemale nuditybare breastsmale rear nuditykissfemale rear nuditynipplesthree word titlepantiesbeatingdigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanaguitardecapitationbedroomcandleold manaxemassacrethroat slittingdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingmoaningdeath of childprankinjectionstalkingdeath of soncabinkissing while having sexteenage sexfreeze framegirl in pantiesrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitymercilessnesspower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterlens flareaxe murderroomkilling spreearrowdeath of loved onetank topphysical abuset shirtjoysexual awakeningbeheadingcar troubleshortsdead animalsummer campcanoeadolescencerepressionsexual perversionrestroomfemale psychopathjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violenceanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gamepillowsole survivortraumatic experiencewet clothesgrudgeoff screen murdervillain not really dead clichemurder victimtroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentfemale serial killerawakeningdate in titledead teenagerlost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esquesadisticdark and stormy nightmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gameknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmslasher flickteen movieteen horrorholiday horror |
| Themes: | psychopathfeardeathmurdercorruptionparanoiaevilmurder of family |
| Mood: | slasherhigh schoolnight |
| Locations: | small towncarcar theftkitchen knife |
| Characters: | slasher killerserial murdererserial killerterrorpsychiatristvillainkillerhusband wife relationshipteenagerboyteenage girlteenage boyfemale protagonistgirllittle girl …little boydoctor patient relationship (See All) |
| Period: | 1960s1970syear 1963year 1978 |
| Story: | psycho terrorpsycho killerhorror movie remadepsycho filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killerdead woman with eyes opensadistic psychopathhouse of horrorscarrying a dead bodydrive in classicmurder spreeknife murder …weirdofamous scoreserial murderhuman monsterbad guymadmanphonebody countgrindhousepsychoblockbusterlifting someone into the airmutilationmaniackillingfirst partmurdererlong takecharacter's point of view camera shotfirst of seriesstabbed to deathstabbinggood versus evilsubjective camerasurprise endingone word titleviolencefemale nuditynuditydogguncigarette smokingtitle spoken by characterknifeshot to deathblood splattershot in the chestwatching tvfalling from heightmaskrunninglow budget filmmarijuananeighbortelevisiontelephonehalloweenstrangulationthroat slittingchildgunshotattempted murderprologuesuburbpay phoneevil manhalloween costumestalkinghandgunpot smokingteen angstbulletelectronic music scorebabysitterstabbed in the stomachdead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhuntmercilessnesstvtitle at the endkilling spreepumpkinnude woman murderedmasked killerdead doggothmental patientyellingclosethiding in a closetkillsuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childbabysittingcarpentermasked villainknittingbutcher knifeoff screen murderwetnessvillain not really dead clicheescaped mental patientno endingpayphonelight bulbmidwestghost costumewoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeyman21 year oldpumpkin carvinglifting a male into the airwoman stabbedlaundry roomjumpsuitsmoking a cigarettesororicideescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberteenager in dangergiant pumpkinteenager murdered (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
| Subgenre: | psycho thrilleramerican horrortragedyslasher flick |
| Themes: | insanitypsychopathmurderdeathsuicidekidnappingrapetorturebrutalitydysfunctional familysadismevilhome invasionpolice investigationmurder of a police officer …mysterious death (See All) |
| Mood: | darknessslashergoreblood and gore |
| Locations: | small townstrip club |
| Characters: | slasher killerserial murdererserial killerterrorsheriffpsychiatristvillainkillerteenagerafrican americanboyfriend girlfriend relationshipboyhostage |
| Period: | 1970s |
| Story: | psycho terrorpsycho killerpsycho filmfemale victimnaked dead womanpsychopathic killersadistic psychopathslashed to deathmutilated bodyinsanecarrying a dead bodylifting a female into the airmurder spreedisturbingbloody violence …knife murderweirdodeeply disturbed personcrime spreebutcherymatricideloss of sisterserial murderabandoned houseslashinghuman monsterbad guymadmancharacters killed one by onebloodbathpsychoticbody countbutchervictimpsycholifting someone into the airmaniackillingmurderercharacter's point of view camera shotstabbed in the cheststabbed to deathstabbingsubjective cameracorpsephotographviolencebloodsexfemale nuditymale nudityfemale frontal nudityfemale rear nudityfemale full frontal nuditytitle spoken by characterknifechasepistolwoman on topbeatingblood splatterremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordstrangulationmassacrethroat slittingimpalementjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformevil manbaseball bathangingshot in the shoulderstalkingpremarital sexloss of motherprofanityteenage sexblood spattersplatterkilling an animalelectronic music scoremass murderrageloss of friendpsychologisthome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalheadphonesperversionmurder of a childdark pastbroken armduct tapekilling spreepumpkinswearingmasked killerhit with a baseball batpervertmexican americanporn magazinedead animaltrick or treatingsexual violencetombstoneschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagekiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainbutcher knifeloss of familydying during sexanimal killingmass murderervillain not really dead clichejack o'lanterndying wordscreepescaped mental patientchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidemidwestcreepymichael myersdeath of petloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialmurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manchoked to deathempty swimming poolmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childkilled with a forkmonster as victimsadistic killeranimal mutilationwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | psycho thrilleramerican horrorsuspenseblack comedysuperherotragedysurvival horrorteen horrorpsychological thriller |
| Themes: | mental illnessinsanitypsychopathvoyeurismdeceptionfuneralfeardeathmurderfriendshipsurrealismkidnappingrapebetrayalescape …monsterdeath of fatherbrutalityparanoiasurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
| Mood: | slashergoreneo noir |
| Locations: | police cartrainforesttaxiwoodskitchenapartmenttaxi drivermuseumtunneltrain stationart museum |
| Characters: | slasher killerserial murdererserial killerterrorpsychiatristvillainkillerfather daughter relationshipteenagerafrican americandoctorteenage girlpolice officerhostagesecurity guard …uncle niece relationshippolice dog (See All) |
| Period: | 2010s |
| Story: | psycho terrorpsycho killerfemale victimhomicidal maniacvillain played by lead actorpsychopathic killersadistic psychopathold womandissociative identity disorderdisturbingbloody violenceweirdodisturbed individualfade to blacksplit personality …serial murdertwist endinghuman monsterdirector cameobad guycharacters killed one by onebody countvictimpsycholooking at oneself in a mirrormaniackillingmurdererbasementmissing personcharacter's point of view camera shotstalkersubjective cameravoyeurcorpsesurprise endingbare chested maleone word titleviolencebloodflashbacksequeldogdancingtitle spoken by characterpartyknifechasepantiescell phoneshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborriversurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportnecklacetransformationtrainingattempted murderdangertentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkinglaptoploss of fathersuspicionrevelationhypodermic needleheavy raincagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastkilling spreechloroformtorso cut in halfhit with a baseball batmental patientpedophiliaforced to stripmental breakdownscene before opening creditsspiral staircasechild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastkidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molestersole survivorwhite braschizophreniclocked in a roommolestationchild rapesinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayflesh eatingdead teenagercaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitylocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
| Subgenre: | psychological horrorsuspenseindependent filmb movieb horrorindependent horrorsadistic horrorfrench horrorhorror b movie |
| Themes: | madnessunrequited loveinsanitypsychopathfearmurderdeathfriendshipsurrealismkidnappingrapetorturedeath of fatherbrutalitydeath of mother …sadismevilhome invasionexploitationdeath of wifemurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
| Mood: | darknessslashergorenightmarecar chasenightblood and gore |
| Locations: | rural settingbathtubhospitalforestwoodsroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfriendmother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboy …brother sister relationshipteenage girlfemale protagoniststudentbest friendfrenchbest friendsmysterious villainmysterious killerdeath of boy (See All) |
| Story: | psycho killershower curtaingrindhouse filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathslashed to deathmurder spreebloody violenceweirdodeeply disturbed persondisturbed individualcrime spreebutchery …serial murderslashinghuman monsterbad guymadmancharacters killed one by onebody countgash in the facebutchergrindhousepsychomutilationmaniackillingmurdererstabbed in the cheststabbingsubjective cameravoyeurbathroomcorpsetelephone callshowersurprise endingphotographflashbackviolencebloodfemale nudityf ratedbare breastsfemale frontal nuditymasturbationdogguncigarette smokingknifelesbian kisschasedreamblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmneighbortelephoneshot in the backdecapitationsurvivalflashlightbound and gaggedaxemassacrethroat slittingimpalementhousesevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropeblood spattersplatterchild murderchainsawfireplacekilling an animalmass murderlistening to musicsurvivorstabbed in the stomachsevered handstrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonebroken glassmental hospitalplot twistperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultkilling spreeparrotdead dogbeing followedpervertblood on camera lenssuffocationtaking a showerbarbed wirevideo surveillanceearphonesclosetnecrophiliaminimal castkillkilling a dogfarmhousefemale psychopathlistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbutcher knifevineyardchainsdriving at nightbludgeoningwalkmanexploitation filmstraight razorcreepbloody body of a childserial rapistsexual predatorgas station attendantfemale serial killerplastic bagcircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
| Subgenre: | american horrorcult filmindependent filmslasher flickteen movieteen horrorindependent horror |
| Themes: | psychopathfuneralmurderrevengesurrealismsupernatural powerevil |
| Mood: | slashergorehigh schoolnightmareavant garde |
| Locations: | bathtubcemeterypolice station |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillermother son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlalcoholicpolice chaseself mutilation …mysterious villainpolice lieutenant (See All) |
| Period: | 1980s |
| Story: | psycho terrorhorror movie remadegrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathdrive in classicremadedisturbingbutcheryserial murderbad guymadmancharacters killed one by onebody count …cellarbutchervictimgrindhousepsycholifting someone into the airfalling down stairsmaniacfirst partcharacter's point of view camera shotfirst of seriesstabbed in the chestgood versus evilsubjective camerajailarrestcorpsesurprise endingbare chested maleviolencebloodcigarette smokingdreamblood splattermirrorface slapslow motion scenefalling from heightbeddemonclassroomtelephonefoot chasestrangulationdeath of friendhousecoffeeperson on fireevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youreference to william shakespearecult directorstrong female characterburned aliveelectronic music scoregothichatcrucifixstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementalarm clockvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsledgehammerbreaking through a doorfamous linevillain not really dead clicheplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerhanged boydemonicsevered facestreet in titleboiler roomevil deadserial child killerbroken backfurnacelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent filmblack comedytragedyslasher flicksurvival horrorteen horrorindependent horror |
| Themes: | madnessinsanitypsychopathfearmurderdeathfriendshipkidnappingtortureescapebrutalityparanoiadysfunctional familysadismevil …exploitationpaniccannibalisminheritancenear death experience (See All) |
| Mood: | darknessslasheravant gardeambiguous ending |
| Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyhostageself mutilation …truck driverself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | horror movie remadevictim invited to dinnerpsycho filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killerrotting corpsescreaming in fearscreaming in horrorhouse of horrorsbased on ed geinlifting a female into the airdrive in classicmurder spree …remadebloody violencedisturbingweirdodisturbed individualbutcheryserial murderabandoned houseslashinghuman monsterold dark housebad guymadmancharacters killed one by onebloodbathbody countbutcherskullvictimgrindhousepsychoblockbusterlifting someone into the airmutilationmaniaccross dressingkillingthreatened with a knifefirst partmurderercountrysidefirst of seriesstabbed in the chestcorpsevoice over narrationsurprise endingphotographbloodviolenceknifechasebeatingblood splatterurinationblondecamerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementtied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackproduct placementevil manknocked outskeletonscardeath of brotherhairy chesttragic eventstalkingglassespigtied upchickendirectorial debutgrandmothercult directorcowsplatterfreeze framepickup truckchainsawropegothicgroup of friendsbarnloss of friendcookvandalismbeardhammerspidercovered in bloodproduced by directorhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibalmercilessnessdark humormutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingkilling spreetank toploss of brothermasked killersouthern accentclose up of eyescar troublehysteriayellingface maskminimal castvomithead woundurban legendscene before opening creditsmeatestatetexanfarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newshit with a hammersole survivorpolaroid camerapsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonelifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armdinner tablefrozen bodypocket knifeskincreepybanned filmdead teenagergeneratorstate in titlebonesruralhuman skulltorturergrave diggermidnight moviehensadisticfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hooksummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionfrozen alivedisorientationpower toolbrutalleatherface18 wheelercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumareference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape …rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmslasher flickteen horror |
| Themes: | insanitypsychopathdeathmurderdrugsparanoiaevilabductionalcoholism |
| Mood: | slasherhigh schoolnightmare |
| Locations: | small townschoolelevatorkitchentruck |
| Characters: | slasher killerserial killerterrorsecretaryvillainpolicemanmother son relationshipfamily relationshipspoliceteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boygirl …nursesecurity guardalcoholicmysterious villain (See All) |
| Period: | 1990syear 1998 |
| Story: | psycho terrorpsycho killerfemale victimhomicidal maniacpsychopathic killersadistic psychopathcult favoritelifting an adult into the airmurder spreebloody violenceknife murderserial murderslashingmysterious manbad guy …madmancharacters killed one by onebody countvictimpsycholifting someone into the airbreaking and enteringmaniaccharacter's point of view camera shotmistaken identitystalkerstabbed in the cheststabbed to deathtoiletstabbingcaliforniagood versus evilsubjective camerahallucinationbloodviolencenumber in titlesequelknifechasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighbortelephonedecapitationhalloweenflashlightwinecandleaxeambulancedeath of friendthroat slittingweaponsevered headattempted murderstabbed in the backprologuekeyuniformevil manactor shares first name with characterstalkingreunionflowersplatterheroinesurvivorrageloss of friendhidingfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingaxe murderdivorceesecret identitypumpkinmasked killernewspaper clippinghockeyreflectionstolen caranniversarybeheadingcar troublefire extinguisherreturning character killed offhiding in a closetgatebody baggraphic violencestabbed in the facehiding placemasked villainbutcher knifevillain not really dead clichesittingseventh partmichael myersdead teenagerdoor bellsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chesthead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All) |
Brian Kessler, a journalist researching serial killers, and his photographer girlfriend Carrie set out on a cross-country tour of the sites of the killings. Sharing the ride and their expenses are Early Grayce, a paroled white trash criminal, and his girlfriend Adele. As the trip progresses, Early b …egins to appear more and more unstable, and Brian and Carrie begin to fear that they may have a real-life killer in the back seat of their car. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent film |
| Themes: | insanitypsychopaththeftfeardeathmurderkidnappingrapetorturesadismevilphotographywritingmurder of a police officerrape and murder |
| Mood: | slashergoreneo noir |
| Locations: | moteldesertbarhelicopterroad tripgas stationtexasroad moviesex in a car |
| Characters: | slasher killerserial murdererterrorvillainkillerpoliceboyfriend girlfriend relationshipwriterhostagewaitresschinese foodshooting a police officer |
| Story: | psycho terrorpsycho filmhomicidal maniacpsychopathic killerblack brasadistic psychopathbloody violencedisturbingcrime spreebutcheryserial murderhuman monsterbad guymadmanpsychotic …body countrainstormgash in the facebutchervictimpsychomutilationmaniackillingmurdererstabbed to deathcaliforniaphotographbare chested maleone word titlebloodviolencesexfemale nuditynuditymale nuditymale rear nuditygunfightcigarette smokingtitle spoken by characterpistolshot to deathblood splattercar accidentshot in the chesturinationshot in the headshotgunbare buttbeerdead bodysex standing upgay slurjournalistnarrationjourneyblack pantiesstabbed in the backon the roadevil manautomobilearsontape recorderragestabbed in the stomachrape victimrapistmale underwearrampagerednecktensionstabbed in the throatdark humorbilliardsperversionsexual assaultkilling spreeblack bra and pantiesphysical abusepervertkillpistol whippolice officer shot in the chestsexual violenceknocked unconscioushillbillyyuppietrailer parkwhite trashcactusgraphic violencehit with a shovelintentionally misspelled titlecross countryabusive boyfriendlunaticmass murdererbreaking a bottle over someone's headpittsburgh pennsylvaniasoutherncreeppolicewoman killingserial rapistexposed breastparole officerfemale photographerpolice officer shot in the backyo yogory violencepolice officer shot through the heartgruesomemurder of a policewomandead policewomanheavy pettinghickbrutalsports brapolice officer shot in the leghair stylemale with earringserial rapepolicewoman shottwisted mind (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in … the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensesurvival horror |
| Themes: | madnessmental illnessinsanitypsychopathmurderdeathrevengekidnappingtortureescapeinvestigationangerlonelinessobsessionsadism …evilabductionwritingmurder of a police officerclaustrophobia (See All) |
| Mood: | darknessneo noir |
| Locations: | small townhelicoptersnowwoodswheelchairsnow storm |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillernursewriterhostageshooting a police officermysterious killerbaby killer |
| Story: | psycho killervictim invited to dinnerhomicidal maniacpsychopathic killersadistic psychopathdrive in classicbloody violenceweirdodeeply disturbed personmysterious strangerbutcheryrecluseserial murderslashinghuman monster …old dark housepsychoticbutchervictimpsychomutilationmaniackillingmurdererbasementcharacter's point of view camera shotwomanstabbingsubjective camerasurprise endingone word titlebased on novelviolencebloodgunfighttitle spoken by characterknifebeatingshot to deathcar accidentshot in the chestshotgunrescueslow motion scenecar crashsearchduelattempted murderauthorisolationpigobscene finger gesturetypewritersociopathragecaptivevillainesspsychologydesperationfemale killerbroken legrampagetensionthunderfanfight to the deathmedicationmurder of a childhighwaydark pastnewspaper clippingphysical abuseintimidationnovelfemale psychopathblizzardfemale villainevil womanmatchidolmurderesspsychological torturepsychotronic filmsledgehammervillain not really dead clichecreepscrapbooktauntingbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killercreepychild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backdark and stormy nightbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistfight sceneceramicgrande dame guignolmale victimserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
| Subgenre: | psychological horrorsuspensecult filmparanormal phenomenaitalian horrorchristmas horrorcult classic |
| Themes: | insanitypsychopathfuneraldeathmurdersurrealisminfidelityrapechristmasghostjealousydrinkingdrunkennessinvestigationanger …corruptiondeath of fatherbrutalityparanoiablackmailillnesssadismhome invasiontheatrepanicdyingtraumaclaustrophobiachristmas past (See All) |
| Mood: | darknessslashergorenight |
| Locations: | police carbathtubhospitalbarrestaurantschoolcarcemeterybicyclewaterelevatorkitchenwheelchairaustraliapolice station …cityitalytruck (See All) |
| Characters: | slasher killerserial murdererserial killerterrorpsychiatristvillainkillerpolicemanmother son relationshiphomosexualfather son relationshippolicefather daughter relationshipboyfriend girlfriend relationship …doctorsingerboygirlmusicianactressmaidprofessorjewgermangay friendmysterious villainself pity (See All) |
| Period: | 1970s |
| Story: | grindhouse filmfemale victimhomicidal maniacdead woman on floorpsychopathic killerdead woman with eyes opensadistic psychopathold womancult favoritemutilated bodycarrying a dead bodydrive in classicmurder spreedisturbingdeeply disturbed person …curtainbutcherysilhouettefamous scoreserial murderslashingtwist endinghuman monstermysterious mancharacters killed one by onepsychoticbody countbutcherdriving a carvictimgrindhousebreaking and enteringmaniackillingmurdererbasementtrapwitnessbirdstabbed to deathstabbingnewspapersubjective camerahallucinationbathroomsecretcorpsetelephone callsurprise endingphotographviolenceflashbackbloodtwo word titlegunkisscigarette smokingsingingknifechasefiresongshootoutbeatingblood splattermirrorface slapwatching tvcameradrinkshootingpaintingbookvomitingrunningdead bodycafeneighborpianocolor in titlerevolvertelevisiontelephonereporterdecapitationsurvivalgay slurbedroomflashlightjournalistbandold manstrangulationaxeimpalementdinerhousejokebrunettedrivingsevered headdrawinghit by a carsearchgraveyardnecklacedrowningpainattempted murderlibraryvirgindangerstabbed in the backprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatdarksuspicioncult directorpsychiceuropearsonrecord playertv newsfireplacedesirestreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpastmercilessnessstabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementdark pastfemale reportergay stereotypeliving roomkilling spreevoodoolightplaying pianotelepathycrowclose up of eyesdead girldrumsapparitiondark secretkillgloveslong hairmen's bathroomfencestaircasejazz musicskirtstreet markettelevision newslizardbitternessfemale psychopathwhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headfemale villainhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueevil womanextreme violencemacabrepsychic powerbourgeoisiegraphic violencedeskmenacemurderesssilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodpsychotronic filmhouse firehouse on fireclose up of eyefingerprinthatchetsecret roomlebanonwater fountainloss of controlmystery killerengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionfemale serial killerchild's drawingexposed breastraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dollhearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincibad girlcleavercognacmad womanmelting facegruesomenewsroomsplit headfireplace pokertromboneskylightlocked upunknown killerattacked from behindknife in backforeignparapsychologyproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallhot waterknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent filmsupernaturalparanormal phenomenaslasher flickcanadian horror |
| Themes: | insanitypsychopathfearmurderdeathrevengesuicidekidnappingghosttorturedrunkennessdeath of fatherbrutalitysupernatural powerdeath of mother …evilabductiontraumafear of water (See All) |
| Mood: | breaking the fourth wallslasherraingorehigh schoolnightmareblood and gore |
| Locations: | small townforestcemeterypolice stationlakeschool nurse |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillermother son relationshipfather son relationshipfather daughter relationshipboyfriend girlfriend relationshipteenage girlteenage boyzombielittle girl …mysterious villain (See All) |
| Period: | 2000s |
| Story: | psycho terrorpsycho killerpsycho filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathslashed to deathmurder spreebloody violencebutcherydomineering motherserial murderslashingmysterious man …bad guymadmancharacters killed one by onebody countbutchervictimpsycholifting someone into the airmutilationmaniackillingmurderercharacter's point of view camera shotstabbingcorpsevoice over narrationshowersurprise endingphotographflashbackviolencebloodcharacter name in titlesequelexplosionpartypistolfiredreamblood splatterslow motion scenebrawlfalling from heightmaskcar crashdemondecapitationfoot chaseimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingpremarital sexcabinsevered armdismembermentundeadsplatterchild murderburned aliveheroinemass murdermachetecomaragesevered handgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterdemonic possessionkilling spreegeekburned to deathmasked killernewspaper clippingtorso cut in halfblood on camera lensbeheadingfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencestonerflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villaindeformitypsychotronic filmbreaking through a doormass murderervillain not really dead clicheghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partmidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormalindependent horror |
| Themes: | insanitypsychopathmurderdeathsurrealismdrugsghosttorturesupernatural powerdeath of mothersadismevilamnesia |
| Mood: | darknessslasherraingorehigh schoolnightmare |
| Locations: | small townairplaneroad trip |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherself mutilationyounger version of characterdeafnessgerman american …evil father (See All) |
| Period: | 1960s1990s1970s1940s1950s |
| Story: | phone boothpsycho terrorpsycho killerhomicidal maniacvillain played by lead actorpsychopathic killersadistic psychopathdrive in classicmurder spreedisturbingbloody violencebutcherysleeping in a carserial murderhuman monster …bad guymadmanpsychoticbody countbutchervictimpsychomutilationfalling down stairsmaniackillingmurdererstabbed in the chestgood versus evilsubjective camerabare chested maleflashbackviolencebloodf ratedcharacter name in titlesequeltitle spoken by characterknifefirepunctuation in titletitle directed by femaledreamblood splatterrescueslow motion scenefalling from heightapostrophe in titledemoncriminalstrangulationimpalementboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodyundeadchild murderburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragekicked in the stomachtherapistorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreenewspaper clippingposterhit with a baseball batmarijuana jointstabbed in the handmolotov cocktailkillohiochild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagkiller childsixth partclawfamily mandeath of title characterlunaticanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymanburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
| Subgenre: | suspensecult filmindependent filmslasher flickaustralian horrorsadistic horror |
| Themes: | insanitypsychopathfearmurderdeathkidnappingrapedrinkingtorturedrunkennessescapebrutalitysadismevilabduction …exploitationcruelty (See All) |
| Mood: | darknessslashergorecar chasenightblood and gore |
| Locations: | desertbarbeachrestaurantswimming poolcarhelicopterairplaneaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All) |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshipdoctorsingerhostageaustralianself mutilationmysterious villainmysterious killer |
| Period: | year 1999 |
| Story: | psycho terrorpsycho killergrindhouse filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathrotting corpsescreaming in fearslashed to deathmurder spreebloody violenceknife murderdeeply disturbed persondisturbed individual …butcheryserial murderslashinghuman monstermysterious manbad guymadmancharacters killed one by onebloodbathbody countrainstormbutchervictimpsychomutilationmaniackillingfirst partmurderercountrysidestabbed to deathstabbingvoyeurbathroomcorpsephotographbloodviolencedogtwo word titlegunkisscigarette smokingtitle spoken by characterexplosionsingingpartyknifechasebased on true storysongshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafeguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo cameraimpalementfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuittragic eventautomobileisolationpigobscene finger gesturedismembermentufogaragepickup truckwolfwoundtouristscene during opening creditsloss of friendcaptivedesperationflatulencestrangerhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassfallblood on shirtperversionslaughtercapturecliffminetied feetopening a doorsexual assaultkilling spreedrugged drinkreflectionpervertbarking dogcar troublecrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmsydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootwaking upsole survivorkangaroocar rollovermass murdererdriving at nightvillain not really dead clicheexploitation filmsoutherncaptivitycreepguard dogends with texttauntingcaged animalcamperserial rapisteclipsedecomposing bodydesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyhunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a cargun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmparanormal phenomenaslasher flickteen horror |
| Themes: | psychopathdeathmurderrevengemonstersupernatural powerevildrug addictionmurder of a police officer |
| Mood: | slasherraingorehigh school |
| Locations: | new york cityboatwoodsseacityamericasewer |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenage girlteenage boyzombiepolice officerteacher student relationshipmysterious villain |
| Period: | 1980s |
| Story: | psycho terrorpsycho killerhomicidal maniacmurder of a nude womanpsychopathic killerblack brasadistic psychopathmutilated bodylifting a female into the airmurder spreeknife murderbutcheryserial murderbad guymadman …characters killed one by onebody countbutcherpsycholifting someone into the airmutilationmaniaccharacter's point of view camera shotstabbed to deathstabbinghallucinationbare chested maleviolencebloodfemale nuditycharacter name in titlenumber in titlesequelexplosionpantiesblood splattermirrornumbered sequeldemonguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationaxevideo camerathroat slittingimpalementsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadhypodermic needleback from the deadmasked manmale underwearrampagenew jerseydead childdisembowelmentslaughterstabbed in the eyesequel to cult favoritemasked killerbeheadingsummer campaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villaintoxic wastedeformitylunaticmetrooff screen murdermass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masktwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
| Subgenre: | psycho thrillersuspensesupernaturalparanormal |
| Themes: | unrequited lovemental illnessinsanitypsychopathfearmarriagedeathmurdersuicidekidnappingrapeghostprisontortureescape …memorysupernatural powerparanoiadrug usesurveillanceevilpanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All) |
| Mood: | darknessslasherraingoreneo noirnightmare |
| Locations: | police carbathtubhospitalswimming poolcartaxipolice station |
| Characters: | slasher killerserial murdererserial killerterrorsheriffpsychiatristvillainkillerpolicemanmother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationship …doctortattoofemale protagonistnurselawyerreference to godsecurity guardself mutilationdoctor patient relationshipstepfather stepdaughter relationshipself immolationself cuttingsuicide by jumping off a bridge (See All) |
| Story: | psycho terrorpsycho killerpsycho filmfemale victimhomicidal maniacpsychopathic killersadistic psychopathbloody violencedisturbinghearing voicesserial murderslashingbad guymadmannervous breakdown …cellardeath threatrainstormpsychomaniackillingmurdererwomansubjective camerahallucinationcorpsetelephone callshowersurprise endingphotographbare chested maleinterviewflashbackbloodviolencesexfemale nudityf ratedfemale frontal nuditygunkissfightexplosionknifechasepistolfirecryingcell phonedreamblood splattercar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashreporterswimmingsurvivalfoot chaseflashlightaxevideo camerathroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandtrusttherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathundermental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencefemale doctoraxe murderkilling spreereckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapemental patientelectricitykillmental breakdownblackoutsatanismblood stainspreadeagledeniallistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmateman on firetrapdoorpurgatoryprophetelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gownbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those …friends. (Read More)
| Subgenre: | american horrorcult filmslasher flick |
| Themes: | psychopathdeathmurderabductionexploitation |
| Mood: | darknessslashergore |
| Locations: | lake |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerteenagerboyfriend girlfriend relationshipteenage girlteenage boylow self esteemmysterious killer |
| Period: | 1980s |
| Story: | psycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathcult favoritedrive in classicmurder spreedisturbingdisturbed individualcrime spreefamous scoreserial murderslashinghuman monster …bad guymadmancharacters killed one by onegrindhousepsycholifting someone into the airmaniacmurderercharacter's point of view camera shotsubjective camerashowerbloodsexnuditynumber in titlesequeldigit in titlebikinimasknumbered sequelaxeimpalementthird partevil mancabinsevered armdismembermentsplattermass murdermacheteragebarnroman numeral in titlesevered handmasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyesequel to cult favoritekilling spreemasked killertorso cut in halfcar troubledefecationsexual violenceshot in the eyehillbillyeyeballhammockextreme violencemasked villainknittingpitchforksole survivordeformitypsychotronic filmbiker gangmass murdererlifting female in airsliced in twopregnant woman murdered3 ddate in titlehockey maskgiallo esquesequel to cult filmyo yoskull crushinggory violenceeast coastgruesomejason voorheesdorkfriday the thirteenthserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | american horrorcult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | psychopathvoyeurismfearmurderdeathfriendshiprevengesurrealismkidnappingghostescapemonsterbrutalitysupernatural powerparanoia …sadismevilpanicmysterious deathshower murder (See All) |
| Mood: | darknessslasherraingorehigh schoolnightmarepoetic justice |
| Locations: | desertsmall townbarschoolswimming poolbusbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerpolicemanfriendmother son relationshipfamily relationshipshusband wife relationshiphomosexualfather son relationshipfather daughter relationship …teenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteachergirlstudentlittle girlself mutilationdrivergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathslashed to deathdrive in classicmurder spreetalking to oneselfidentity crisismurder suspectbutcheryhearing voicessplit personality …serial murderslashingbad guymadmanbody countcellarrainstormgash in the facebutchergrindhousepsycholifting someone into the airlooking at oneself in a mirrormutilationmaniacthreatened with a knifemurdererbasementscreamcharacter's point of view camera shotbirdstabbed in the cheststabbed to deathstabbingsubjective cameravoyeurhallucinationundressingunderweartelephone callshowersurprise endingbare chested malebloodviolencecharacter name in titlenuditynumber in titlemale nuditysequelmale rear nuditybondagedogfightcigarette smokingpartyknifechasefirecryingdreamdigit in titleblood splatterface slapshotgunslow motion scenewatching tvbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonclassroomcriminalf wordfoot chasename in titlemassacrebasketballimpalementfootballsnakeapologydream sequencechild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firepossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodyratcharacter says i love youclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlistening to musicjoggingmousestabbed in the stomachbarefoot malevisitcovered in bloodsadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkingescape attempthit on the headmurder of a childdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefskilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbarking doghigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankbroken mirrorbus stopburnt facepush upsnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving incrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonepsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injurydomineering fatherno endingglovecaged animalcrying maleshower roomwagonboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower planthorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmblack comedydark comedysurvival horror |
| Themes: | mental illnessinsanitypsychopathdeceptionmurderdeathkidnappingincestsadismevilhome invasiongreedcannibalismwealthstarvation …claustrophobia (See All) |
| Mood: | darknessslashergoresatiresocial satire |
| Locations: | los angeles californiaslum |
| Characters: | terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog |
| Period: | 1990s |
| Story: | psycho terrorpsycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathhouse of horrorsmutilated bodyinsanedragging a dead bodymurder spreedeeply disturbed persondisturbed individualserial murderslashing …human monsterold dark housebad guymadmanbody countcellarskullgrindhousepsychomutilationbreaking and enteringfalling down stairsmaniacbasementsecretcorpsebloodviolencedogcigarette smokingtitle spoken by characterknifepistolshot to deathblood splattershot in the chestface slapshotgunbirthdayflashlightmansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletoncharacter says i love youcult directorterminal illnessfireplacekilling an animalgothicscene during opening creditsragestabbed in the stomachspidersevered handsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boylasersightlandlordgothperverthiding in a closetschemeevictionlighterfemale psychopathclimbing through a windowanimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a manstarvingmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacesickoabused childbad girlpitbullmute childtenementhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedcrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
| Subgenre: | american horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horrorurban fantasy |
| Themes: | insanitypsychopathfeardeathmurderfriendshiprapeghostpregnancymonsterinvestigationbrutalitysupernatural powerdepressionsadism …eviltrauma (See All) |
| Mood: | slashergorenightmare |
| Locations: | churchhospitalswimming poolcarmotorcyclewatercar on firedeath in a car accident |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfriendmother son relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanboyfriend girlfriend relationshipdoctor …boyfemale protagonistgirlnursebabyartistreference to godlittle girlsingle motherwaitresslittle boyalcoholicfathercrying babyalcoholic fatherpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
| Period: | 1980s1940s |
| Story: | psycho terrorpsycho killervictim invited to dinnerpsycho filmgrindhouse filmhomicidal maniacvillain played by lead actorpsychopathic killersadistic psychopathslashed to deathmutilated bodylifting a female into the airdrive in classicmurder spreebloody violence …domineering motherserial murderslashingmysterious manbad guymadmancharacters killed one by onedead motherpsychoticbody countvictimlifting someone into the airmutilationfaintingfalling down stairsmaniackillingmurdererscreamstabbingdisguisegood versus evilhallucinationtelephone callshowersurprise endingphotographbare chested maleviolencebloodflashbacksexfemale nudityf ratednuditybare breastssequelgunfemale rear nuditypartyknifechasepistoltopless female nuditycryingdreamblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonfoot chaseflashlightambulancedeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manskeletonstalkingautomobilepremarital sexsevered armhaunted housedismembermentredheadundeadsplatterfreeze framewaiterteen angstwarehousemass murderbeer drinkinggay charactercomic bookmutantloss of friendspidercrying womanskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalegay stereotypeasylumfifth partkilling spreenewspaper clippingmale objectificationtaking a showergiving birthmental patienttaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerpsychotronic filmwet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someoneplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymanhorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketcharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
This stylish Brian De Palma thriller plays off the theme of the unsuspecting witness who discovers a crime and is thereby put in grave danger, but with a novel twist. Jack Terry is a master sound recordist who works on grade-B horror movies. Late one evening, he is recording sounds for use in his mo …vies when he hears something unexpected through his sound equipment and records it. Curiosity gets the better of him when the media become involved, and he begins to unravel the pieces of a nefarious conspiracy. As he struggles to survive against his shadowy enemies and expose the truth, he does not know whom he can trust. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmconspiracyb horrorpolitical thrillerpolitical conspiracy |
| Themes: | guiltpsychopathdeathmurderpoliticstorturefilmmakinginvestigationparanoiasadismsurveillanceevilexploitationtechnologyclaustrophobia |
| Mood: | slasherneo noirnight |
| Locations: | car in waterhospitaltrainsnowcityrooftoptrain stationpennsylvania |
| Characters: | slasher killerserial murdererserial killervillainkillerdoctorprostitutedetectivephotographerhitmanmurder of a prostitute |
| Period: | 1980swinter |
| Story: | phone boothpsycho killerpsycho filmgrindhouse filmfemale victimhomicidal maniacpsychopathic killerdead woman with eyes opensadistic psychopathdrive in classicmurder spreedisturbingdisturbed individualserial murderslashing …bad guymadmancharacters killed one by onepsychoticbody countvictimgrindhousepsychomutilationmaniackillingmurdererwitnessstabbed to deathdisguisevoyeurshowersurprise endingbare chested maleflashbackfemale nuditynuditybare breastsfemale frontal nuditytwo word titleguntitle spoken by characterknifechasewoman on topcar accidenturinationrescuewatching tvlingeriealcoholtelephonereportercleavageassassinbridgepoliticiansubwayassassinationunderwater scenegunshotpoint of viewscreamingpay phonecover upevil manattempted rapehairy chesttragic eventsplit screenfilm within a filmfireworkscult directorgraffititrusttape recorderrecordingcaught having sexcrying womanmovie theaterfrogparadedead womanmale underwearwatching televisionrampagewoman in jeopardydamsel in distressveteranslaughtermustachephiladelphia pennsylvanialonerbriefskilling spreereckless drivingpolitical corruptionfilm industryinterrupted sextruthsubway stationtelevision newsblackoutmotel roomrestroomgovernortv reporterwhodunitcarnageemergency roomwhite briefspresidential electionwoman in lingerienewscasthitchcockiantragic endingpresidential candidateenigmastrangled to deathtapepsychotronic filmtelevision reporterbroken bottlewiretappingsoundslow motion action scenesubway trainundershirtgovernment corruptionpolitical assassinationwoman in showereye witnesspayphonemedia manipulationgarroterainy nightcreepyred lighttirewoman strangled to deathaudio tapereconstructiontorturerdead prostitutegiallo esquesadisticaudio recordingwearing a sound wirefish marketspying on couple having sexelectronicscold blooded murdernews broadcasteast coastwoman in perilmilitary veteranpolitical cover upice pickfilm businesswiretap360 degree panscreening roomanonymous telephone callimplied fellatiophone tapreference to benjamin franklinspying on someonebody mutilationsorority housepoint of view shotsteadicampaying for sexincriminating photographsound effectunwanted sexual advancesweeping womanbird's eye shotsound manediting roomfemale victimswearing a wiretelephone repairmancar off bridgeprojection roomsound engineersound effectscondescensionroman a clefnoisesoral sex in publicstreet prostituteblow outsound recordiststabbed with an ice picktire blow outhit on the head with a bottlereference to the zapruder filmsound equipmentyellsound mixingfoley artistliberty bellmurder in bathroomover dubbingartistic creationphiladelphiathe media (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
| Subgenre: | american horrorsuspenseindependent filmindependent horrorsadistic horrorslasher horrorhorror b movie |
| Themes: | insanitypsychopathmoneymurderdeathtortureescapebrutalitysadismevilhome invasionexploitationcrueltymurder of a police officer |
| Mood: | slashergorenightblood and gore |
| Locations: | strip clubtrying to escape |
| Characters: | serial killerterrorvillainkillerthiefhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlhostageself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All) |
| Story: | psycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathslashed to deathmutilated bodymurder spreedeeply disturbed personcrime spreebutcheryserial murderslashinghuman monstermysterious man …bad guycharacters killed one by onebloodbathpsychoticbody countgash in the facebutchervictimpsycholooking at oneself in a mirrormutilationfalling down stairsmaniacthreatened with a knifefirst parttrapscreamstabbed in the cheststabbed to deathstabbinggood versus evilcorpsesurprise endingflashbackviolencebloodfemale nuditycharacter name in titlebare breastsfemale frontal nuditytwo word titlefightcigarette smokingnipplesknifelesbian kisspistolbeatingblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffssurvivalfoot chasegay slurflashlightimpalementhousetied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manactor shares first name with characterisolationneck breakingex convictblood spattercrime bosskilling an animaltape recorderhammerhidingspiderdesperationcovered in bloodteddy bearhomeanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnesspsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyeboxmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirewifestabbed in the handset upconstruction workerpistol whiplightervery little dialogueacidclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelpsychotronic filmcut handhouse on firedragging a bodyviolent deathex wifeexploitation filmcaptivityclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiredead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane mandisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
| Subgenre: | american horrorcult filmindependent filmslasher flickteen horror |
| Themes: | psychopathdeceptionfeardeathmurderrevengesurveillanceevilmurder of a police officer |
| Mood: | slashergoresatire |
| Locations: | forestwoodskitchenwheelchairrooftopfire truck |
| Characters: | slasher killerserial killerpsychiatristvillainkillerteenage girlteenage boynursesecurity guardcoroner |
| Period: | 2000s |
| Story: | homicidal maniacpsychopathic killerblack brasadistic psychopathlifting a female into the aircrime spreepeep holeserial murderabandoned househuman monsterold dark housebad guycharacters killed one by onebody countrainstorm …skulllifting someone into the airmaniackillingthreatened with a knifemurderercharacter's point of view camera shotstabbed in the cheststabbed to deathgood versus evilsubjective cameraundressingcorpsesurprise endingflashbackbloodviolencefemale nuditysequeltwo word titlefightknifechasefirecell phoneblood splatterfistfightmirrorwatching tvcomputercamerabrawlfalling from heightmaskshowdownf worddecapitationhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementinternetsevered headpolice officer killednews reportstabbed in the backelectrocutionproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingsevered armobscene finger gesturechainsawheavy rainsecurity cameraloss of loved onemorguefatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the heade mailraised middle fingergasolineaxe murdercasual sexsequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancereturning character killed offhiding in a closetwebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firelocked in a roombreaking through a doorstupid victimbreaking a mirrorx rayed skeletonsecret roomleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing … so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)
| Subgenre: | psycho thrilleramerican horrorblack comedysupernatural |
| Themes: | psychopathdeathsupernatural powerevil |
| Mood: | slasherraingorecar chase |
| Locations: | chicago illinoisschool buswater gun |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshippoliceboyteachernew student |
| Period: | 1990s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathfalse accusation of murderbloody violencebutcherybad guymadmanbody countbutcherpsycholifting someone into the air …falling down stairsmaniacthreatened with a knifemurdererbasementstabbed in the cheststabbed to deathcorpsebloodsequelcigarette smokingsingingpunctuation in titledigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancethroat slittingtied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandneck breakingobscene finger gestureburned alivegothictied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murdersuffocationhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a beddigging a gravelocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All) |
Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession …escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)
| Themes: | unrequited loveinsanitypsychopathfearmurderdeathtorturelonelinessbrutalityobsessiondepressiondrug usesadismphotographychildhood trauma …psychological trauma (See All) |
| Mood: | slashergoreneo noir |
| Locations: | restaurantlos angeles californiasex in public |
| Characters: | serial killerterrorvillainkillermother son relationshiphomosexualtattooprostitutephotographermysterious villain |
| Period: | 1980s2010s |
| Story: | female victimvillain played by lead actormurder of a nude womanpsychopathic killerdead woman with eyes openbased on ed geinmurder spreeknife murderdisturbed individualserial murderslashinghuman monsterbad guynervous breakdownapartment building …victimlooking at oneself in a mirrormaniacthreatened with a knifestabbed in the cheststabbed to deathsubjective cameravoyeurhallucinationbathroomcorpsephotographone word titleviolenceflashbackbloodthreesomefemale rear nudityknifecell phoneblood splatterurinationremakecomputercameravomitingcar crashneighborfoot chasebound and gaggedwinestrangulationcocainesubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialoguestabbed in the backevil mankicked in the facetragic eventstalkingsevered armdismembermentscene during opening creditsragemovie theaterart galleryschizophreniarampagepillsrejectiondeath of protagonistdisembowelmentwedding dressdark pasttied feetsevered legmisogynymannequinwoman in bathtubsuffocationconfusionstabbed in the handhiding in a closetsubway stationsexual perversionbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootstrangled to deathschizophrenicbreaking through a dooronline datingbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation |
| Themes: | insanitypsychopathfuneraldeathmurderghostmonstersupernatural powersadismevil |
| Mood: | slashergorenightmare |
| Locations: | churchbarcemeteryschool boy |
| Characters: | slasher killerserial murdererserial killerterrorpsychiatristvillainkillerfather daughter relationshipteenagermother daughter relationshipdoctornursetough guylittle girlsingle mother …self mutilationalcoholic fatherevil nurse (See All) |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathlifting a female into the airdrive in classicbad mothermurder spreedisturbingbloody violencebutcheryserial murderabandoned houseslashingbad guy …madmancharacters killed one by onebody countbutchervictimlifting someone into the airfalling down stairsmaniackillingmurdererbasementstabbed in the cheststabbed to deathstabbingnewspaperbathroomcorpsesurprise endingbare chested maleviolencefemale nuditynumber in titlesequelbondagecigarette smokingfiredreamdigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicnumbered sequeldemondecapitationfoot chasedeath of friendimpalementsuicide attemptnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationcharacter says i love youundeadsplatterteen angstelectronic music scorecomaragetied to a bedcrucifixback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyekilling spreepajamassmokealleyreturning character killed offohioevil spiritstabbed in the armgroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriestelevision setdigging a gravemattressgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerboneshanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymansexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
In the green woods of Silver Falls, Oregon, Aaron Hallam, a trained assassin AWOL from the Special Forces, keeps his own brand of wildlife vigil. After Hallam brutally slew four deer hunters in the area, FBI Special Agent Abby Durrell turns to L.T. Bonham-- the one man who may be able to stop him. A …t first L.T. resists the mission. Snug in retirement, he's closed off to his past, the years he spent in the Special Forces training soldiers to become skilled killers. But when he realizes that these recent slaying is the work of a man he trained, he feels obligated to stop him. Accepting the assignment under the condition that he works alone, L.T. enters the woods, unarmed--plagued by memories of his best student and riddled with guilt for not responding to Aaron's tortured letters to him as he began to slip over the edge of sanity. Furious as he is with his former mentor for ignoring his pleas for help, Aaron knows that he and L.T. share a tragic bond that is unbreakable. And, even as they go into their final combat against each other, neither can say with certainty who is the hunted and who is the hunter. (Read More)
| Subgenre: | psycho thrilleramerican horrorsuspensemartial arts |
| Themes: | guiltpsychopathdeathmurderescapelonelinessevilhunting |
| Mood: | slashergorenightmarecar chaseblood and gore |
| Locations: | barforesthelicoptersnowbicyclewoodssewer |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillertough guysniperex boyfriend ex girlfriend relationshipsniper riflepolice chaseex soldierolder man younger man relationship |
| Period: | 1990s2000s |
| Story: | psycho terrorpsycho killerpsycho filmhomicidal maniacpsychopathic killersadistic psychopathmurder spreedisturbingbloody violenceknife murderdeeply disturbed persondisturbed individualcrime spreebutcheryserial murder …slashinghuman monsterbad guymadmancharacters killed one by onebody countbutchervictimpsychomutilationmaniackillingmurdererstabbed in the cheststabbingcorpseflashbackbloodviolenceknifechasepistolshootoutshot to deathblood splatterfistfightmachine guncar accidentshot in the headcatgunfightbrawlfalling from heightvomitingshowdownhand to hand combathandcuffsrivercombatshot in the backf wordswimmingstrangulationmassacredeath of friendthroat slittingbridgeimpalementone man armypolice officer killedshot in the foreheadduelkaratefbifugitiveevil mancabinwaterfallsevered armobscene finger gesturedismembermentsubtitled scenewolfstabbed in the stomachhunterswat teamhonorcrime scenehaunted by the pastu.s. armystabbed in the throatmanhuntpost traumatic stress disorderspecial forcesstabbed in the legbooby trapknife fightcommandoslaughtercaptureknife throwingdark pastwar veteransevered legkilling spreefountainpostcardstabbed in the armyugoslaviamilitary uniformsole black character dies clicheextreme violenceoregongraphic violencestabbed in the facemilitary trainingmass graveportland oregonsevered foothoodauto theftjumping off a bridgebritish columbiapacific northwestkosovobalkanbiblical quoteanimal trapgory violencetrackingsurvivalistbloody spraygruesomebasic trainingbody partsethnic cleansingdart gunskate parkbrutalnaturistrogue soldierwar buddyarrowheadyugoslavian army (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | suspensecult filmindependent filmcoming of ageconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | unrequited lovevoyeurismdeceptionfearmurderdeathfriendshipsurrealismdrunkennessescapedancebrutalitysupernatural powerparanoiaillness …sadismevilcrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | darknessslasherraingorenightavant gardestylization |
| Locations: | schoolswimming poolforesttaxiairportwoodsapartmentgermanytaxi driver |
| Characters: | psychiatristkillersister sister relationshipfriendteenagerdoctorboyteenage girlfemale protagonistteachergirlpolice officerstudentprofessorwitch …germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | grindhouse filmpsychopathic killerdead woman with eyes openrotting corpsedrive in classicremadebloody violenceknife murderfade to blacksilhouettehearing voicesslashingrainstormvictimgrindhouse …looking at oneself in a mirrorfaintingkillingthreatened with a knifefirst partmurderermissing personscreamcharacter's point of view camera shotstabbed in the cheststabbed to deathtoiletwomanstabbinggood versus evilsubjective cameravoyeurhallucinationbathroomsecretcorpsevoice over narrationtelephone callsurprise endingone word titleviolenceflashbackblooddogcigarette smokingdancingexplosionknifechasefireblood splatterslow motion scenefalling from heightshowdownpianodemontelephoneswimmingfoot chasewineambushstrangulationdeath of friendthroat slittingimpalementcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcover upcollege studentlightninghangingdisappearanceinjectionsuspicionballetcult directorpubeuropeitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy raincookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the enddisfigurementnotedressing roomblind manopening a doorroomlightbatpiano playerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowsleepschool principalwhisperingwormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotcoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on fireanimal killingghoulglowing eyesnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
A film about two homicide detectives' ('Morgan Freeman (I)' (qv) and ('Brad Pitt' (qv) desperate hunt for a serial killer who justifies his crimes as absolution for the world's ignorance of the Seven Deadly Sins. The movie takes us from the tortured remains of one victim to the next as the sociopath …ic "John Doe" ('Kevin Spacey' (qv)) sermonizes to Detectives Somerset and Mills -- one sin at a time. The sin of Gluttony comes first and the murderer's terrible capacity is graphically demonstrated in the dark and subdued tones characteristic of film noir. The seasoned and cultured but jaded Somerset researches the Seven Deadly Sins in an effort to understand the killer's modus operandi while the bright but green and impulsive Detective Mills (Pitt) scoffs at his efforts to get inside the mind of a killer... (Read More)
| Subgenre: | psycho thrilleramerican horrorcult filmtragedy |
| Themes: | insanitypsychopathmurderdeathrevengerapereligionjealousytortureinvestigationangerevilgreedmurder investigation |
| Mood: | slasherraingoreneo noir |
| Locations: | deserthospitalbarhelicopternightclubtaxiurban settingapartmentpolice stationrooftopbrothel |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerhusband wife relationshippoliceprostituteteacherdetectivephotographerlawyerinterracial relationshiplust …security guardpolice detectivebiblepolice shootoutpimppregnant womanself mutilationcoronersuicide by cop (See All) |
| Story: | psycho terrorvictim invited to dinnerhomicidal maniacpsychopathic killersadistic psychopathmurder spreedisturbingcrime spreestairwellserial murderhuman monsterbad guymadmanbody countvictim …psychoblockbustermutilationmaniackillingmurdererarrestcorpsesurprise endingphotographbare chested maleone word titleinterviewbloodviolencenumber in titledogtitle spoken by characterchasepantiespistolshootoutdigit in titleshot to deathblood splattercar accidentshot in the headshotgunheld at gunpointinterrogationprostitutionhandcuffsrevolvercriminaldecapitationfoot chasegay slurflashlightambulancedinersubwaywhite pantiessevered headscantily clad femalehit by a carnews reportshot in the foreheadattempted murderlibraryevil mansadnesstied uptypewriterfreeze framegirl in pantiestv newscard gamepokergothictape recordersociopathtied to a bedfbi agentcrucifixloss of wifeswat teamsevered handrapistswitchbladeobesitypedophileprideautopsybulletproof vestdisfigurementknife throwingboxkilling spreeage differencedead dogalleycartoon on tvkillspiral staircasecockroachinformanturban decayenvypolice captaindistrict attorneyoffscreen killingscene of the crimewrathrazor bladefashion modelcluedarkroomtwo way mirrorhomeless personhitchcockianintentionally misspelled titlepsychological torturespaghettibarbershopmass murdererinnocent person killedpolice partnerjumping from a rooftopwriting in bloodel trainswatpolice protagonistbreaking down a doorcreepysleeping pillsreference to ernest hemingwayfingerprintstorturerreference to jack the ripperforced suicidegluttonywearing a sound wirenumber as titlemetronomeseven deadly sinstenementslothmixed alpha numeric titleabandoned apartmentnumber 7 in titleplea bargaindart boardbad guy winshyperventilationstar wars referencecredits rolling downphoto laburban gothicdelivery serviceblack detectivereference to jodie fosterair freshenerbody shavingface bandageforced eatingreference to geoffrey chaucerreference to marquis de sadereference to st. thomas aquinas (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
| Subgenre: | psycho thrillerslasher flick |
| Themes: | psychopathdeathmurderrevengetorturedrunkennessbrutalitydeath of motherevilmurder of a police officer |
| Mood: | darknessslashergorehorror movie remake |
| Locations: | police carbathtubforestmotorcycleboatbicyclewaterwoodslakecampfiretunnelschool busbackwoodssex in a tent |
| Characters: | serial murdererterrorsheriffvillainkillerafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlasian americanmysterious villainblonde girlgirl nudity |
| Period: | 1980s |
| Story: | psycho terrorpsycho killershower curtainfemale victimhomicidal maniacvillain played by lead actorpsychopathic killerbra removingsadistic psychopathmutilated bodyinsaneknife murderweirdosilhouettedisposing of a dead body …serial murderabandoned houseslashinghuman monsterbad guycharacters killed one by onepsychoticbody countpsychomutilationmaniacmissing personstalkerstabbed in the cheststabbed to deathwomanstabbingbrahallucinationcorpsetelephone callsurprise endingbare chested maleviolencebloodfemale nuditynuditynumber in titlebare breastsfemale frontal nuditymasturbationdogsex scenefemale rear nuditynippleschasepistolfiretopless female nuditywoman on topdigit in titleblood splatterurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanaalcoholswimmingdecapitationflashlightcandlestrangulationtoplessaxemassacrevideo cameradeath of friendthroat slittingimpalementsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstabbed in the backprologuescreamingmini skirtmoaningtentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditscaptivewalkie talkiebuttockscampcovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyeaxe murdersevered legarrowburned to deathmasked killermannequinplantbeheadingporn magazinestabbed in the handbongcanoestaircaserear nudityshot with an arrowfemale psychopathloud sexno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichegraphic violenceopen endedcheating boyfriendmurderessmasked villainspitting blooddeformitytelevision setpool of bloodold housenakedstupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmfemale serial killerscrewdrivernaked buttwoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien …d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)
| Subgenre: | american horrorsuspensecult filmindependent filmmartial artsblack comedysupernaturalparanormal |
| Themes: | psychopathfuneralmurderrevengesupernatural powerevil |
| Mood: | slasherraingorehigh schoolnightmare |
| Locations: | small townhospitalbeachcemeteryelevatorschool nurseblood in water |
| Characters: | slasher killerserial murdererserial killerterrorvillainkillerfriendfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshiptough guylittle girl …waitress (See All) |
| Period: | 1980s |
| Story: | psycho killerhomicidal maniacvillain played by lead actorpsychopathic killersadistic psychopathdrive in classicmurder spreedisturbingbutcheryserial murderslashingold dark housebad guybutcherlifting someone into the air …mutilationmaniackillingmurdererwidowerstabbed in the cheststabbed to deathcorpsesurprise endingphotographbare chested malebloodnumber in titlesequelfemale frontal nuditydogcigarette smokingfiredreamdigit in titleblood splatterurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinersevered headcoffincharacter repeating someone else's dialoguelocker roomperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesunderwatersevered armsleepingundeadpizzasurgeryteen angstelectronic music scoreslow motionwoman with glassesstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreereturning character killed offneedlejunkyardohiodefecationcockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chesttorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotleserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | cult filmindependent filmdark comedyslasher flickcreature featuresadistic horror |
| Themes: | madnessmental illnessinsanitytheftfuneralfeardeathmurdersurrealismkidnappingrapejealousytorturemonsterseduction …death of fathersadismtheatrecannibalismmurder of a police officer (See All) |
| Mood: | slasherraingorenightmare |
| Locations: | police carcemeteryroad tripcavegas stationmuseumtunnelshedcave in |
| Characters: | slasher killerserial killersheriffthieffamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshippolice lieutenantevil doctor |
| Period: | 1970syear 1977 |
| Story: | phone boothvictim invited to dinnerdead woman with eyes opensleeping in a carhuman monsterold dark housemadmanpsychoticgash in the faceskullpsycholifting someone into the airmaniacthreatened with a knifelong take …missing personcharacter's point of view camera shotstabbed in the cheststabbed to deathsubjective camerahallucinationcorpsesurprise endingphotographbare chested maleviolenceflashbackbloodnumber in titledancingknifechasepistolfirebeatingdreamdigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointrevolvershot in the backhalloweenbound and gaggedaxehousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on fireactor playing multiple rolesevil manlightningskeletonhanginghalloween costumedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youcult directorpoemtv newsundergroundmass murdertape recordertied to a bedcaptivewalkie talkiegiantflatulencesevered handhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanternmannequintorso cut in halfhit with a baseball batintestinesburied aliveneedleshot in the neckurban legendfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousereference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
| Subgenre: | psycho thrillercult filmindependent filmblack comedysadistic horror |
| Themes: | madnessinsanitypsychopathdeceptionfeardeathmurderfriendshiprevengesuicidekidnappingrapebetrayaltortureescape …seductionangerdeath of fatherbrutalitydeath of motherparanoiahumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymurder of a police officernear death experiencemurder of family (See All) |
| Mood: | gorenightmareambiguous ending |
| Locations: | moteldesertbathtubbarpolice stationfarmroad tripgas stationtexasbrothel |
| Characters: | serial killerterrorsheriffvillainmother son relationshipfamily relationshipshusband wife relationshipfather son relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationship …prostitutepolice officernursehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
| Period: | 1970syear 1978 |
| Story: | phone boothgrindhouse filmfemale victimhomicidal maniacpsychopathic killerfemale in showermutilated bodymurder spreeknife murdercrime spreebutcheryserial murderhuman monsterbad guymadman …body countbutchergrindhouselooking at oneself in a mirrormaniacthreatened with a knifemurdererbasementstabbed in the cheststabbed to deathjailarrestcorpseshowerphotographbare chested maleviolencebloodflashbacksequelmale rear nuditydogsex scenefemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterexplosionknifechasepantiespistolfireshootoutwoman on topbeatingdreamshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanahandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingimpalementcocainefemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigneck breakingchickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencehead buttmass murderscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachcovered in bloodrapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onenewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertreference to elvis presleyprayingface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynistsexual violencestandoffvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticcocaine snortinghouse on firemass murdererevil clownbilingualisminnocent person killedreturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodnecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
While taking a shower, Kate Miller, a middle-aged, sexually frustrated New York City housewife, has a rape fantasy while her husband stands at the sink shaving. Later that day, after complaining to her psychiatrist Dr. Robert Elliott about her husband's pathetic performance in bed, she meets a stran …ge man at a museum and returns to his apartment where they continue an adulterous encounter that began in the taxicab. Before she leaves his apartment, she finds papers which certify that the man has a venereal disease. Panicked, Kate rushes into the elevator, but has to return to his apartment when she realizes she's forgotten her wedding ring. When the elevator doors open, she's brutally slashed to death by a tall blonde woman wearing dark sunglasses. Liz Blake, a high-class call girl, is the only witness to the murder and she becomes the prime suspect and the murderess's next target. Liz is rescued from being killed by Kate's son Peter, who enlists the help of Liz to catch his mother's killer as Detective Marino who's in charge of the case is uncooperative in the investigation. (Read More)
| Subgenre: | cult filmindependent filmerotic thriller |
| Themes: | mental illnessguiltpsychopathvoyeurismfeardeathmurderfriendshipinfidelityjealousyadulterydrinkingseductionextramarital affairloneliness …obsessionparanoiablackmailunfaithfulnesssexualitysadismphotographypanictraumafalling in loveaffairmurder investigation (See All) |
| Mood: | darknessneo noirnightmarecar chase |
| Locations: | new york citycarwatertaxielevatorapartmentcityofficemuseumsex in car |
| Characters: | serial killerpsychiatristkillerpolicemanfriendpoliceprostitutetranssexuallustpolice detective |
| Story: | female victimvillain played by lead actorblack braslip the undergarmentdeeply disturbed personmysterious strangerdisturbed individualmurder suspectsplit personalityfemale removes her dressapartment buildingvictimmutilationmaniaccross dressing …trapfemale removes her clotheswitnessscreamstalkerwomandisguisebrasubjective cameravoyeurhallucinationbathroomundressingunderweartelephone callshowersurprise endingphotographbare chested maleviolencesexfemale nuditynuditymale nuditybare breastsfemale frontal nuditykissfemale rear nudityfemale full frontal nuditynipplesleg spreadingchasethree word titlepantiestopless female nudityfondlinghigh heelswoman on topbeatingmirrorblondewritten by directordrinksex in bedthongbare buttsunglassesrunninglingeriedead bodyinterrogationprostitutiontelephonecleavagebisexualjournalistold manthroat slittingfemale pubic hairsubwaywhite pantiesbrunettefalse accusationscantily clad femalecontroversysearchfemme fatalecigar smokingattempted murderblack pantiespassionevil mansensualitymanipulationwigstalkingsplit screenthreatcheating wifecouplesexual fantasyidentityno pantiesdesirehidingassaultdysfunctional marriagedesperationcovered in bloodcoitusart galleryhomicidesexual desirewoman in jeopardybra and pantiesunfaithful wifepartnerbroken glasspanties pulled downperversiondeceitwedding ringsuspectattractionpunchcopulationblack bra and pantiesexhibitionismfemale detectivegarteradulterous wifegirl in bra and pantiesconfusiondark secretcar drivinglong hairmental breakdownsubway stationclose upnudeskirtrepressionsexual perversionsexual tensionlegswhodunitdegradationblood stainmind gamejacketexhibitionistnude girltransvestismhallwaypsychoanalysismurder witnesscop killermurder attemptdesksexual repressionmenacemultiple murderhitchcockiancaressreference to supermantargetcut handsexual obsessiongender disguisemurder victimstraight razorfemale writercrime of passionwhite coatcuttrophy wifebad dreamfemale in a showerexaminationmultiple homicideman wearing a wigblack glovesreference to alfred hitchcockfemale in bra and pantiesladysteamsex crimepastichegiallo esquekilled in an elevatorman and woman in a bedstab woundfemale corpsenorth american giallomultiple stabbingromantic obsessionbritish manwhite glovesdark killerpolice psychologistblack gloved killergender dysphoriawoman journalistblack suit clad killertaxi cabwoman in a bedspurned mantwist at the endattacked in an elevator (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
| Subgenre: | psycho thrilleramerican horrorsuspensecult filmindependent filmsupernaturaltragedyparanormalparanormal phenomenacanadian horror |
| Themes: | madnesspsychopathdeceptionfearmurderdeathlovesurrealismsuiciderapechristmasinvestigationsupernatural powerdeath of motherparanoia …blackmaildeath of wifepanicapocalypsedisabilitymurder investigationunlikely heronuclear holocaust (See All) |
| Mood: | slasherneo noir |
| Locations: | police carchurchhospitalschoolsnowwheelchairtrucktunnelschool teacherfire truck |
| Characters: | serial murdererserial killersheriffpsychiatristvillainmother son relationshiphusband wife relationshipfather son relationshipboyfriend girlfriend relationshipdoctorteacherpolice officernursephotographerbaby …little boysnipergermanex boyfriend ex girlfriend relationshipsniper rifleself mutilation (See All) |
| Period: | world war two1980s1970swinterseeing the future |
| Story: | grindhouse filmhomicidal maniacpsychopathic killerbra removingscreaming in feardrive in classicserial murderslashingbad guybody countrainstormgrindhousemutilationmaniacmurderer …widowerstabbed in the chestgood versus evilcorpsesurprise endingphotographbased on novelflashbackbloodfemale nuditykisstitle spoken by characterexplosionchasepistolfireshootoutdreamshot to deathblood splattercar accidentshot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointcar crashhandcuffsrevolvertelephonef wordreporterflashlightambulancemansionpoliticianman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationpremarital sexcharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmancold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathcomaexploding buildingloss of wifepress conferencesevered handambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childslaughtersexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentteachingswastikacrutchesroller coastermegalomaniacold flameelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loverspsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonetorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebobased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All) |
Earl Brooks is a highly respected businessman and was recently named Portland's Man of the Year. He hides a terrible secret however: he is a serial killer known as the Thumbprint Killer. He has been attending AA meetings and has kept his addiction to killing under control for two years now but his a …lter ego, Marshall, has re-appeared and is pushing him to kill again. When he does kill a couple while they are making love, he is seen and photographed by someone who also has his own death and murder fetish. In a parallel story, the police detective investigating the murder is having problems of her own. She is going through a messy divorce and a violent criminal who had vowed revenge some years before has escaped from prison and is after her. (Read More)
| Subgenre: | suspensecult film |
| Themes: | psychopathdivorcedeceptionfearmarriagemurderdeathlovefriendshipsuicidekidnappingpregnancyinvestigationseductionanger …blackmailsadismabductioncrueltydyingtraumamurder of husband (See All) |
| Mood: | raingorenightmaremurder suicide |
| Locations: | hotelchurchhospitalrestaurantcemeteryairplanetaxikitchenofficerooftopstorm |
| Characters: | serial killersecretarykillerpolicemanfriendhusband wife relationshippolicefather daughter relationshipmother daughter relationshipdoctorstudentdetectivedancerlawyerpolice detective …ex husband ex wife relationship (See All) |
| Story: | homicidal maniacmurder of a nude womanpsychopathic killerdead woman with eyes openalimonytalking to oneselfhearing voicessplit personalityserial murderpeeping tombreaking and enteringeyeglassesmaniackillingmurderer …witnessstabbingdisguisebranewspapervoyeurhallucinationsecretunderwearcorpsetelephone callsurprise endingphotographbloodflashbackviolencefemale nuditycharacter name in titlemale nuditymasturbationgunsex scenekissfemale rear nuditydancingnipplestitle spoken by characterpistolpunctuation in titlecryingcell phoneshootoutwoman on topdreamblood splattercar accidentmirrorshot in the chesturinationshot in the headcomputersex in bedshootingtearsbeddead bodycafeprayertelephonebedroomflashlightthroat slittingbridgedinerdouble crossvanshot in the legshot in the foreheadlatex glovesgravestrippingprologuebusinessmanfactorychampagneumbrellaevil mancollege studentshot in the shoulderwigdeath of husbandsilencerpickup truckfireplacedesireaddictionheavy rainice creamcaught having sexbeardcovered in bloodparking garageblack humorfollowing someonedead womans&mschizophreniahomicidecrime scenestabbed in the throatmercilessnessstabbed in the neckmillionaireconvenience storeshovelscissorshit on the headsurprisedead manalternate realitybody landing on a cardivorceenude woman murderedreckless drivingexhibitionismfemale detectivelyinginterrupted sexbeing followedyellingclosetrepeated scenehead woundmen's bathroomescalatordouble lifevacuum cleanermasochismblood stainimaginary friendframedescaped convictjacketwetting pantsflight attendantdnaconscienceemergency roombleeding to deathmurder witnesshit with a shovelclothingalter egomultiple murderman wearing glassesbmwcruisingwet clothesschizophrenicalcoholics anonymousfingerprintbanquetportland oregonapprenticehatchetintercomthrown from a carovenstabbed with scissorsjoggerdance classwife swappingdriver's licensecrossword puzzlekilled during sexstrobe lightmultiple homiciderainy nightwoman shot in the foreheadsafe deposit boxdead woman on bedroad ragedance studiosidewalk cafespying on couple having sexneon lightpotterylawyer client relationshipdoor lockstaringimaginary personsecret compartmentnude man murderedurinating in fearcollege dropoutphilanthropistincriminating photographattempted kidnappingexercyclefetishistmurder of a nude manincriminating evidenceamateur photographerlack of evidenceaa meetingdoor keyprocess serversadomasochistflip phonepalo alto californiareference to stanford universitygood becoming evilmechanical engineervolvo 240barcelona chairburner phoneurge to kill (See All) |
After his father is killed in a car accident, things unravel for Kale Brecht and he is placed under house-arrest for punching his Spanish teacher. Having nothing better to do, Kale occupies himself by spying on his neighbors. But one night, he witnesses what appears to be a murder going on in Mr. Tu …rner's house. Kale becomes obsessed with uncovering the truth behind these murders but, after a few unsettling run-ins with Mr. Turner, it becomes a matter of life and death. And the ominous question: Who is watching whom? (Read More)
| Subgenre: | suspenseblack comedy |
| Themes: | psychopathvoyeurismmurderdeathfriendshiprevengekidnappingbetrayaljealousydrinkingescapeinvestigationdeath of fatherparanoiaphotography …panicmurder of a police officer (See All) |
| Mood: | slasherneo noirhigh school |
| Locations: | police carswimming poolcarbicyclecourtroomrooftopstormfishing boat |
| Characters: | serial killerterrorvillainpolicemanfriendmother son relationshipfather son relationshippolicefather daughter relationshipteenagermother daughter relationshipboyteenage boyteacherstudent …dancerwriterpolice detectivecousin cousin relationship (See All) |
| Story: | homicidal maniacmissing womanpsychopathic killerhardware storecurtainhuman monsterbad guymadmancellarextortionskullpsychobreaking and enteringmaniacbasement …witnesslong takemissing personstabbed in the cheststabbed to deathwomannewspapervoyeurbathroomarrestcorpsetelephone callone word titlebloodviolencedoggunkissfightdancingtitle spoken by characterpartyknifechasecell phoneblood splatterfoodcar accidentpunched in the facewatching tvcomputerdrinkbikinibookplace name in titlerunningdead bodyneighborhandcuffsclassroomswimmingvideo cameraeatingimpalementjudgesevered headtrialfishingduelflash forwardbinocularssuburbevil manreadingrabbitbaseball batlightningskeletonprankscarwighigh school studentstalkingneck breakinggardenclassobscene finger gesturesubtitled scenegarageflirtingtv newsteen angstlistening to musicsociopathcaptiveassaultparking garagebroken legrampagebarefootwoman in jeopardywindtelescopethunderspanishbroken glassshovelscissorsstabbed in the legyoung lovedeerduct tapekilling spreereckless drivingchocolatexboxearphonesboredomclosetlaundrycoca colalistening to a radiostakeoutxbox 360bunk bedplaying a video gamereference to youtubemercedes benzshirtford mustanghitchcockianbmwcamera phonenewlywedbutcher knifeleg injurysecret roomfictional cityfordtv hostlawn mowerchevroletsnorricamwatching someoneipoddishwasherpeanut butterhouse arrestmoving vanpsphdtvdead deerred bullgarden shearswet jeanslawn mowingporch swingoverturned carcarcasscocoonjaguar cardecomposed bodyplaystation portablefelonybagelfelonford crown victoriasurgical toolvolkswagen new beetlelexusmoverankle monitor1 year latervolvo cartwinkiesapple macbookitunesspanish teacherhonda accordlove seekingapple macbook proreference to ituneschevrolet tahoeelectronic tagford f150 pickup truckjaguar s type (See All) |
The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi …llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)
| Subgenre: | american horrorcult filmindependent filmb movievideosadistic horrorhorror b movie |
| Themes: | psychopathvoyeurismfearmurderdeathrevengekidnappingrapetortureseductionangerbrutalityhumiliationsadismevil …exploitationcrueltyvengeancerape and revengerevenge murder (See All) |
| Mood: | slashergore |
| Locations: | bathtubsmall townchurchnew york cityforestcarbicyclewaterlakegas stationcountry |
| Characters: | serial murdererserial killervillainkillerfemale protagonistgirlwriterlustself justicesex with a stranger |
| Period: | 1970s |
| Story: | psycho killergrindhouse filmfemale victimpsychopathic killersadistic psychopathdrive in classicmurder spreedisturbingserial murderfemale removes her dresshuman monstercharacters killed one by onepsychoticbody countdeath threat …victimgrindhousemutilationeyeglasseskillingmurdererfemale removes her clothesnewspapervoyeurbare chested maleviolencebloodfemale nuditymale nuditybare breastsfemale frontal nuditymale frontal nuditygunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesmale full frontal nudityknifeleg spreadingpantiesfondlingcryingbeatingmirrorbikinilow budget filmmale pubic hairriveralcoholtelephonecleavagegangnew yorkaxefemale pubic hairwhite pantiesdrivingman with glassesscantily clad femalecontroversydrowningjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingglassesthreatcabinhandgunvigilanterecord playerclaim in titlenipples visible through clothinginjurysexual abuseragedesperationrape victimrapistfemale killerredneckwoman in jeopardylow budgetmercilessnessdark herosexploitationpanties pulled downgang rapeperversioncastrationaxe murderbruisekilling spreemisogynywoman in bathtubpervertkillviolence against womenvigilantismmisogynistcanoemental retardationsexual perversionsexual violencefemale psychopathloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathmotorboatcarnagefemale villainatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencemurderesssmall breastsfemale prisonershared bathone woman armyviolent deathdelivery boynoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucheryfemale serial killersexual sadismcreepysexual crueltybanned filmhanged boysadisticeye candyinfamygory violenceeast coastmisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All) |
On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic … and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)
| Subgenre: | american horrorcult filmindependent filmsadistic horror |
| Themes: | madnessinsanitypsychopathvoyeurismdeathmurderrevengesuicidekidnappingrapetortureescapeinvestigationseductionbrutality …humiliationsadismevilabductioncrueltyvengeancerape and revengerape and murder (See All) |
| Mood: | slashergorehigh schoolnightmare |
| Locations: | swimming poolforestcemeterylakerunning through the woods |
| Characters: | slasher killerserial murdererserial killerterrorsheriffvillainkillerfriendfamily relationshipsfather son relationshippoliceteenage girlreference to godself justice |
| Period: | 1970s |
| Story: | horror movie remadehomicidal maniacpsychopathic killersadistic psychopathfemale in showerdrive in classicbloody violencedisturbingdisturbed individualserial murderhuman monsterbad guymadmanbloodbathpeeping tom …victimgrindhousemutilationmaniackillingmurdererfemale removes her clothesbathstabbed to deathtoiletstabbingvoyeurshowerbloodviolencefemale nudityfemale frontal nuditydoggunfemale rear nudityfightfemale full frontal nudityknifepantiesshot to deathblood splatterurinationremakeshootingbeerbirthdaymarijuanafoot chasebound and gaggedgangconcertthroat slittingfemale pubic hairwhite pantiesscantily clad femalecontroversycigar smokingnecklacelatex glovespublic nuditydrug addictstabbed in the backscreamingsuburbelectrocutionevil manringconvertiblechickendirectorial debutsevered armhandgunbased on filmcult directordismembermentbralesschainsawnipples visible through clothingbeer drinkingmachetesexual abuseice creamrape victimrapistfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiepedophiledisembowelmentperversionmurder of a childcastrationducksexual assaultshot multiple timesdead girlpervertprayingcannabisforced to striprunning awayspit in the facemisogynistphysiciansexual perversionsexual violenceelectronic musicfemale psychopathdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnagefemale villainatrocitystation wagonshot through the mouthgraphic violencereading a newspaperchild molesterbakingstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerfemale serial killerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmsex offenderforced suicidesadisticstabbed in the bellyhands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckersvideo nastysickocandlelight dinnerbad girlpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
| Themes: | insanitypsychopathdeathmurderrevengesuiciderapetortureevilcannibalismrape and revenge |
| Mood: | slashergore |
| Locations: | desertwaternew mexico |
| Characters: | slasher killerserial killerterrorvillain |
| Period: | year 2007 |
| Story: | psycho killergrindhouse filmhomicidal maniacpsychopathic killersadistic psychopathmutilated bodybloody violenceserial murderhuman monsterbad guymadmanbody countgash in the facepsychomaniac …stabbed in the cheststabbed to deathstabbinggood versus evilcorpsesurprise endingfemale nuditynuditybare breastssequelfightexplosionpistolfirelickingshot to deathblood splattershot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordsurvivalgay slurarmyimpalementtrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultaccidental deathbroken legguardrampagesevered fingerhit in the crotchcannibalstabbed in the headdynamiteaccidental killingmineaxe murderkilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancydeformitypsychotronic filmsledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monsterumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
| Subgenre: | american horrorsupernatural |
| Themes: | madnesspsychopathfeardeathmurdermonstermemoryracismbrutalitysupernatural powersadismbullyingabductionhomophobiacruelty …childhoodcannibalismmissing childunlikely friendshipschool bullyingsupernatural powers (See All) |
| Mood: | gore |
| Locations: | small townschoolforestbicyclesewernew boy in town |
| Characters: | serial killervillainpoliceteenagerchildrenzombiebullylittle boyjewchildhood friendbar mitzvahboy in underwearevil father |
| Period: | 1980ssummeryear 1989year 1988 |
| Story: | psycho killerhomicidal maniacpsychopathic killersadistic psychopathscreaming in fearscreaming in horrorbloody violencedisturbingdeeply disturbed personabandoned housebad guycellarbutcherpsychomutilation …eyeglassesmaniackillingfirst partmurdererbasementmissing personnewspaperbathroombased on novelone word titleviolencebloodflashbackkisstitle spoken by characterblood splattercatbattlepaintingbookpianodemongay slurchild abusechildcoffinchild in perilcreaturelibraryclowndeath of brotherbrothersevered armgaragesplattersisterballoonstreetsexual abuseoverallscovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatpedophilemurder of a childturtleabusive fatherbroken armkilling spreeloss of brotherheroismunderdogpervertspittinggirl in bra and pantiesoutcastwoodbicyclingwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringteenage girl in underwearpool of bloodreference to michael jacksonoverbearing motherold houseghoulglowing eyesevil clowncreepsidewalkarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownpocket knifechild killercamaraderiemonsterschild murdererhypochondriachit with a rockmissing person postersinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All) |
As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the …y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)
| Subgenre: | american horrorcult filmindependent filmparanormalcreature feature |
| Themes: | fearmurderdeathrevengeghostescapemonstersupernatural powerevil |
| Mood: | darkness |
| Locations: | rural settingsmall townchurchbarbeachwaterseashipcampfirefishing boatghost ship |
| Characters: | terrorsheriffvillainmother son relationshipchildrenboyzombiepriestsingle motherlittle boyemployer employee relationshipcatholic priestmysterious villain |
| Period: | 1980s1970syear 1979 |
| Story: | horror movie remadegrindhouse filmmutilated bodydrive in classicremadedisturbingbutcheryslashingmysterious manbad guybutchervictimgrindhouselifting someone into the airmutilation …killingstabbed to deathwomanstabbingcaliforniacorpsesurprise endingviolencebloodtwo word titleknifechasesworddead bodydemondecapitationimpalementchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorundeadrecord playerpirategoldelectronic music scoremass murdergothictape recorderstabbed in the stomachcrucifixtreasurehitchhikercelebrationwoman in jeopardyreverse footagepower outagepsychotronicautopsyfogeye gougingslaughterpierdark pastkilling spreelighthousedjliving deadspiral staircasejournalevil spiritblackoutradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulhookradio broadcasttragic villainmistphonograph recorddockscreepymusic score composed by directorstained glass windowdemonicbayfemale hitchhikercampfire storyhell on earthleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com