Please wait - finding best movies...
A vehicle crash in the Pine Barrens leads to a missing teen which raises conspiracy theories about the infamous Jersey Devil legend. On the anniversary of the crash, Sarah Franklin, convinced her cousin Kelsey is alive, goes out to the crash site with Alex, Kelsey's boyfriend, to investigate. Things … go downhill quickly as Sarah and Alex uncover what really lurks in the woods. (Read More)
| Subgenre: | heist gone wrong |
| Themes: | devil |
| Locations: | woods |
| Characters: |
| Period: |
| Story: | jersey devilcrash sitelearning the truthex boyfriendmissing personurban legendhorror moviejournalism studentpine barrensface to facecrazy old manblood spraycgi bloodshock valuechain of events …open doorone year latercollege studentsalivejerseytwo friendsfirst filmwedding daycousinpick upmissingcrashtruthbody countboyfriendlow budgetlegendcreatureold man (See All) |
Urban Legend tells the story of a group of pretty college students at a remote New England university. The focus of the story is Natalie, a beautiful, academically-gifted student at the fictional Pendleton University. Natalie and her friends are all involved in the Folklore class being taught by Pro …fessor Wexler. Wexler regales his class with urban legends, which include Pendleton's own urban legend about a Psych professor who murdered six students at Stanley Hall 25 years ago. Natalie is the first one to suspect there's a killer on campus, especially after she has ties to all of the victims. No one, including her friends, Wexler, Dean Adams and security guard, of course, believes her until it's too late. Now she finds that she and her friends are part of the killer's ultimate urban legend. (Read More)
| Subgenre: | slasher flickteen movieteen horror |
| Themes: | murderdeathrevengepsychopath |
| Mood: | goreraincar chaseslasher |
| Locations: | swimming poolgas stationsinging in a car |
| Characters: | teenagerfriendfemale protagonistserial killersecurity guardprofessormysterious killer |
| Story: | urban legendcollege studentslegendbloodviolenceflashbackgunsex scenesingingpartychasesurprise endingpistolcorpseblood splatter …computerfalling from heightvomitingcollegetelephonedecapitationjournalistbound and gaggedcandlestrangulationaxedeath of friendbridgeimpalementradioroommateproduct placementlightninghangingsuspicionfirst partgothicheavy rainlifting someone into the airtied to a bedstabbed in the stomachvillainessjournalismparking garagefemale killerjanitorrear entry sexthunderstormrainstormaxe murdercharacters killed one by onecar troublescene before opening creditsfemale psychopathradio stationspreadeaglefraternitybody in a trunkscalpelcampusdisc jockeycollege campusorchestral music scoregoth girloff screen murdervillain not really dead clichered herringmicrowave ovenpoodledorm roomfall to deathfemale serial killermicrowavepepsitalk radiodead teenagerradio hosthanged boyconvicted felondark and stormy nightchat roomsource musicyelling for helproommate issueslifting a male into the airdead body in a car trunkradio talk showshot with a guncollege roommatecry for helpcall for helploss of best friendcrying for helpbody in a car trunksinging along with radiostuck during sexwest highland white terrierkilled in a carradio call in showfalse scareradio callerthrown through windshieldannoying roommate (See All) |
Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and … made into a movie. The Blair Witch Project. (Read More)
| Subgenre: | independent filmcult filmblack comedysuspensemockumentarytragedyfound footagefake documentaryghost storysupernatural horrorfamily tragedyfolk horror |
| Themes: | fearsupernatural powerpanicwildernessstarvationcamping in the wilderness |
| Mood: | student filmdarknessmyth |
| Locations: | woodsforest |
| Characters: | boyfriend girlfriend relationshipfilmmakercrying babyevil witch |
| Period: | 1990syear 1994 |
| Story: | missing personurban legendlegendcigarette smokingchasesurprise endingcryingcorpsebookrunninglow budget filmriveralcoholsubjective camerahalloween …flashlightvideo camerafour word titlemaplooking at the cameratalking to the cameralatex glovespainscreamingscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriafolklorehikingabandoned housemessageautumnfrightgrassscareno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianobscurityscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All) |
This film is about a legend that has been started by the town folk of Cold Rock. Since the children in the town have been going missing, people have said it's an entity known as 'The Tall Man' who has been taking them. Julia Denning (Jssica Biel) is the local nurse whose husband died years earlier. …She is soon personally involved as her child is taken. She tries to track down where the child is taken, but finds that there's more to what's happening than she knew. The towns-folk start to turn on her and the truth comes out. But there's still more to the story - who is 'The Tall Man'? And what is the truth behind the disappearances? (Read More)
| Subgenre: |
| Themes: | suicidekidnappingdeception |
| Mood: | rain |
| Locations: | foresttunnelabandoned factory |
| Characters: | female protagonistnursesheriffpolice lieutenant |
| Story: | urban legendmissingtruthlegendflashbackdogphotographtitle spoken by characterthree word titlesurprise endingvoice over narrationface slappunched in the facewritten by directorarrest …car crashinterrogationbound and gaggeddinertied to a chairnonlinear timelinechilddrawingnews reportcharacter repeating someone else's dialogueknocked outdisappearancebirthanimal attacktitle appears in writingwomen's prisonlens flarehit with a baseball batfilm starts with textloss of childprison visitshrineabusive boyfriendchild abductionman slaps a womantitle spoken by narratorangry mobwashington statecreekreference to sherlock holmesfreight trainhanged womanhit with a rockdog bitemissing person posterhiding in a carhit with a wrenchbead curtainrock thrown through a windowreference to homerhealth clinic (See All) |
Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own …life. (Read More)
| Subgenre: | paranormal phenomenasupernatural horror |
| Themes: | murderdeathrevengesurrealismsuicideghostfearfuneralinvestigationvoyeurismsupernatural powerphotographyadoptiondyingmysterious death |
| Mood: | rainnightmarehorror movie remake |
| Locations: | bathtubwaterelevatorwheelchaircity |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlserial killerstudent …writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All) |
| Story: | urban legendjournalism studentlegendf ratedbased on novelbloodflashbackcigarette smokingphotographtitle spoken by charactersurprise endingpantiesshowertelephone callcell phone …dreamhorsemirrorblondeface slapremakewatching tvcomputercamerafalling from heighthallucinationvoyeurislandclassroomtelephonereportergood versus evilcleavagenewspaperjournalistaxewomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationunderwater scenetreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicgirl in pantiesanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secretwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitdeformed armhorse breederfalling down a well (See All) |
Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try …ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)
| Subgenre: | suspensesupernaturalfound footagevideosurvival horrorpsychological thrillerpsychological horrorfolk horror |
| Themes: | murderdeathfriendshipkidnappingbetrayalghostfearescapedeceptionsupernatural powerparanoiaevilpaniccampingnear death experience |
| Mood: | gorerainambiguous endingmyth |
| Locations: | woodsforestsmall townnightclubcampfiretunnel |
| Characters: | boyfriend girlfriend relationshiphostagewitchself mutilationdeath of girlfriend |
| Period: | 2010s |
| Story: | missing personlegendcreaturecharacter name in titlebloodviolencesequeltwo word titletitle spoken by characterchasesurprise endingcell phonecorpseblood splatterrescue …falling from heightvomitingrunningriverf wordsubjective camerasurvivalflashlightdeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationapologyno opening creditsdouble crosssearchthird parttreecursedangerscreamingcharacter's point of view camera shottentknocked outcollege studentlightningactor shares first name with characterdisappearancebasementsuspicionprofanitysleepingfreeze frameheavy rainloss of friendwalkie talkieoverallsvideotapewristwatchyoutubeinterracial friendshipcrushed to deathbroken legtensionmercilessnessescape attemptblack and white sceneinfectionaerial shotattichandheld camerarainstormcharacters killed one by onetripteleportationtracking deviceyellingminimal castvomitold dark houseabandoned housedronenight visionno title at beginningfilm starts with textcabin in the woodsdeath of boyfriendcamcorderparasitewatching a videosymbolpentagrampsychotronic filmtime loopgrindhouse filmleg injuryno endingbanishmentmarylandbarricadefilm studentcamping triploss of girlfriendshaky camlost in the woodsrebootloss of boyfriendcrawlingvomiting bloodhearing noisesriver crossingcentipedetime paradoxmysterious noiselovecraftianbroken footdark forestno cell phone signalrunning in the darkblair witchcrossing a riveropening creditsbootstrap paradoxsleeping in the foresthouse in the woodsblair witch projectmysterious figure (See All) |
A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend … has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)
| Subgenre: | psycho thrillerslasher flick |
| Themes: | murderdeathrevengetorturedrunkennesspsychopathbrutalitydeath of motherevilmurder of a police officer |
| Mood: | goreslasherdarknesshorror movie remake |
| Locations: | woodsforestmotorcycleboatbathtubbicyclewaterpolice carlakecampfiretunnelschool busbackwoodssex in a tent |
| Characters: | african americanboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlvillainsheriffasian americanterrormysterious villainserial murdererblonde girlgirl nudity |
| Period: | 1980s |
| Story: | missing personmissingbody countboyfriendlegendfemale nuditynuditynumber in titlebloodviolencebare breastsfemale frontal nuditymasturbationdogbare chested male …sex scenefemale rear nuditynippleschasesurprise endingpistoltelephone callfiretopless female nuditywoman on topcorpsedigit in titleblood splatterurinationblonderemakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingdecapitationflashlightbracandlestrangulationtoplessaxemassacrevideo camerastabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestsevered headcultscantily clad femalebreast fondlingdrowningskinny dippingstalkerstabbed in the backprologuescreamingmini skirtmoaningtentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexmaniacpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscamppsychocovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowperversioncellphonedisfigurementbody landing on a carstabbed in the eyeaxe murdersevered legcharacters killed one by onearrowburned to deathpsychoticmasked killermannequinpsycho killerplantserial murdervillain played by lead actorpsychopathic killerbad guybeheadingporn magazinestabbed in the handbonghuman monstercanoestaircaseabandoned househomicidal maniacrear nuditydisposing of a dead bodyshot with an arrowfemale psychopathloud sexslashingno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmurderessmasked villainknife murderspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapsleeping bagwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmpsycho terrorfemale serial killerscrewdrivernaked buttweirdowoman's bare buttdrinking gamewater skiingteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chestcamp counselorhearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All) |
Loomis Crowley is testing the underground game Stay Alive with his friends Sarah and Rex. When the game is over, Loomis finds Rex and Sarah dead in their room, and he is pushed by a shadow from the staircase, breaking the banister and hanging the same way he died in the game. Loomis' sister, Emma, g …ives his game to his best friend, Hutch. They, and his friends Miller, Phineus with his sister October, Swink and Abigail play the game together. When Miller and Phineus die the same way they died in the game, the survivors disclose that the game is based on the life of the evil Countess Elizabeth Bathory. She was buried alive in the tower of her real state in the Geronge Plantation. With the police chasing them, and after the death of October, the survivors reach the house and try to find the corpse of the Countess to destroy her fiend. (Read More)
| Subgenre: | videodisneysurvival horrorteen horrorsupernatural horrorslasher horror |
| Themes: | murderdeathfriendshipdrugsghostfuneraldeath of motherhomelessnessenvironmentmurder of a police officer |
| Mood: | high schoolslasher |
| Locations: | carcemeterysinging in a carblood in car |
| Characters: | friendbrother sister relationshipteenage girlteenage boylawyerwaitresspolice detectiveemployer employee relationshipchildhood friendyounger version of character |
| Story: | horror moviealivebody countlow budgetbloodviolenceflashbackmale rear nuditybare chested malefemale rear nudityfemale full frontal nuditycigarette smokingtitle spoken by characterchasesurprise ending …firecorpseshot to deathblood splattercar accidentmirrorshot in the chestslow motion scenecomputermaskbookcar crashprayerstabbingdeath of friendthroat slittingcocainestabbed in the chestchild in perilpolice officer killedvanperson on firedollhangingdiarydeath of brotherautomobilelaptopcharacter says i love youfull frontal nudityoccultgameburned alivelooking at oneself in a mirrorgroup of friendscaught having sexvirtual realityrealitystealing a carconstruction sitecrossbowstabbed in the throatanimated sequencenew orleans louisianatitle appears in writingthunderstormexploding headroseblood on shirtplayburned to deathloss of brotherlaptop computerinterrupted sexreflectionhackerbongapparitiontowerlightercomic reliefbroken mirrorhanging upside downchandelierplaying a video gamehanged mannaked dead womanmultiplayercrowbartrapdoorhouse firevideo gamehusband murders wifepeep holeplantationzippo lightergamersome scenes animatedthroat cutcarriagebloody body of a childcityscapehorse drawn carriagenail gunshackleschevrolethidden roomyoung3 dcountessnailchild killerzombie childred rosestabbed in the heartstabbed in the foreheadhanged by the neckinternet cafereal lifecomputer gamepig maskbaronesstitle appears in textworking lategroup of teenagersone way mirrorpontiacreflection in car mirrorbathorygame designerkilledshearsthroat slitblue collar workerreal worldlaw clerkliving in a vanmouth forced opengame reality crossoverinside a computerreference to elizabeth bathory (See All) |
While camping in the woods, Polly Watt and her clumsy boyfriend Seth Belzer damage their tent. They decide to spend the night in a low-budget motel. Meanwhile the criminals, Lacey Belisle and Dennis Farell, have trouble with their runaway car while heading to Platt and they walk on the lonely road. …When Polly passes by Lacey, she stops the car and the couple is rendered by Dennis. However, Polly hits something in the road and while replacing the tire, they are attacked by a weird splinter. The car overheats and they stop in a gas station, where they are trapped by zombies, victims of the splinter parasite. (Read More)
| Subgenre: | body horror |
| Themes: | deathsuicidemonsterguiltself sacrificemurder of a police officer |
| Mood: | gore |
| Locations: | woodsgas station |
| Characters: | boyfriend girlfriend relationshippolice officerhostage |
| Story: | boyfriendcreatureviolenceone word titlecigarette smokingchasesurprise endingpistolfirecorpseblood splattershot in the chestshot in the headshotgunheld at gunpoint …beerbathroomshot in the backhit by a cartentbaseball batmurderersevered armfireworksicesecurity camerahammersevered handbroken legstealing a carinfectionblood on shirthandheld cameraone dayconvictbody landing on a carbroken armsevered legdead woman with eyes opentorso cut in halfanniversaryvideo surveillanceescaped convictamputationcarjackingparasitespitting bloodarm cut offhatchetpolicewoman killingtrail of bloodjumping from a rooftopfreezerreanimationhand cut offscrewdrivercamping tripfreezingbroken fingerfinger cuttire irontorn in halfmatchesassimilationexploding gasoline stationdead policewomanthermometerdog hit by a cartemperaturediversionpushing a carcutting arm (See All) |
Distraught, confused, and half-wild with fear, Sarah Carter emerges alone from the Appalachian cave system where she encountered unspeakable terrors. Unable to plausibly explain to the authorities what happened - or why she's covered in her friends' blood - Sarah is forced back to the subterranean d …epths to help locate her five missing companions. As the rescue party drives deeper into uncharted caverns, nightmarish visions of the recent past begin to haunt Sarah and she starts to realize the full horror and futility of the mission. Subjected to the suspicion and mistrust of the group and confronted once more by the inbred, feral and savagely ruthless Crawlers, Sarah must draw on all her inner reserves of strength and courage in a desperate final struggle for deliverance and redemption. (Read More)
| Subgenre: | survival horror |
| Themes: | betrayalfearmonsteramnesiaself sacrificemurder of a police officerclaustrophobia |
| Mood: | gore |
| Locations: | hospitalforestelevatorpolice carcavecave in |
| Characters: | sheriff |
| Story: | missing personmissingcreaturenumber in titlebloodviolencesequelflashbackdogsurprise endingpistolcorpsedigit in titleblood splatterfalling from height …second partdead bodynumbered sequelflashlightvideo camerawomanthroat slittingstabbed to deathunderwater sceneknocked outkicked in the facedisappearancepolicewomanratmutantgroup of friendsloss of friendloss of loved onejumping from heightsevered handcovered in bloodcrushed to deatheaten alivefight to the deathstabbed in the neckfalling to deathdeerreturning character killed offdefecationsecond in seriesflarehead bashed infall from heightbitten in the neckcrushed headkicked in the headcamcorderhit with a shovelnewscastfemale police officersole survivorfordtruckerno survivorspick axehand cut offpower drillwoman in uniformbonesdying womanstartledsearch partymine shaftmutilated corpsehand chopped offrescue teamrubblewinkingnews crewelectric drillford crown victoriahole in the groundappalachian mountainshead smashed with a rockfalling rockhummer h2cave dwellerbottomless pitcrawlershelmet lighthiking bootsrunning through wood (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
| Subgenre: | independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror |
| Themes: | murderdeathrevengefearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytraumamysterious death |
| Mood: | gorenightslasherdarknessblood and gore |
| Locations: | woodscarmotorcycleboatwaterrural settingpolice carlaketruck |
| Characters: | policeteenagerfriendteenage boypolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driverslasher killer …mysterious villainserial murderer (See All) |
| Period: | 1970s1950ssummer |
| Story: | jerseybody countlow budgetold mansexfemale nuditynumber in titlemale nudityviolencebare breastsmale rear nuditybare chested malekissfemale rear nuditynipples …three word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerrunningdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleaxemassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantiesnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All) |
Greta is a young American woman who takes a job as a nanny in a remote English village, only to discover that the family's 8-year-old is a life-sized doll that the parents care for just like a real boy, as a way to cope with the death of their actual son 20 years prior. After violating a list of str …ict rules, a series of disturbing and inexplicable events bring Greta's worst nightmare to life, leading her to believe that the doll is actually alive. (Read More)
| Subgenre: | family tragedy |
| Themes: | murderescapevoyeurismmysterious death |
| Locations: | woodsforestcemetery |
| Characters: | family relationshipshusband wife relationshipfemale protagonistamerican abroadex boyfriend ex girlfriend relationshipsuicide by drowningamerican in europe |
| Story: | learning the truthalivephotographsurprise endingshowermaskpaintingstabbingon the rungraveportraitdollhaunted housekilling an animalloss of son …plot twistatticfamily secretnannyface maskstuffed animalold dark housebroken mirrormaking outknocked unconsciousgramophonedeath by drowningsecret roomsex dollabusive relationshiphidden roomgovernessscrewdriverelderly couplereference to johannes brahmsanimate dollgoodbye letterbelief in ghostsrat trapmouse trapcreepy child (See All) |
Sharon Da Silva wakes up every night screaming about "silent hill". Pursued by a police officer suspicious of her motives and swerving to avoid another child her adoptive mother crashes the car knocking herself unconscious. When Rose Da Silva awakens to find her adopted child is missing, she searche …s the fog and ash blanketed town for her beloved daughter. (Read More)
| Themes: | murderdeathfriendshiprevengesurrealismreligionbetrayalghosttorturemonsterbrutalitysupernatural powersadismfaithhope …self sacrificemurder of a police officermissing childghost townreligious cult (See All) |
| Mood: | gorerainnight |
| Locations: | hospitalschoolhotelelevator |
| Characters: | policemother daughter relationshipgirlpolice officernursepolicemanlittle girlwitchreligious fanatic |
| Story: | missing personmissingcreaturefemale nuditybloodviolenceflashbackgunphotographtitle spoken by characterknifepistolcell phoneblood splattercar accident …rescuearrestshowdownbathroomdemonhandcuffsclassroomgood versus evilsurvivalflashlightwomanbridgeimpalementstabbed in the chestmapnundouble crossbeaten to deathscreamingkeyperson on firecourtscardarkpolicewomanwaterfallhandgunsacrificedismembermentburned alivegothicmutilationladderorphanagecompassionjanitortrappedsufferingbased on video gametitle appears in writingcigarette lighterdark herofogsoulcliffsirentorso cut in halfheroismblood on camera lensbarbed wirefemale bondingfemale fighterhuman monsterbus stopburnt faceunconsciousnesshandcuffedpipeconscienceashesburnt bodypersecutioncar radiochild molesteradopted daughtermotorcycle copmurder of a nude womanimmolationsleepwalkingsecret roommissing daughterretreatknife in the chestmisthornhidden roomsliced in twomoral ambiguitycoal minebodily dismembermentwest virginiaabandoned minedaylimbohandcuffed womanskinned aliveburned at the stakesexy nursetown name in titlemultiple monstersmelting facemurder of a policewomanchain link fencesplit in twonightmare becomes realitysleeping on couchcatholic orphanagefundamentalist christianroom keywitch burninghandcuffed behind backschool roomsilent hillmaternal instincttorn fleshash falldead but doesn't know itmotherly instinctbarcelona chairdust mask (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
| Subgenre: | independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
| Themes: | murderdeathfriendshiprevengesurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic …self sacrificenear death experience (See All) |
| Mood: | satirespoofhigh schoolparodyslasherambiguous ending |
| Locations: | woodshospitalforestsinging in a car |
| Characters: | homosexualteenagermother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlserial killernursehostagekillermotherex boyfriend ex girlfriend relationship …parent child relationshipslasher killerself referentialparty girl (See All) |
| Period: | 1980syear 1986year 1987 |
| Story: | urban legendbody countviolenceflashbacktwo word titlebare chested malecigarette smokingdancingexplosionknifechasethree word titlesurprise endingpantiesfire …cell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurf worddecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementstabbed to deathdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditssummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
A reckless janitor accidentally releases a zombie from a laboratory of research. Meanwhile, the teenagers scouts Ben Goudy and Carter Grant decide to camp for the last time since they are too old to be scouts. The problem is that they do not want to harm the feelings of their friend Augie Foster and … the Scout Leader Rogers. They have a flat tire after hitting a deer on the road and Carter's sister Kendall Grant, her boyfriend and her friend Chloe stop their Jeep to see whether they need a ride. They invite Ben and Carter to go to a party in the night. The two scouts leave the camping during the night to go to the party. When they drive through the town, they do not see a living soul and they decide to visit a night-club since the bouncer is not at the door. They discover that people have turned into zombies and they team-up with Ben's recent acquaintance Denise Russo, who is bartender in the nightclub, and Augie that was left alone at the camp and came to the town. Soon they discover that the non-infected inhabitants have been evacuated and the town will be bombed by the government. They decide to rescue Kendall but they find that the address her boyfriend gave to them is wrong. What can they do to save Kendall? (Read More)
| Subgenre: | coming of ageblack comedyb movieabsurdismslapstick comedyteen movieteen comedyzombie apocalypseurban fantasy |
| Themes: | murderdeathfriendshiprevengebetrayalfeardrunkennessescapedeceptionmilitaryrivalryunrequited lovehome invasionexploitationapocalypse …couragemurder of a police officernear death experienceunlikely heroghost town (See All) |
| Mood: | gorehigh schoolbreaking the fourth wallone night |
| Locations: | woodsbarschoolforesthelicoptermotorcyclesmall townbuspolice stationstrip clubcampfirelaboratory |
| Characters: | teenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacherzombiesoldierpolice officerhostagebest friendwaitressalcoholicolder woman younger man relationshipself mutilation …homeless manneighbor neighbor relationship (See All) |
| Story: | learning the truthmissing personbody countboyfriendbloodviolencebare breastsmale frontal nuditymale rear nuditybare chested malegunkiss …fightphotographexplosionpartyknifelesbian kisschasesurprise endingpistolfiretopless female nuditycell phonecorpseshot to deathblood splattermachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenecatwritten by directorcondombare buttpaintingbeerbombcar crashjailclassroomalcoholstripperscientistshot in the backf worddecapitationsurvivalfoot chaseflashlightambushcaliforniaaxemassacremontageimpalementstabbed to deathstabbed in the chesttied to a chairmapaccidentsevered headradiohit by a carpolice officer killedvanshot in the legold womanshot in the foreheadon the rungunshotattempted murdercharacter repeating someone else's dialoguevirginbeaten to deathdangerstabbed in the backportraitprologuekeysuburbperson on fireattackuniformproduct placementrace against timetentscene during end creditsdiarygymamerican flagbodyguardwighigh school studentsplit screenexploding bodybasementloss of fatherpolicewomanpremarital sexcharacter says i love youthreatened with a knifesevered armdismembermentundeadmonkeygaragetopless womanfalling down stairshand grenadefireplaceburned alivekilling an animalhead buttcagediseasevirusjail cellwalkie talkieexploding buildingbarefoot malecovered in bloodgrindhouseteenage protagonistback from the deadeaten alivereverse footagejanitorstealing a carbraveryu.s. armycrossbowblood on faceunderage drinkingstabbed in the throatobesityhit in the crotchhomelessstabbed in the neckresurrectionconvenience storeshot in the facebroken glassevacuationstabbed in the headmentorcigarette lighterstabbed in the legexploding headrivaljumping through a windowinfectionaerial shotwisecrack humorblood on shirtfriendship between boysone daydeerdisfigurementgasolinestabbed in the eyeclassmateaxe murdermutationtrophysevered legflat tiremale virginheroismdjblood on camera lensearphonesflagfire extinguisheroutcastshot in the neckdead animalhomagedefecationhead blown offarmored carjournallightermale friendshipabandoned housemallblood stainburnt facehead bashed inreluctant herobitten in the neckshot in the handaltered version of studio logohead cut offevil womantrampolinebadgesitting on a toilettraffic accidentbouncerstabbed in the facecellreference to star warscut into piecesscatological humorvending machineimprovised weaponburn victimshot in the crotchhouse on fireanimal killingpunch in facestupid victimknocked out with a gun buttteenage heromale male hugoutbreakzombie attackscreaming womanscientific researchselfiehardware storeliquor storestabbed in the mouththroat rippingnight clubpaddlesurprise during end creditsbechdel test failednail gunaxe in the headbarricademan wearing a wigfalse teethcorporalscientific experimenthand through chestscouttoupeeblood on handsboy scoutgeneration yreference to britney spearssevered penisbustid cardtoilet stallabsurd violenceclassmate classmate relationshipstabbed in the crotchcleanerhit with a frying pantire ironstabbed in the foreheadvulgar languagehit with a car doorgory violencedead deerfirst aidscreaming girltaking off underwearmarshmallowmopwoman hits manmillennialrecruitmentcampsiteknothole in chestteeth knocked outfertilizeractor talks to audiencehordejaw ripped offmale female fightbiting someonerunning out of ammoface burntooth knocked outescape out a windowgarbage chutescoutingbank notecopped feelreference to dolly partonescape out windowhomemade explosivekilling a deerobscene hand gesturecat ladyescaping out a windowpenis ripped offlock pickingcagedweed whackerescape by the windowrecruitment videoreference to bambibitten in the armreading someone's diaryface blown offwater treatment plantgearing upzombie animalevil old womanheart massagescoutmasterstabbed through the neckzombie cat (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that …await. (Read More)
| Subgenre: | independent filmcult filmdark comedyslasher flickcreature featuresadistic horror |
| Themes: | murderdeathsurrealismkidnappingrapejealousyfeartorturefuneralmonsterseductiontheftdeath of fatherinsanitymental illness …sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
| Mood: | gorerainnightmareslasher |
| Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
| Characters: | family relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
| Period: | 1970syear 1977 |
| Story: | missing personurban legendlegendnumber in titlebloodviolenceflashbackbare chested maledancingphotographknifechasesurprise endingpistolfire …beatingdreamcorpsedigit in titleshot to deathblood splattercar accidentshot in the headshotgunslow motion scenewatching tvthongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenbound and gaggedaxestabbed to deathstabbed in the chesthousetied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesevil manlightningskeletonhanginghalloween costumelong takedisappearancecheerleadercrosssplit screenpigtied upcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerlanterndead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark househuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravitycandlelightliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
Helen Lyle is a student who decides to write a thesis about local legends and myths. She visits a part of the town, where she learns about the legend of the Candyman, a one-armed man who appears when you say his name five times, in front of a mirror. Of course, Helen doesn't believe all this stuff, …but the people of the area are really afraid. When she ignores their warnings and begins her investigation in the places that he is rumored to appear, a series of horrible murders begins. Could the legend be true? (Read More)
| Subgenre: | cult film |
| Themes: | revengekidnappingbetrayalghostprisonfearescapefuneralartinvestigationseductionangerpsychopathgriefabduction |
| Mood: | goreslasher |
| Locations: | schoolelevatorwheelchairapartmentchicago illinoisslum |
| Characters: | policeboyfriend girlfriend relationshipserial killerphotographerartistlittle boymotherpsychiatrist |
| Story: | urban legendlegendfemale nuditycharacter name in titlebloodone word titledogkisscigarette smokingtitle spoken by charactersurprise endingfirebeatingcorpse …mirrorpaintingrunningcollegetelephonetoiletfalse accusationdrivingcultbathgravestabbed in the backscreamingperson on firegraffitichild murderburned alivenipples visible through clothinggothicslow motionlifting someone into the aircovered in bloodparking garagemental institutionhatredmakeupbathingghettoblack eyedisfigurementcastrationbonfireframed for murdermental patientyellingtaking a photographlevitationneedlefolkloreforced to stripdead animalkilling a dogdiscoverybeeabandonmentgang violenceframedurban decaykidamputationbeliefmacabrealtarsecret passageaggressionhookbudweiserlifting female in airmuralhidden roomdead babyslide projectorrottweilerpublic restroomtall mandeath of doghousing projectlifting an adult into the airpast lifecheating on wifelynch mobfalse accusation of murderswarmdisbeliefdisembodied voicepolice lineupsociologistapartment complexaccused of murderfilthraw meatkiller beemedicine cabinetviciousnessbathroom mirrorbloody maryafter lifehook for a handhole in a wallabusive policemanloathingrepulsioncandymanloss of penisvacant apartmentdisbelieving authorityburnt hairhypnotized cast (See All) |
Every town has its own ghost story, and a local folktale around Ravens Fair is about a ventriloquist named Mary Shaw. After she went mad in the 1940s, she was accused of kidnapping a young boy who yelled out in one of her performances that she was a fraud. Because of this she was hunted down by town …speople who in the ultimate act of revenge, cut out her tongue and then killed her. They buried her along with her "children," a handmade collection of vaudeville dolls, and assumed they had silenced her forever. However, Ravens Fair has been plagued by mysterious deaths around them after Mary Shaws collection has returned from their graves and have come to seek revenge on people that killed her and their families. Far from the pall of their cursed hometown, newlyweds Jamie and Lisa Ashen thought they had established a fresh start, until Jamie's wife is grotesquely killed in their apartment. Jamie returns to Ravens Fair for the funeral, intent on unraveling the mystery of Lisa's death. Once reunited with his ill father, Edward, and his father's new young bride, Ella, Jamie must dig into the town's bloody past to find out who killed his wife and why. All the while, he is doggedly pursued by a detective who doesn't believe a word he says. As he uncovers the legend of Mary Shaw, he will unlock the story of her curse and the truth behind the threat from a rhyme in his childhood: if you see Mary Shaw and scream, she'll take your tongue. And the last thing you will hear before you die...… (Read More)
| Subgenre: | ghost story |
| Themes: | murderdeathrevengeghostfuneraldeceptionsupernatural powerdeath of wifemurder of family |
| Mood: | raincar chase |
| Locations: | cemeterysmall townapartmentmotel |
| Characters: | husband wife relationshipfather son relationshipdetectiveolder man younger woman relationshipstepmother stepson relationshipghost in mirror |
| Story: | urban legendtruthlegendbloodflashbackphotographsurprise endingfirecorpseshotguncamerafalling from heightflashlightmansionmap …police officer killedtheatergravecursescreamingclownpuppetwidowerdolldisappearancebasementsuspicionstageunderwaterchild murderpoemshavingfireplacerevelationgothicloss of wifepump action shotgunshovelrowboatdeath of protagonistrosetuxedolooking at self in mirrorlanterndead boydead woman with eyes openmannequinphoto albumclose up of eyesspiral staircasetombstonefalling into waterwhisperingfilm starts with textswimming underwaterhearsewheelchair boundmacabrefuneral homecoughing bloodclose up of eyeevil clownpackagestraight razorrocking chairmorticiantrail of blooddiscovering a dead bodybegins with textventriloquistpregnant woman murderedgrave side ceremonyextreme closeupsevered tonguedummyimitationmissing person posteroxygen tanktongue cut outfamily portraitdeath of pregnant womandripping waterhiding under the coverstongue rippingfamily photoventriloquismcoughing up blooddeath of expectant motherends with dedicationdeath starewhistling kettledigging up a gravefall through floordripping faucetdigging grave (See All) |
Meg Penny is a cheerleader out on her first date with one of the football players, Paul Taylor. It doesn't go very well. Before they get where they're going, an old vagrant runs out in front of Paul's car, screaming in terror. The old man is closely followed by Brian Flagg, the local teen rebel, com …plete with long hair, black leather jacket, motorcycle and tough-guy attitude. Paul blames Brian for chasing the old man, but after the threesome takes him to the doctor's office, it becomes clear the vagrant had more to worry about than some young tough. He was screaming because of the acid-like substance on his hand - a substance that spreads over his body and eventually consumes him. Soon, the growing red blob, which sprouts tentacles to attack its victims, becomes a menace to the small town of Arbeville, Colorado. The military soon arrives in Hazmat suits, led by the wide-eyed Dr. Christopher Meddows. They're from the government, they say, and they want to help; but Brian's distrust for authority figures proves justified when he learns of their true motives. (Read More)
| Subgenre: | independent filmcult filmblack comedysuspensestop motion animationcreature featureteen romancebody horror |
| Themes: | murderdeathfriendshipfeardrunkennessescapemonsterdeceptionmilitaryparanoiaredemptionpaniccourageself sacrificenear death experience …unlikely hero (See All) |
| Mood: | gorehigh schoolpoetic justiceone nighthorror movie remake |
| Locations: | woodshospitalchurchforestcarhelicoptersnowmotorcyclecemeterysmall townkitchenpolice stationpolice carouter spacesewer …car motorcycle chasemotorcycle chasetruck accident (See All) |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipdoctorbrother brother relationshipboybrother sister relationshipteenage girlteenage boysoldier …nursepriesttough guywaitressvillainbiblesheriffself mutilationhomeless manbiologistalcoholic drink (See All) |
| Period: | 1980s |
| Story: | crash siteurban legendcreaturebloodviolencedogguncigarette smokingexplosionchasesurprise endingpistolfirecorpseblood splatter …machine guncar accidentremakerescueslow motion scenecatcondomarrestheld at gunpointbombcafehandcuffsrevolverscientistdecapitationsurvivalorphanflashlightambushaxeambulancedeath of friendbridgefootballdinermapexploding carfalse accusationsevered headanti herodisarming someonechild in perilhit by a carpolice officer killedvannecklacetransformationdangerscreamingperson on firerace against timetentdeath of childtough girlscarhigh school studentcheerleaderfilm within a filmexploding bodydateratsevered armdismembermentgaragecold wardisastereavesdroppinghand grenadeburned aliverevelationelectronic music scorelooking at oneself in a mirrorviruscookwalkie talkieamerican footballmovie theaterphone boothrebelrocket launchermexican standoffcolonelpreachercrushed to deathsocial commentarybikereaten alivefemale warriormechanicrampagereverse footageexplosivebraveryu.s. armychaosevacuationinfectionone daydisfigurementraised middle fingerlonerstadiummutationjuvenile delinquentflamethrowerburned to deathtorso cut in halfleather jacketsatellitebazookablood on camera lensalleyfire extinguisherhit in the faceteenage lovefirst datearmored cartelephone boothpopcornpharmacycornfieldcrystalcrash landingdeputyexploding trucktentaclereverendjockfight the systemexperiment gone wrongmeteorquarantinewet t shirtparasitefacial scarcrowbardistrustfemale bartenderimprovised weaponburn victimcut handclimbing out a windowscience runs amokwalkmandate rapeteenage herooutbreakhookgovernment conspiracyearth viewed from spaceblond boypharmacistdrugstorefootball gamedecomposing bodysleeping pillfreezerbiological weaponhigh school footballmotorcycle stuntjumping from a carhazmat suitmotorcycle crashprojectionistyo yosinkmass deathbiohazardjarpart stop motionfreeze to deathbiological warfaregeiger counterblobmanholetown halldisbeliefliquid nitrogenteen rebeldrainmilitary secretplungerchild eatenface burnusherboy eatengroup of childrenspecimenreference to hansel and gretelcopped feelgelatinbad boygerm warfareorganismcar off bridgejelloquad bikeevil preachertoilet plungerteen heroteen couple eaten (See All) |
A scientific expedition searching for fossils along the Amazon River discovers a prehistoric Gill-Man in the legendary Black Lagoon. The explorers capture the mysterious creature, but it breaks free. The Gill-Man returns to kidnap the lovely Kay, fiancee of one in the expedition, with whom it has fa …llen in love. (Read More)
| Subgenre: | cult filmb moviecreature featuremonster moviecult classic |
| Themes: | murderdeathmonsterunrequited love |
| Locations: | beachboatshipfishing boatsea monster |
| Characters: | boyfriend girlfriend relationshipship captainfemale scientist |
| Story: | creaturebare chested malefightphotographknifechasevoice over narrationshot in the chestcolor in titlescientistshot in the backsubjective camerastabbed in the chestunderwater scenefive word title …first partlifting someone into the air3 dimensionalexpeditionamazonscuba divingorchestral music scoreman on firepsychotronic filmfossilset on fireopening narrationdead fishlifting a female into the airlifting an adult into the airhorror iconlagoonspear gununderwater fightunderwater photographyscuba diveramazon riverfishing netbig bangpaleontologycult favoriteamazon rainforestbeauty and the beastmarine biologistdeveloping a photographmonster as victimman in a swimsuitmissing linkmonster huntingscientific discoveryuniversal monstersday for nightwebbed fingersfemale in a swimsuitgill manshared universeunderwater camera (See All) |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto …p her from constantly getting visions of Jessica's fate. (Read More)
| Subgenre: | independent film |
| Themes: | murderdeathsuicideinfidelityghostjealousyadulteryinvestigationdeceptionincestextramarital affairdeath of fathersupernatural powerunfaithfulnessmental illness …father daughter incest (See All) |
| Mood: | rainnightmare |
| Locations: | woodsschoolcemeterysmall townbathtubwaterrural settingwheelchaircourtroomstormbackwoods |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattooboylawyersingle motherlustwitchsheriffsuicide by hanging |
| Story: | missing personmissingfemale nudityf ratedbloodviolencefemale frontal nudityflashbackmasturbationmale rear nuditydogtwo word titlebare chested malegunfight …dancingphotographexplosionpartyleg spreadingpantiestelephone callfirebeatingdreamcorpsewatching tvthongbare buttsecretliedead bodysex standing uphallucinationhandcuffscleavagecandlestrangulationwomanwidowwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All) |
In the year 1752, Joshua and Naomi Collins, with young son Barnabas, set sail from Liverpool, England to start a new life in America. But even an ocean was not enough to escape the mysterious curse that has plagued their family. Two decades pass and Barnabas (Johnny Depp) has the world at his feet-o …r at least the town of Collinsport, Maine. The master of Collinwood Manor, Barnabas is rich, powerful and an inveterate playboy...until he makes the grave mistake of breaking the heart of Angelique Bouchard (Eva Green). A witch, in every sense of the word, Angelique dooms him to a fate worse than death: turning him into a vampire, and then burying him alive. Two centuries later, Barnabas is inadvertently freed from his tomb and emerges into the very changed world of 1972. He returns to Collinwood Manor to find that his once-grand estate has fallen into ruin. The dysfunctional remnants of the Collins family have fared little better, each harboring their own dark secrets. Matriarch Elizabeth Collins Stoddard (Michelle Pfeiffer) has called upon live-in psychiatrist, Dr. Julia Hoffman (Helena Bonham Carter), to help with her family troubles. (Read More)
| Subgenre: | black comedydark comedyfish out of watergothic horrorvampire comedy |
| Themes: | revengesurrealismsuicideghostjealousydrunkennessmagicsupernatural powertime traveldysfunctional familyunrequited lovealcoholismmadness |
| Mood: | spoofnightmare |
| Locations: | woodsbarcemeterysmall townshipcastlecampfiresinging in a carfire truckabandoned factoryfishing village |
| Characters: | family relationshipsfather son relationshippoliceteenagermother daughter relationshipsingerpolice officerpolicemanvampirepsychiatristwitcholder man younger woman relationshipfishermanship captaingo go girl |
| Period: | 1970s20th century18th centuryyear 1972 |
| Story: | learning the truthaliveold manbloodflashbacktwo word titletitle spoken by characterpartyfirevoice over narrationcorpseshotgunswordfalling from height …shootingpaintingshowdownsunglassesgood versus evilorphanmassacreambulancemansionmontagedinerrock bandno opening creditscoffinfishingunderwater scenefemme fatalepantyhoseold womangunshotcursebased on tv seriesfactoryumbrellamanipulationreference to william shakespeareundeadstrong female characterwerewolfactor playing himselfsabotagefireplacediscowarehousegothictape recorderred dresstreasureexploding buildingwitchcrafttherapistservantmobrailway stationstrong female leadmind controlblack humortorchhitchhikingmental institutionsexual desirecamera shot of feetcrime scenepump action shotgunconstruction sitecynicismblood on faceintriguehippiedark humorimmortalityhypnosisheartclifffemale doctorcanered pantiesbarefoot femalepassionate kisschainbrushing teethblack magicfamily secretimprisonmentfemale stockinged feetmarijuana jointcartoon on tvburied alivelost lovemasturbation referencehanging upside downpsychedelicfoot closeuppocket watchstrait jacketfamily businesschandelierpunsexual frustrationevil womanmanipulative behaviorbechdel test passedreference to shakespeare's romeo and julietimmortalseductive behaviorvampirismmainefemale bosslack of moneysecret passagehouse fireold housefeet on tablechainsmagic spellgas explosionpointing a gun at someonesecret roomestranged fathersailing shipseductive womanfemale antagonistfemale to male footsie playingplaying footsieangry mobselfish womanfalling off a cliffmanorrenovationblood drinkinghidden roomdrinking bloodbossy womanmirror ballpassenger trainpretending to be someone elsepsychological manipulationelectroshock therapyexhumationgovernessmanipulative womanblood transfusionsecret passagewaygrand pianoforced suicidetriceratopsfemale psychiatristactor playing dual rolesmoking after sexdisco balltaking off underwearvolkswagen busliverpool englandestranged daughterlava lampbuilding explosionfemale stockinged solesreference to mcdonald's restaurantfemale werewolfactress playing dual rolesplashed with waterred lingeriefactory ownergender confusiongold watchpumpkin patch1770sbare feet on tableteen bedroomspurned womanfalling chandeliermephistophelesfisherybank check1760sbackhoebolt cutterwaffle1750swicked witchpatterned pantyhoseeighteenth centurymale stockinged feetbelief in ghostsreference to alice coopertransfusionred pantyhosetroll dollstar cameochanging one's namecannerycynical womandumping dead bodyfemale seductionimmortal manyear 1776 (See All) |
Following the events of Alien vs. Predator, and the maturation of the chestburster that erupted from the body of Scar (the Predator that defeated the Alien Queen) into an adult Predalien, the Predator scout ship crashes in the woods of Gunnison County. A local, Buddy Benson, and his son, Sam, are hu …nting in the forest and witness the crash, but they are chased and are implanted with alien embryos by facehuggers along with several homeless people living in the sewers. Meanwhile another Predator lands seeking out the Alien and destroying evidence of their presence on Earth. The dwellers of the town find themselves in the middle of a battlefield between the two deadly extraterrestrial creatures, and the small group of survivors splits between the leadership of Sheriff Eddie Morales and the bad-boy Dallas Howard. Both have different opinions about the best means to escape from the beings. (Read More)
| Subgenre: | cult film |
| Themes: | murderdeathpregnancyescapemonsterdeceptiondeath of fatherbrutalitysadismhomelessnesshuntingmurder of a police officer |
| Mood: | gore |
| Locations: | woodshospitalschoolforesthelicoptersmall townsewerhumvee |
| Characters: | boyfriend girlfriend relationshipbrother brother relationshipalienbullysheriffhomeless mandeath of girlfriend |
| Story: | missing personcrashbloodviolencesequeldogsurprise endingpistolshot to deathblood splattershot in the chestshot in the headshotgunsecond partshot in the back …flashlightbased on comic bookimpalementstabbed to deathdinerstabbed in the chestno opening creditsacronym in titlechild in perilshot in the foreheadstabbed in the backkeycover updeath of childtankexploding bodyratsemiautomatic pistolex convictsevered armdismembermentchild murderkilling an animalmorguewristwatchcolonelveteranpower outageevacuationm 16stabbed in the headexploding headplaystation 2deermutationlasersightdeath of loved oneprequelgirl in bra and pantieshead blown offacidnight visioncoloradohanging upside downhelicopter crashcrash landingpredatorbased on graphic novelbloody body of childcrushed headstabbed in the shouldercrossovernuclear bombparasitealien planetestrangementcut into piecesnuclear explosionnight vision gogglesversus in titlealien creaturegovernment conspiracyinfanticidepizza delivery boyhuman versus alienchevroletalien technologypregnant woman murderedair strikehomeless womanpepsihybridnational guardskinned alivegun storestabbed in the foreheadgreen bloodmismatched bra and pantieshunting rifleindoor swimming poolmelting facexenomorphalien space craftdark horse comicsinfestationspaceship crashhondanissanstorm drainford motor companyalien hunterinfrared visioninvisibility cloaksporting goods storealien artifactfalling down an elevator shaftford taurushonda civicextraterrestrial alienalien breedingalien versus alienchevrolet capricehonda accordjeep cherokeedodge the carhuman body alien host (See All) |
The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l …ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)
| Subgenre: | independent filmcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror |
| Themes: | murderdeathrevengemonsterpsychopathsupernatural powerevildrug addictionmurder of a police officer |
| Mood: | gorerainhigh schoolslasher |
| Locations: | woodsnew york cityboatseacityamericasewer |
| Characters: | teenage girlteenage boyzombiepolice officerserial killerkillervillainteacher student relationshipterrorslasher killermysterious villainserial murderer |
| Period: | 1980s |
| Story: | jerseybody countfemale nuditycharacter name in titlenumber in titlebloodviolencesequelbare chested maleexplosionpantiesblood splattermirrornumbered sequeldemon …hallucinationguitarmanhattan new york citydecapitationflashlightgangnew yorkstrangulationaxevideo camerastabbingthroat slittingimpalementstabbed to deathsubwaywhite pantiesexploding carnecklacedrowningon the runblack pantieselectrocutioncharacter's point of view camera shotevil manattempted rapeunderwaterundeadmaniachypodermic needlelifting someone into the airmutilationpsychoback from the deadmasked manmale underwearrampagenew jerseybutcherblack bradead childdisembowelmentslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritemasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villainknife murdertoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermurder of a nude womanmurder spreemass murdererghoulbutcherybody paintblond boyeighth partpolice officer knocked unconsciouspsycho terrorstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear guneast coastjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyserial teen murdererbig applegirl strangling (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
| Subgenre: | black comedysuspensesuperherotragedypsycho thrillersurvival horrorteen horrorpsychological thrilleramerican horror |
| Themes: | murderdeathfriendshipsurrealismkidnappingrapebetrayalfearescapefuneralmonsterdeceptionvoyeurismpsychopathdeath of father …brutalityparanoiainsanitymental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
| Mood: | goreneo noirslasher |
| Locations: | woodstrainforesttaxikitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
| Characters: | father daughter relationshipteenagerafrican americandoctorteenage girlpolice officerserial killerhostagekillersecurity guardvillainpsychiatristterroruncle niece relationshipslasher killer …serial murdererpolice dog (See All) |
| Period: | 2010s |
| Story: | missing personbody countbloodviolenceone word titlesequelflashbackdogbare chested maledancingtitle spoken by characterpartyknifechasesurprise ending …pantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shottentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingmaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
| Subgenre: | found footageparanormal |
| Themes: | murdersuicideinfidelityghostpregnancysupernatural poweralien abduction |
| Mood: | gore |
| Locations: | hospitalswimming poolforestlakemotelwater gun |
| Characters: | doctorbrother sister relationshipzombiealienself mutilation |
| Story: | missing personcreaturefemale nuditybloodmale nuditysequelfemale frontal nudityinterviewmale frontal nuditydogbare chested malesex scenemale full frontal nudity …explosionpistolcell phoneshot to deathblood splattershot in the chestshot in the headshotguncar crashbathroomdemonshot in the backsubjective camerafoot chasegay slurvideo camerathroat slittingstabbed to deathcultno opening creditschild in perilhit by a carbirthday partybreast fondlingspaceshipunderwater sceneanthologydrowningpoint of viewpoisoncharacter's point of view camera shotdeath of childcollege studentprankexploding bodylaptopneck breakingcharacter says i love yousubtitled sceneufoundeadprivate detectivekilling an animalbarnnosebleedsevered handcovered in bloodteddy beareaten alivepump action shotgunmale masturbationsurveillance camerasevered fingerstabbed in the throatstabbed in the neckfalling to deathdisembowelmenttitle at the endeye gougingraised middle fingerstabbed in the eyelooking at self in mirrorlens flarehit with a baseball batblood on camera lensintestinesvideo tapehead blown offurinehead bashed inrazorplaying a video gamevhsshot through the mouthcrowbarcommunepeep holevcrdocumentary crewsleeping bagthroat rippingmedical experimentstrobe lightnational parkcult leadercyclistfemale vomitingbitten on the armghost childslumber partyvhs tapeburnt handimplantmass suicidevomiting bloodsleepoverhit on the head with a rockbitten in the facefinger bitten offbox cuttermountain bikingjaw ripped offcompoundwater balloonbitten on the legsleeping in a bathtubbarbecue grillhelmet camerahollywood hills (See All) |
John Klein is involved in a car accident with his wife, but while he is unharmed, his wife mentions a moth shaped creature appearing. After her death, John begins to investigate the secrets behind this mentioned Mothman. It takes him to a small town of Point Pleasant, West Virginia, where he discove …rs a connection with the same problem. Here he meets Connie Mills, while he continues to unravel the mystery of what the Mothman really is. (Read More)
| Subgenre: | paranormal phenomenaconspiracy theory |
| Themes: | christmasobsessionsupernatural powercancerdeath of wife |
| Locations: | hospitalsmall townpolice carmotelchicago illinoissex in carsex in a closet |
| Characters: | policepolice sergeant |
| Story: | urban legendcreaturebased on novelthree word titletelephone calldreamcar accidenthallucinationreporterjournalistbridgedrawingunderwater scenewidowerproduct placement …policewomanpsychicwashington d.c.disasterlooking at oneself in a mirrorsex on floorloss of wifecrying manearthquaketime lapse photographysketchairplane crashfrustrationlipstickdeath of loved oneman cryingreal estate agentohiobroken windowgovernorbroken mirrortraffic jamwhisperinghearing voicespremonitionwarningtow truckcar breakdowndead wifedriving at nightbrain tumorends with textchristmas decorationstumorcar wreckrunning for your lifebrain surgerytraffic lightphone ringingbased on supposedly true storyextreme closeupcharacter appears on tvwest virginiavoice mailcryptozoologyecuadoromentearbridge collapsewind chimemysterious eventsnews broadcasthypothermiaringing telephonecolumbus ohioear bleedingprecognitioncat scanblack outcar falls into waterwreckchemical plantdripping watermysterious voicemagnetic resonance imagingunplugged electronic worksmothmanmysterious telephone callbright lightrecounting a dream2 years laterbroken electronic worksstrange happeningswashington post the newspaperdeath by exposure (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
| Subgenre: | cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
| Themes: | murderdeathfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness …murder of a police officermurder of family (See All) |
| Mood: | goresatirenightmaremurder of a boy |
| Locations: | woodshospitaltrainforestcemeterybuslondon englandtaxivillagerural settingapartmentpolice carenglandtrucktaxi driver …laboratorysex in shower (See All) |
| Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant …jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
| Period: | 1980s |
| Story: | college studentstwo friendslegendsexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested male …sex scenefemale rear nuditycigarette smokingknifechasesurprise endingshowertopless female nuditydreamcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reporttransformationfive word titleracial slurpublic nuditycursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londonquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
| Subgenre: | cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
| Themes: | murderdeathfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurismpsychopathbrutalitysupernatural powerparanoia …sadismevilpanicmysterious deathshower murder (See All) |
| Mood: | gorerainhigh schoolnightmareslasherdarknesspoetic justice |
| Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
| Characters: | family relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacher …girlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
| Period: | 1980syear 1985 |
| Story: | urban legendbody countlegendcreaturecharacter name in titlenuditynumber in titlebloodmale nudityviolencesequelmale rear nuditybondagedogbare chested male …fightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilspankingtransformationbartenderpublic nuditystabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
Minature green monsters tear through the small town of Kingston Falls. Hijinks ensue as a mild-mannered bank teller releases these hideous loonies after gaining a new pet and violating two of three simple rules: No water (violated), no food after midnight (violated), and no bright light. Hilarious m …ayhem and destruction in a town straight out of Norman Rockwell. So, when your washing machine blows up or your TV goes on the fritz, before you call the repair man, turn on all the lights and look under all the beds. 'Cause you never can tell, there just might be a gremlin in your house. (Read More)
| Subgenre: | cult filmblack comedystop motion animationholiday horrorchristmas horror |
| Themes: | friendshipchristmasmonsterunlikely hero |
| Locations: | barswimming poolsmall townwater |
| Characters: | family relationshipsboyfriend girlfriend relationshipmother |
| Period: | 1980swinter |
| Story: | urban legendcreatureone word titledogtitle spoken by charactervoice over narrationpart of seriestransformationpuppetsuburbfirst of seriesproduct placementchristmas treebankgift …first partcult directorpubrecord playerholidaychainsawelectronic music scorebeer drinkingexploding buildingmovie theaterblockbustersocial commentaryrampagecrossbowinventorpsychotronicyoung lovegadgetpetcar troublecartoon on tvfountainanimal crueltydepartment storebankerslingshotorchestral music scoresnowmanchinatownhorror for childrentoy carmicrowave ovenanimal in cast creditsbarmaidmidnightfire alarmshopkeepermicrowaveskunkmass destructionfreak accidentbank tellercandy barcoors beerflasherreference to snow whitescience teachergremlinsnowplownegative asian stereotypebroken ruledumb copbright lightswimming bathslight sensitivitysalespeoplegreedy bankerreference to pepe le pewyoung men's christian association (See All) |
Harry Angel has a new case, to find a man called Johnny Favourite. Except things aren't quite that simple and Johnny doesn't want to be found. Let's just say that amongst the period detail and beautiful scenery, it all gets really really nasty.
| Subgenre: | independent filmcult filmsupernaturalpsychologicalpsychological horrorsupernatural thriller |
| Themes: | devilmurderdeathdrugsreligioninvestigationmagicincestmemorycorruptionsupernatural powerblackmailgamblingcannibalismamnesia …murder investigationdeath of daughterfather daughter incest (See All) |
| Mood: | goreneo noir |
| Locations: | hospitalnew york citybarbeachrestauranttrainchurchhotelsnowbathtubbuselevatorfarmtrain station |
| Characters: | father daughter relationshipdoctorsingerteenage girlsoldierserial killernursedetectivemusicianbabypriestlawyerinterracial relationshiplustpolice detective …biblemaidfrenchself discoverypolice arrestfather daughter sex (See All) |
| Period: | 1950s |
| Story: | missing personold mancharacter name in titlebased on novelbloodfemale frontal nudityflashbackmale rear nuditydogtwo word titlebare chested malesex scenefemale rear nuditycigarette smoking …interracial sexdancingnipplesphotographsingingsurprise endingpantiespistolcryingdreamcorpseshot to deathblood splatterfistfightmirrorcatwritten by directorvomitingtearsrunninginterrogationpianodemonhallucinationrevolverrivermanhattan new york cityfoot chaseflashlightbracandlemansionbridgestabbed to deathdinertoiletstabbed in the chestsevered headnundream sequenceritualsearchgraveyarddrowningbartenderracial slurgunshotgravedrug addictmicrophonekeyuniformstatuescreamringscene during end creditspianistpursuitcountrysideglassesratstagechickenjazzprivate detectiveapplauseoccultidentityspiritkilling an animalhead buttbreaking and enteringcophypodermic needleeggtape recorderperformancecomamutilationpatientguitaristbuttocksmovie theatersevered handtimecovered in bloodnew year's eveaudiencebrooklyn new york cityparadeanimal attackpreachermental institutionwatching televisionfannew orleans louisianajunkiescene after end creditssuperstitiondisembowelmentheartblood on shirtchoirsoulrainstormcanecastrationlooking at self in mirrorpastorfortune tellervoodooblack magicmusic bandprivate investigatorposteratheistwoman in bathtubdrumsgarterbeing followedceremonyinvestigatorfountainbaptismlouisianaspiral staircasehorse racingperformerarcadeanimal crueltysatanismbroken mirrormaking outclinichearing voicesinterracial kissgramophoneshot in the eyelistening to radiowhistlingrazormarching bandafrican american womanstablecleaning ladyolder man younger woman sextimes square manhattan new york citycrabbettingritecrowbarmorphinesymbolheart ripped outhorse and wagoniconpentagramaltarprivate eyecut handmurder of a nude womankicking in a doorpart of the body in titletrenchcoatharlem manhattan new york citydeal with the devillockworld war two veteranstraight razortap dancingevil childgenital mutilationfuneral processionluciferphonograph recordshackstreetcarbody part in titlesatanic ritualincestuous sexdevil worshipcajunconey island brooklyn new york citydog bitenylonswashroomsouthern gothicafroelectric fananimal sacrificeblood on the floorcockfightyear 1955ice pickpriestesssoul transferencemarqueeherbincantationtarot cardsbloodstainoccult ritualmedicine cabinetfreight elevatorlost soulconey islandpit bullharlemfaustianjubilationscaldingpalm readerpick up truckfoot bridgeslumscongafather murders daughteroccult detective17 year old girlbongosposing as a doctorid tagsearch for selfbreaking a lockhoodoopoughkeepsie new yorkfaustian bargaingumboself search17 year old daughterfather kills daughter (See All) |
Seth Brundle ('Jeff Goldblum' (qv)), a brilliant but eccentric scientist attempts to woo investigative journalist Veronica Quaife ('Geena Davis' (qv)) by offering her a scoop on his latest research in the field of matter transportation, which against all the expectations of the scientific establishm …ent have proved successful. Up to a point. Brundle thinks he has ironed out the last problem when he successfully transports a living creature, but when he attempts to teleport himself a fly enters one of the transmission booths, and Brundle finds he is a changed man. This Science-Gone-Mad film is the source of the quotable quote "Be afraid. Be very afraid." (Read More)
| Subgenre: | cult filmtragedycyberpunkcreature featureallegorybody horror |
| Themes: | suicidejealousypregnancymonsterparanoiaabortionfalling in love |
| Mood: | gorenightmare |
| Locations: | hospitallaboratory |
| Characters: | love triangledeath wish |
| Period: | 1980s |
| Story: | ex boyfriendcreaturemale nudityviolenceinterviewmale rear nuditybare chested malesex scenedreamremakeshotgunslow motion scenecomputeranimal in titlescience …scientistreporterlatex glovesstalkingfirst partcult directorexperimentlifting someone into the airmutantmad scientistmagazinemale underwearscissorsexploding headmutationbriefsteleportationintestinesmedical masksurgical masksuper strengtheditordental maskgenetic engineeringmetamorphosisteethwoman wearing only a man's shirtexperiment gone wrongorchestral music scoresuperhuman strengthtragic loveanimal experimentationarm wrestlingex loverpsychotronic filmfamous lineassisted suicidescience runs amokweepingarm ripped offphysicistmoral ambiguitylifting a female into the airlifting an adult into the airsteakpleadingremake of cult filmearbaboondefenestrationdoomed romancestrange behaviorgrand guignoljaw ripped offmedicine cabinettrailer narrated by hal douglasstockingfingernailmonster as victimloft apartmentblurred boundariescountdown timergenetic alterationwall climbingwoman takes off stockingremoving a fingernailvoice recognition (See All) |
Set in the town of Chanderi, Stree is based on the urban legend of Nale Ba that went viral in Karnataka in the 1990s, and features Shraddha Kapoor and Rajkummar Rao in pivotal roles.
| Themes: | friendshipghostdrinkingfearsupernatural powerabduction |
| Mood: | nightdarkness |
| Locations: | woodsmotorcyclesmall townbuscampfiretown |
| Characters: | father son relationshipprostitutedancerwitch |
| Period: | 1990s |
| Story: | urban legendlegendtitle spoken by characterpartysurprise endingcell phoneurinationcatundressingsecretletterbookalcoholsubjective cameraflashlight …montagescreamingattackpossessionreference to william shakespearefriendship between menjoggingtempletorchsuperstitionbookstoreblack magicbroken windowsewing machinemysterious womanchosen onebare midriffvengeful ghostwriting on wallimplied male nuditydark alley (See All) |
In a small town in Massachusetts, four high school girls perform a ritual in an attempt to debunk the lore of Slender Man. When one of the girls goes mysteriously missing, they begin to suspect that she is, in fact, his latest victim.
| Subgenre: | suspensesupernaturalvideocreature featureteen moviesurvival horrorteen horrorsupernatural horrorpsychological horror |
| Themes: | murderdeathfriendshipsurrealismkidnappingfeardrunkennessescapemonstersupernatural powerinsanityevilhome invasionpanicself sacrifice …madnessmythologynear death experience (See All) |
| Mood: | high schoolnightmarenightdarkness |
| Locations: | woodshospitalschoolforestcemeterysmall townpolice carschool bustown |
| Characters: | family relationshipshusband wife relationshipfather daughter relationshipteenagermother daughter relationshipdoctorteenage girlteenage boyfemale protagonistpolice officernursesister sister relationshipbest friend |
| Period: | 2010s |
| Story: | missing personurban legendcreatureviolenceflashbacktwo word titlekissphotographtitle spoken by characterchasesurprise endingshowercryingcell phoneslow motion scene …arrestdemonhallucinationsubjective camerasurvivalflashlightstrangulationinternetfalse accusationdrawingritualtransformationtreelibrarydangerscreamingproduct placementdisappearancehigh school studentlaptopblindfoldobscene finger gesturelove interestoccultgothiclooking at oneself in a mirroryoutubevictimteenage protagonistinterracial friendshipfull moonvisionmercilessnesspower outageescape attemptraised middle fingersuspecttext messaginghysteriaevil spirittentaclemassachusettsmacabrecamera phonepsychotronic filmstupid victimgrindhouse filmmissing daughterpanic attackvinylskypemissing person posterscreaming girlshape shiftingslender manschool tripscience classgender in titlemysterious creaturegirl in perilopening creditssupernatural creaturered haired girlsummoning a demon (See All) |
The six-member crew of the International Space Station is tasked with studying a sample from Mars that may be the first proof of extra-terrestrial life, which proves more intelligent than ever expected.
| Subgenre: | detective story |
| Themes: | lovespace travel |
| Mood: | atmosphere |
| Locations: | outer spacespacespace stationstation |
| Characters: | alienterrorex militaryin love |
| Period: | near future |
| Story: | horror moviepick uplow budgetcreaturesciencelong takethreatplanetseriesteamastronautone dayextraterrestrialsuitelementary school …wheelchair boundhandfictionalien planetscience fictionzero gravityblue collartrapped in spacemedia frenzybeing watchedlocationpuzzle solvingorderfeature filmplayingnew homeblobmix uplab ratextra terrestrialshape shiftingshape shifting alienproduction designalien life formspace probethoughtextraterrestrial lifeprobeprooflaborganism2013close encounteralien organismanother planet20152017lab mouseplayersrubber glovesampleteam leaderartificial gravityback to lifebreaking freespace crewmaking upintelligentplanet mars (See All) |
Daniel Rey along with his wife, Kristi; daughter, Ali; toddler son, Hunter, and their dog, move to Carlsbad, California. A few days later their residence is broken into, however, nothing appears to be missing. In order to prevent re-occurrences, they install a number of security cameras that will re …cord everything on a DVR. After they hire a Spanish-speaking nanny to look after Hunter, she informs them that there is something wrong in their house and performs prayers, much to the chagrin of Daniel, who lets her go. He will subsequently regret this decision as more inexplicable and strange incidents occur, with Ali concluding, after a research, that their house may be possessed by a demonic entity. (Read More)
| Subgenre: | cult filmmockumentaryfound footage |
| Themes: | murderdeathkidnappingsupernatural powerhome invasion |
| Locations: | swimming poolbathtubkitchen |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabysister sister relationshipterroraunt niece relationshipaunt nephew relationshipcrying babybikini girlstepmother stepdaughter relationship |
| Period: | year 2006 |
| Story: | missing personmissingnumber in titlesequeldogbare chested malefightphotographsurprise endingfiredigit in titlemirrorrescuewatching tvsecond part …numbered sequeldemonsubjective camerabedroomcaliforniavideo camerahouseno opening creditschild in periltalking to the cameracharacter repeating someone else's dialoguesuburbfired from the jobactor shares first name with characterbasementneck breakingcharacter says i love youwhat happened to epilogueflyinglifting someone into the airsecurity camerawalkie talkiecrucifixhot tubdemonic possessionliving roomnannyphoto albumlaptop computerpractical jokexboxvideo surveillanceyellinggerman shepherdnight visionno title at beginningfilm starts with textactress shares first name with characterunsubtitled foreign languagefilmed killinghome videoouija boardwoman in a bikinidead birdbilingualismdeal with the devilends with textrocking chairnail polishshaky camcribaction figurehdtvbaby monitorno music scorescratchanimate objectburning a photographpool cleanerpainting toenailsbite markhorror movie prequelprequel and sequelolive oilmaking a bedevploud noiseno background scorefast forwardjumping into a poollocked out of housedragged down stairsmazda miata (See All) |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends …up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
| Subgenre: | independent filmcult filmblack comedysuspensesupernaturalparanormal phenomena |
| Themes: | murderdeathsurrealismsuicidefearescapemonsterinvestigationdeceptionparanoiainsanityapocalypseself sacrificepolice brutalityghost town …end of mankind (See All) |
| Mood: | neo noirnightmare |
| Locations: | new york citybarchurchhotelcarsmall townbusbicycleelevatormoteltunneltownnew england |
| Characters: | policedoctorpolice officerwriterlawyerpsychiatristsecretaryhomeless manself referentialinsurance agentevil monster |
| Period: | 1990s |
| Story: | missing personcreaturebloodviolenceflashbackdogguncigarette smokingtitle spoken by characterchasesurprise endingbeatingcorpseshot to deathblood splatter …car accidentshot in the chestshot in the headshotgunarrestpaintingbookriflecar crashbathroomdemonhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilfoot chaseaxeambulancebridgedinerweaponnonlinear timelineanti herodrawinghit by a carnews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonecharacter's point of view camera shotlightningcrossfilm within a filmbasementsuspicionmurderercinemasevered armcult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudtorchend of the worldanimal attackschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murdermutationasylumriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguninsane asylumcornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All) |
The American software designers Sean and Ben travel to Moscow to sell their software to investors. However, their Swedish partner Skyler pulls a fast one on Sean and Ben, and they are out of the business. They go to a nightclub, where they meet American Natalie and Australian Anne and they flirt wit …h the girls and see Skyler in the club. Out of the blue, the population is surprised by lights, which they mistake for natural phenomena. But soon, they learn that the lights are aliens invading Earth and using power supply to annihilate mankind. Sean, Ben, Natalie, Anne and Skyler hide in the kitchen and when they leave the place, they seek out survivors on the street. Are they the last people on Earth? (Read More)
| Subgenre: | post apocalypse |
| Themes: | friendshipbetrayaldrunkennessescapeself sacrificemurder of a police officer |
| Locations: | airplanebusnightclubtaxiairportapartmentrooftopsubmarinenuclear submarinerussian submarine |
| Characters: | teenageralienamerican abroadaustralian abroad |
| Story: | crash sitecreaturedogexplosionchasethree word titlepistolcell phonehorserescuecatheld at gunpointscientistsurvivalfoot chase …massacrebridgesubwaymapradiounderwater sceneelectrocutionproduct placementexploding bodyak 47killing an animalgroup of friendsloss of friendrocket launcherend of the worldalien invasionresistancepower outage3 dimensionalshopping mallm 16lens flarecharacters killed one by onebullet timemoscow russiatracking devicetext messaginginvisibilityelectricitymolotov cocktailshipwreckplane crashflaredepartment storeembassyalien contactiphoneimprovised weaponflare gunresistance fighterpet catmcdonald's restaurantwoman wearing black lingerieairlinerbird cageflame throwerlight bulbbuilding collapseray gunabandoned carstray dogelectromagnetic pulsewet jeansaurora borealisuh 60 blackhawk helicopterdisintegrationreference to nirvanarocket propelled grenadesosaustralian accenttrip and fallwoman changing clothesbusiness ideadeserted citystatic electricityinvasion of earthinvisible beingdetectorhiding under a carflying through a stormtelescopic sightwoman disintegratedbabushkafaraday cagetube station (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
| Subgenre: | independent filmcult filmblack comedysuspensetragedypsycho thrillerslasher flicksurvival horrorteen horroramerican horrorindependent horror |
| Themes: | murderdeathfriendshipkidnappingfeartortureescapepsychopathbrutalityparanoiadysfunctional familyinsanitysadismevilexploitation …paniccannibalisminheritancemadnessnear death experience (See All) |
| Mood: | avant gardeslasherdarknessambiguous ending |
| Locations: | carcemeterykitchenwheelchairfarmroad triptruckgas stationtexascountryback country |
| Characters: | family relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipteenage girlteenage boyserial killerhostagekillervillainterrorself mutilationtruck driverslasher killer …serial murdererself inflicted injury (See All) |
| Period: | 1970syear 1973 |
| Story: | urban legendbody countlow budgetbloodviolencephotographknifechasesurprise endingvoice over narrationbeatingcorpseblood splatterurinationblonde …camerawritten by directorfalling from heightvomitingsunglassesrunninglow budget filmcollegedecapitationsurvivalfoot chaseflashlightbound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crosscontroversyvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackfirst of seriesproduct placementevil manknocked outskeletonscardeath of brotherhairy chestcountrysidetragic eventstalkingglassespigmurderertied upfirst partthreatened with a knifechickendirectorial debutgrandmothercult directorcross dressingcowkillingsplatterfreeze framemaniacpickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbusterpsychocovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensiongrandfatherhippiecannibalmercilessnessdark humormutebutcherpsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuelens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesserial murderpsychopathic killerbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark housescene before opening creditshuman monstermeatestatetexanabandoned househomicidal maniacfarmhouseanimal crueltyslashingcar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballsummer vacationdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handmurder spreeclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airbutcherygrindhouse filmsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpsesummertimeporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All) |
In Tokyo, Shigeharu Aoyama is a widower that grieves the loss of his wife and raises his son Shigehiko Aoyama alone. Seven years later, the teenage Shigehiko asks why his middle-aged father does not remarry and Shigeharu meets his friend Yasuhisa Yoshikawa, who is a film producer, and tells his inte …ntion. However, Shigeharu has difficulties to approach to available women to date and Yasuhisa decide to organize a sham audition for casting the lead actress for the fake movie. They receive several portfolios of candidates and Shigeharu becomes obsessed by the gorgeous Asami Yamazaki. Despite the advice of the experienced Yasuhisa, Shigeharu calls Asami to date and he falls for her. But who is the mysterious Asami? (Read More)
| Subgenre: | independent filmcult filmpsychological thrillersadistic horror |
| Themes: | murderdeathfriendshipsurrealismmarriagedrinkingfeartortureangerdivorcelonelinesspsychopathobsessiondeath of motherparanoia …drug usegriefdatinghumiliationsadismabusecrueltydeath of wifestarvationreligious cult (See All) |
| Mood: | rainnightmare |
| Locations: | hospitalbarbeachrestauranthotelelevatorwheelchairjapansearooftop |
| Characters: | husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipdoctorboyteenage girlteenage boynursedanceractresslittle girllittle boy …japaneseolder man younger woman relationshipfathersingle fatheruncle niece relationshipaunt niece relationshipself destructivenessstepfather stepdaughter relationship (See All) |
| Period: | 1990s |
| Story: | missing personmissingold mansexfemale nuditybased on novelnuditybloodviolenceone word titlefemale frontal nudityinterviewflashback …dogbare chested malekisscigarette smokingdancingnipplesphotographtitle spoken by charactererectionpantiestelephone callcell phonedreamunderwearmirrorwatching tvcomputerdrinkundressingvomitingliebeerbedcafepianohallucinationtelephonesubjective cameradecapitationfoot chasebedroombraconcertstrangulationvideo cameraambulancesuicide attemptfishdinnerchild abusesevered headfishingtonguecontroversysearchfemme fatalemarriage proposalcoffeebartenderpaintrainingflash forwardbusinessmanwidowerliarumbrellaauditionscreamscarpianistdisappearanceinjectiondateballetdismembermentfalling down stairssyringekilling an animaldesirehypodermic needlelooking at oneself in a mirrorhappinessmutilationoverallslosssadomasochisms&mtokyo japansufferingsevered fingerpet dogsonco workerscissorsschool uniformlaughterpedophilefilm producerperversionstabbed in the eyehousekeeperroommisogynyplaying pianodead dogceremonypiano playerpervertvideo tapewifeneedleparalysiskilling a dogmen's bathroomstairwaysubtitlesstepfathersexual perversionfemale psychopathmasochismtraffic jamyoung womanhusbandpiercingunhappinessballerinadruggedamputationlollipopbleedingfilm productionbody bagextreme violencemurderesswoman in a bikiniritescriptwoman undressingscreenplayflashback within a flashbacksevered footbroken neckgrindhouse filmbody partremarriageballet dancerman in a wheelchairtelephone numbermiddle aged manpassing outbedriddenparallel worldsevered eargarroteburnweirdoacupuncturepneumoniafemalespiked drinkleg bracesevered tonguegolf ballclose up of mouthrecord companydance studioincensewashroomagonyrubber glovesbeaglemystery womanshorelineburn scarcasting callsackpushed down stairspaleontologistreference to julia robertsreference to katharine hepburnresumeyogurtvoice over readingballet dancingballet shoesdioramasit inupright pianocamera shot of a woman's legsjob applicantforebodingclinking glassesmace spraymissing fingerspasmpiano wireclothes cut offmissing limbbaton twirlerbody in bagrod and reeltongstuning forkbroken collarboneburning oneselfawakened by a phonefoot amputationnegativismturning self in to the policefake auditionpracticing golfpretty woman (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r …eason too. (Read More)
| Subgenre: | cult filmtragedy |
| Themes: | murderdeathsuicideghostfuneralmagicangersupernatural powerdeath of mothergriefdeath of wife |
| Mood: | gorenightmarenightdarkness |
| Locations: | woodshospitalschoolchurchcarcemeteryairplanebathtubairportrural settingtrucknew england |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipzombiepriestlittle girllittle boysuicide by hangingfather in law son in law relationshipdeath of boy |
| Period: | 1980s |
| Story: | old manbased on novelbloodviolenceflashbackdogphotographexplosionsurprise endingfiretitle directed by femaledreamcorpserescuepunched in the face …watching tvcatsecrettearsbedbathroomneighbortelephoneflashlightdeath of friendwomanweaponchildcoffinpantyhosepainconfessiongraveperson on firehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonmoonfemale stockinged legsburned alivegothicinjurylifting someone into the airhatloss of friendtoyhidingloss of wifedead womanback from the deadhitchhikingcamera shot of feetpromiseloss of sonpet dogresurrectionshovelpsychotronicdead childdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenooseloss of sisterkiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
After Iggy's long-time girlfriend is murdered and the whole town agrees he is the killer, he awakens one morning with horns and the townspeople soon confess their sins. Once knowing the sins of the people, he is facing the true killer of his beloved girlfriend.
| Subgenre: | supernaturalmurder mysteryurban fantasy |
| Themes: | devilmurderdeathlovefriendshiprevengeinfidelityrapereligionjealousydrunkennessinvestigationangersupernatural powerdeath of mother …cancerillnessevilalcoholismcrueltytraumapolice investigationmurder of a police officernear death experiencedeath of daughterrape and murder (See All) |
| Locations: | woodshospitalbarchurchforestcemeterysmall townpolice carsex outsidesex in a carsex in chaircar on firesex outdoorssex in woods |
| Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipdoctorbrother brother relationshipteenage girlteenage boygirl …police officernursepolicemanmusicianpriestlawyerlove trianglechristianbest friendreference to godlittle girlgay kisswaitressinterracial relationshipchristianityalcoholicchildhood friendyounger version of charactercheating girlfriendreligious fanaticdeath of girlfriendbetrayal by friend (See All) |
| Story: | learning the truthfemale nuditybased on novelbloodmale nudityviolenceone word titlebare breastsfemale frontal nudityflashbackmale frontal nuditybare chested malesex scenefemale rear nudityfight …cigarette smokinginterracial sexphotographtitle spoken by charactermale full frontal nudityexplosionfiretopless female nudityvoice over narrationcryingshot to deathshot in the chesturinationblondeface slapshot in the headshotgunslow motion scenepunched in the facewatching tvundressingbrawlsecretletterliedead bodyhallucinationhandcuffsreference to jesus christprayerreportergay slurnewspaperjournalistcandlestabbingimpalementcocainedinerstabbed in the chestsnakenonlinear timelineno opening creditsscantily clad femaleunderwater sceneshot in the legnecklacetransformationbartendergunshotconfessionattempted murderpublic nuditydrug addictcursevirginbeaten to deathprotestperson on firedollstatueringscarhairy chestcrosswitnesscharacter says i love youloss of motherredheadcheating wifearsonterminal illnesstopless womancloseted homosexualrockanswering machineburned aliveaddictionheavy raingay characterdrugfriendship between menlistening to musicgroup of friendstold in flashbackcaught having sexdemonstrationmagazinecrying womanvisitteddy bearfollowing someonecrying manpresumed deaddrug overdosepump action shotgunsevered fingerbreakupblood on faceconfrontationunfaithful wiferejectionbroken glassjunkietaking a picturepolice officer shotfirst kissdeath of protagonistaccidental killingfriendship between boyswedding ringsuspectgasolinemale male kissbarefoot femaleinjusticechainriding a bicycleplaying pianoframed for murderseattle washingtonengagement ringsinbeing followedmale objectificationblood on camera lensbarking dogtaking a photographporn magazinecartoon on tvoutcastmolotov cocktailstuffed animalplaying poolrepeated scenehead blown offdoubtdrunken manpiano playingloss of daughtertemptationmale in underwearoutsiderdouble barreled shotgunhospital roommasturbation reference13 year oldexhibitionistgramophonereceptionistbare chested boywormstreet fightbitten in the neckman punching a womantaking off shirthandcuffedtopless girlconscienceurinatingtrumpetmurder suspectsleeping in a carevil womancar set on firewatermelonmurder attemptmurder by gunshottreehousedance scenehiding placeriding a bikepitchforkseductive behaviormemorialrescue from drowningtaking off clothesundressing someonetraumatic experienceangstturkeydeath by gunshotburn victimsnake bitehouse on firepunch in faceimmolationdonutfinding a dead bodysex from behindcloseted gaymale male hugpointing a gun at someoneblasphemycrime of passionseductive womanwingsdrug triptitle spoken by narratorvinylman slaps womandaredrunken womanspoiled bratcrying malemoving outhysterical womandiscovering a dead bodyselfish womanhornburnreference to the rolling stoneshand injuryman hits womancharacter says i'm sorryvicarloss of girlfriendtalismanhysterical outburstdeath by shootingantiherotv crewbitten on the armbiblical referencesocial outcastblood on handscherrybreaking upspoiled childhomophobic slurmelonunfaithful girlfriendreference to david bowietrumpet playerpassed out drunkmorse codeoutburstsex at workfalse accusation of murderchildhood flashbackscreaming girlmurder disguised as suicideprivate investigationhit on the head with a rockmurder by shootingbitten in the facesleeping on the floorbrother brother conflictestranged motherupside down camera shotheavy smokerreference to nirvanahornstree houseasthma inhalerbanging head against wallsetting a fireterminally illgay coptalking about masturbationplush toymale female fightreference to jim morrisonangel wingssearch for truthgrieving fatherplaying trumpetspoiled girlbitten by a snakeadvocatepunch in stomachreference to the doorswingcrying for helpbrother brother fightgoodbye letterstabbed with a pitchforkdeath during sexfight between friendschristian fanaticgolf instructorattention seekerdelirium tremensoutdoors sexselfish motheramc gremlinchainletcherry bomb (See All) |
Chris and his girlfriend Rose go upstate to visit her parent's for the weekend. At first, Chris reads the family's overly accommodating behavior as nervous attempts to deal with their daughter's interracial relationship, but as the weekend progresses, a series of increasingly disturbing discoveries …lead him to a truth that he never could have imagined. (Read More)
| Subgenre: | independent filmdark comedypsychological thrillersupernatural horrorpsychological horror |
| Themes: | murderdeathfriendshiprevengesurrealismsuicidekidnappingbetrayaljealousydrinkingfeardrunkennessracismpsychopathparanoia …abductionblindnesswildernesschildhood trauma (See All) |
| Mood: | goresatirerainnightmaredarkness |
| Locations: | woodsnew york cityforestairportelevatorrural settingwheelchairlake |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboybrother sister relationshipdetectivepoliceman …photographerbest friendreference to godinterracial relationshipvillainpsychiatristmaidolder woman younger man relationshipgrandfather granddaughter relationshipyounger version of charactersuicide by gunshotjapanese americansuicide by shooting (See All) |
| Story: | missing persontruthbloodviolenceflashbackdogtwo word titlebare chested malegunkissfightcigarette smokinginterracial sexphotographtitle spoken by character …partysurprise endingtelephone callcell phoneblood splattercar accidentmirrorwatching tvcomputercameradrinkshootingrifletearsrunningcar crashdead bodytelephonef wordwinecandlestrangulationaxestabbingapologycultflash forwardprologuesuburbevil manmanipulationdisappearancedie hard scenarioloss of motherblack americanmaniacsurgeryeyeglasseshuggingshavingteafireplacekilling an animaladdictionreference to adolf hitlerlooking at oneself in a mirrorrace relationsshot in the stomachscene during opening creditsexercisebisexual girlcrying womanservantbrooklyn new york citycrying mannicknamestabbed in the throatimmortalityhypnosisstabbed in the leghit on the headlaughterracistdeercellphonestabbed in the eyeblind mandead motherbrushing teethbenchsports carbrainreference to barack obamaauctionmale objectificationhit and runearphonesstabbed in the handbrainwashingparalysisstereotypehuman monstersex slavesarcasmname callinglooking out a windowsecret societyfemale psychopathself defenseknocking on a doorinterracial kissmale protagonistfemale villainseizurecrazinessevil womanawkward situationgenetics11 year oldracial discriminationhoodiepsychotronic filmhouse firegrindhouse filmpolice sireneyesflash camerapackingintercomtrancestory tellingbingochopping woodloss of memorylawnmowerbrain surgerybritish actor playing american characterart dealercar keysburning houseafrican american protagonistreference to 9 11bloody mouthroadkillgazebobody switchingtransplantwhite supremacistdead body in car trunkairport securityblack heroimplied incestdragging a dead bodystuffed animal toyjump scareolder woman younger maninside the mindsocial criticupstate new yorkisolated housestrange behaviorwhite supremacyattacked from behindbolt upright after nightmareneurosurgeonkicking someonehooded sweatshirtquitting smokingfootstepssedationhuman brainobjectificationreference to jeffrey dahmertranshumanismgroundskeepertalking in a carbrain transplantdog foodfloating in spacevagina slurfighting backreference to tiger woods26 year oldfalling to the groundidletter openerhypnotic tranceracial hatredkilling a deermissing friendtesticles slurhit on the head with a balltelephone hangupukeleleblack maidsneak attackstomped to deathb wordreference to jesse owenstransplantationdog sittinglong consweatpantshouse in the woodsstrapped to a chairtattletalebilliard ballromance subplotshot in the gutfellatio slurfoosball tablehead scarmedical operationmounted deer headstepford wives plottransportation security administrationbreaking a dishreference to greecestabbed with a letter openerbroken car headlightevil familylosing consciousnessrunning upstairssearching for missing friendthwarted ambitionwalking alone at night (See All) |
Five teenagers head off for a weekend at a secluded cabin in the woods. They arrive to find they are quite isolated with no means of communicating with the outside world. When the cellar door flings itself open, they of course go down to investigate. They find an odd assortment of relics and curios, … but when one of the women, Dana, reads from a book, she awakens a family of deadly zombie killers. However, there's far more going on than meets the eye. (Read More)
| Subgenre: | black comedysupernaturalslasher flickteen horrorsupernatural horrorreality spoof |
| Themes: | murdersurrealismsuicideghostdrunkennessmonstergamblingsurveillanceapocalypse |
| Mood: | goresatireslasher |
| Locations: | woodslakegas stationtunnelcave in |
| Characters: | teenagerboyfriend girlfriend relationshipzombiesecurity guardwitchbabe scientistself referential |
| Period: | 2000s20th century1900s21st centuryyear 2009 |
| Story: | creaturefemale nuditybloodflashbackbare chested malesurprise endingpistoltelephone callshot to deathblood splattermachine gunshot in the chestshot in the headcar crashcollege …robotf worddecapitationmassacreimpalementstabbed to deathstabbed in the chestsevered headman with glassesgravecharacter repeating someone else's dialoguevirginstabbed in the backclownperson on firediarymanipulationexploding bodymercenarydirectorial debutsevered armdismembermentsubtitled scenefreeze frametopless womanwerewolfhand grenadegrenadeathleterevelationgroup of friendsswat teamsevered handcovered in bloodend of the worldeaten alivecelebrationredneckcameostabbed in the throatdark humorfalling to deathstabbed in the headthrown through a windowtitle at the endstabbed in the eyeaxe murdercharacters killed one by oneethnic slurcellarinterrupted sexmarijuana jointvideo surveillancestabbed in the handbonghuman sacrificestonerboy with glassesinterracial kissjapanese schoolgirlelectric shockcabin in the woodstentacleoffice workerbitten in the neckcarnagescarecrowjocksawgoblinstabbed in the shoulderfilmed killingtwo way mirrormusic boxwoman in a bikinimasked villainrecreational vehiclepsychological tortureku klux klantrapdoorlocked in a roomforce fieldevil clownhatchetunicorngiant spiderinternno survivorsbear trapgas station attendantdyed hairkiller clowngirl stripped down to pantiescyclopstorture chamberdirt bikezombie childtruth or darebody torn apartdead teenagerfilm reelcocktail partyscholarcubepuppeteerkilled in an elevatorgiant snakehorror icongrappling hookblonde stereotypeno cellphone signalblobevil godcontrol roomunderground bunkerpushed into waterritual sacrificestrange behaviorlovecraftianravinechasmanimate treemermantorture victimbulletproof glassspeaker phonedeconstructionswimming in a lakebloody hand printmountain roadyear 1903alpha maleboat dockpheromonesmounted animal headgroup of fiveconchgiant batharbinger of deathgiant handtrowelfalling into a lakebetting poolcaged monster (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi …nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
| Subgenre: | independent filmsuspense |
| Themes: | murderdeathlovesuicidekidnappingghostpregnancydrinkingfeardrunkennessfuneralmemoryobsessionsupernatural powerparanoia …drug usedysfunctional familyguiltafterlife (See All) |
| Mood: | rainnightmaremurder suicide |
| Locations: | cemeterybathtubchicago illinois |
| Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipmother daughter relationshipchildrenboyteenage girlteenage boypolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero …seeing a ghost (See All) |
| Story: | missing persontruthsexbased on novelbloodbare chested malegunfemale rear nudityfightpartyknifeerectioncryingsongwoman on top …corpseshot to deathblood splattershot in the chestwatching tvdrinksecretshootingvomitingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandambulancesuicide attempthousenonlinear timelinecoffinsearchgraveyardtalking to the cameragraveproduct placementcover upattempted rapedisappearancesleepinghaunted housepsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshoveldelusionhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismbreaking a windowhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
| Subgenre: | independent filmcult filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror |
| Themes: | murderdeathfriendshipsurrealismfeardrunkennessescapedancedeceptionvoyeurismbrutalitysupernatural powerparanoiaillnesssadism …evilunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All) |
| Mood: | gorerainnightavant gardeslasherdarknessstylization |
| Locations: | woodsschoolswimming poolforesttaxiairportapartmentgermanytaxi driver |
| Characters: | teenagerfrienddoctorboyteenage girlfemale protagonistteachergirlpolice officerstudentsister sister relationshipkillerpsychiatristprofessorwitch …germanamericanamerican abroadself mutilationaunt nephew relationshipevil witchmysterious killernew student (See All) |
| Period: | 1970syear 1977 |
| Story: | missing personlegendbloodviolenceone word titleflashbackdogcigarette smokingdancingexplosionknifechasesurprise endingtelephone callfire …voice over narrationcorpseblood splatterslow motion scenesecretfalling from heightshowdownbathroompianodemonhallucinationvoyeurtelephonesubjective cameraswimminggood versus evilfoot chasewineambushstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathtoiletstabbed in the chestcoffinritualattempted murdercharacter repeating someone else's dialoguedangerprologuescreaminglocker roomcharacter's point of view camera shotcover upcollege studentlightningscreamhangingdisappearanceinjectionsuspicionmurdererfirst partthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalnipples visible through clothingelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadmercilessnesspower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerpsychopathic killerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowslashingsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotknife murderbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesgrindhouse filmnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpseunknown killerhole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All) |
Rebecca must unlock the terror behind her little brother's experiences that once tested her sanity, bringing her face to face with a supernatural spirit attached to their mother.
| Subgenre: | supernaturalparanormal phenomenasupernatural horror |
| Themes: | suicideghostmonstersupernatural powerdepressionillnessmental illnessself sacrifice |
| Mood: | behind the scenesnightdarkness |
| Locations: | schoolapartment |
| Characters: | policemother son relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistlittle boymotherchildhood friendsuicide by gunshotblonde girlsupernatural killersuicide by shooting self |
| Story: | horror movieface to faceboyfriendlow budgetcreatureviolenceflashbacktwo word titlebare chested malegunkissphotographtitle spoken by charactersurprise endingpistol …blondeshot in the headwatching tvshowdowndead bodyorphanbedroomflashlightcandleambulancepolice officer killedbased on short storyfactorytough girlbaseball batopening action scenescreambasementtrapbrotherdirectorial debutlove interestwarehousetape recorderlifting someone into the airmental institutionwoman in jeopardypower outagemedicationsocial workerduct tapelightmannequindeadfinal showdownclosethair pullingold dark houseparenthooddead fatherblonde womanfriendship between womenfemale friendshipgun held to headpopcornredheaded womanyoung womanfriendship between girlsbased on short filmpsychiatric hospitalexperiment gone wrongfemale police officerfamily homemain character shotpsychotronic filmhalf brotherlapdcandlelighttalking to oneselfflickering lightmedical experimentwriting in bloodfemale in a showerlight bulblong blonde hairyounggun held to one's headentitywriting on a wallfemale ghostred lightdummyorphan girlaudio recordingsockmentalthrown from heightsibling relationshipneon lightcaseyounger brotherhalf brother half sister relationshipjump scaremomdisembodied voicemother daughter estrangementbig sisterpower cutlighting a candle8 year oldparasollocked roomblack lightworking latebead curtainreference to metallicahandprintultraviolet lightfuse boxskin diseaselocked in a basementprocessfear of the darksleeping in a bathtubstreetlightwoman wrapped in a towelspecterflashback sequenceheadlightsmonster under bedlights suddenly go outwriting on wallfloorboardtextile factorygrabbed from behindmentally ill motherfigurelight switchlightsmalevolent entityminuteshadow personimplied female nuditytrapped in a basementlight sensitivitymedical recordsgrabbed by anklemysterious female figureskin conditionunder the beddeceased fatherexperimental surgerymysterious figureprescription medicationshadowy figuredragged along the floorhaunted house ridereference to slayerself harmer (See All) |
After a car accident, Michelle awakens to find herself in a mysterious bunker with two men named Howard and Emmett. Howard offers her a pair of crutches to help her remain mobile with her leg injury sustained from the car crash and tells her to "get good on those" before leaving the bunker. She has …been given the information that there has been an alien attack and the outside world is poisoned. However, Howard and Emmett's intentions soon become questionable and Michelle is faced with a question: Is it better in here or out there? (Read More)
| Subgenre: | black comedysuspenseconspiracypost apocalypsepsycho thrillerpsychological thriller |
| Themes: | murderdeathkidnappingbetrayalfearescapemonsterdeceptionmemoryangerparanoiabreak uppanicapocalypsecourage …self sacrificenear death experienceregretalien abduction (See All) |
| Mood: | nightdarknessambiguous ending |
| Locations: | carwaterrural settingkitchenapartmentfarmtruckgas stationusashed |
| Characters: | female protagonistalienhostageex military |
| Period: | 2010s |
| Story: | missing personcrashcreaturenumber in titlebloodsequelflashbackbare chested malegunphotographexplosionknifechasethree word titlesurprise ending …pistolshowertelephone callfirecell phonecorpsedigit in titleshot to deathfoodcar accidentshot in the headslow motion scenewatching tvbrawlsecretbookliebeersecond partbedcar crashdead bodyinterrogationneighborhandcuffsrevolversurvivalflashlightambushwomanmontagebridgetoiletstabbed in the chestmapaccidentfishdinnerexploding cardrivingno opening creditsbirdradiodisarming someonedrawingdouble crossspaceshipnews reportgunshotargumentcharacter repeating someone else's dialoguedangerscreamingkeyattackreadingtough girllightningscreammanipulationscarstalkingthreatpigbasementsuspiciondie hard scenariothreatened with a knifedirectorial debutufoarsonstrong female characterpickup truckanswering machineburned aliverevelationspearheroinebeer drinkingsociopathbarncaptivebeardspacecraftwatching a moviemagazinevideotapeeccentricladderstrong female leadpuzzletorchend of the worldschizophreniasocial commentarybroken legfemale warriorgas maskwatching televisioncamera shot of feetredneckwhiskeyalien invasionbarefootwoman in jeopardydamsel in distresstensionbraverycynicismconfrontationnew orleans louisianadeath threattitle appears in writingescape attemptscissorscigarette lighterpedophileaerial shotdisfigurementbarefoot femalebroken armduct tapeburned to deathgunfiresmokemoral dilemmavodkaclose up of eyesmolotov cocktailminimal castlouisianadead animalmisogynistscene before opening creditshuman monstermetaphorcrutchesdvdalarmwalletblackoutjukeboxacidcamera shot of bare feetdisposing of a dead bodyvacuum cleanerfarmhousebunkerearringfish tankburnt facegoldfishmind gamecornfieldone linerbaseball captentaclefemale herohead injuryoffscreen killingheld captivelocked doorvhsgasorchestral music scorealien contactcar radiohitchcockianoverhead camera shotchild molesterboard gameexploding shipdistrustsubterraneanwatching a videoradio newssole survivorpsychotronic filmimprovised weaponschizophrenicdriving at nightbreaking a bottle over someone's headvideo cassetteleg injurysecret roomarm slingcat and mousevinyldeeply disturbed personcontaminationkeysdoomsdayreference to santa clausdinner tablerunning for your lifepsychological manipulationconspiracy theoristcar keyssnorricamhazmat suitpadlockabandoned carhidden truthjigsaw puzzlesingle set productionleg bracepoison gasruralambiguitybeer bottlebomb shelterham radiovhs tapestreet in titleanti villainreference to paris franceaddress as titlecar alarmwater bottlebiohazardunconsciousyelling for helpword gamematcheswatching a movie on tvair ventsurvivalisthandcuffed to a pipesmart phonefeature film directorial debutintravenousstitchesbox cutterliquid nitrogenshower curtainunderground bunkernight drivingcharadesfalloutdreadmonopolytoolboxchemical weaponslocked roomclaustrophobicchemical weaponamateur radioairlockmatchbookdead pigface burncontainmentinjured legreading a magazineargument between couplematchboxdown blouseemergency broadcast systemself sufficiencyfallout sheltershort term memory lossfashion designstitching a woundmatchstickreference to al qaedaunidentified flying objectwhiskey bottleanimal carcassbus ticketelectrical fireshort term memoryparanoid schizophrenicacid burnex navygas attackopening creditssingle settingbaton rouge louisianaforehead cutfrancophileman shoutingwatching a video on tvcar keymonopoly gamethreaten to killegg timerinjured womanplaying a gamepain medicationplaying a board gamereading magazinewhite lightiv linepuzzle piecereference to houston texasrunning from dangerwoman using crutches55 gallon drumshared universe (See All) |
A young photographer Thun and his girlfriend Jane discover mysterious shadows in their photographs after fleeing the scene of an accident. As they investigate the phenomenon, they find other photographs contain similar supernatural images, that Thun's best friends are being haunted as well, and Jane … discovers that her boyfriend has not told her everything. It soon becomes clear that you can not escape your past. (Read More)
| Subgenre: | supernaturalasian horror |
| Themes: | deathrevengesuiciderapeghostescapeobsession |
| Mood: | nightmare |
| Locations: | hospitalfire escape |
| Characters: | boyfriend girlfriend relationshipgirlphotographerex boyfriend ex girlfriend relationshipgirlfriendbest friendsghost girl |
| Story: | boyfriendbloodone word titleflashbackphotographsurprise endingcorpsecar accidentcamerafalling from heightcollegeaccidentpainscreamspirit …48 hour film projectmental hospitalgang rapeshadowdark pasthit and rungraduationcremationlong hairevil spiritpolaroidx raydenialmind gamepharmacywrist slittingdarkroomstairwellstrobe lightyearbookthaihorror movie remadecollege graduationlights outsecret lovercarried on shouldersmultiple suicidepreserved corpse (See All) |
In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.
| Subgenre: | supernaturalamerican horror |
| Themes: | murderdeathfearmonstermemoryracismpsychopathbrutalitysupernatural powersadismbullyingabductionhomophobiacrueltychildhood …cannibalismmadnessmissing childunlikely friendshipschool bullyingsupernatural powers (See All) |
| Mood: | gore |
| Locations: | schoolforestsmall townbicyclesewernew boy in town |
| Characters: | policeteenagerchildrenzombieserial killerbullylittle boyvillainjewchildhood friendbar mitzvahboy in underwearevil father |
| Period: | 1980ssummeryear 1989year 1988 |
| Story: | missing personcreaturebased on novelbloodviolenceone word titleflashbackkisstitle spoken by characterblood splattercatbattlepaintingbookbathroom …pianodemongay slurnewspaperchild abusechildcoffinchild in perillibraryclowndeath of brotherbasementbrothermurdererfirst partsevered armkillinggaragesplattermaniacsistereyeglassesballoonstreetsexual abusemutilationoverallspsychocovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatbutcherpedophilemurder of a childturtleabusive fatherbroken armcellarkilling spreeloss of brotherpsycho killerheroismunderdogpervertspittingpsychopathic killerbad guygirl in bra and pantiesoutcastwoodabandoned housebicyclinghomicidal maniacwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringbloody violenceteenage girl in underwearpool of bloodreference to michael jacksonoverbearing mothersadistic psychopathold houseghoulglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererdisturbinghypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com