Best popular movies like Scream 4:

Do you need specific genre & keyword selection to find films similar to Scream 4?
<< FIND THEM HERE! >>

Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 4 (2011)

Sidney Prescott, now the author of a self-help book, returns home to Woodsboro on the last stop of her book tour. There she reconnects with Sheriff Dewey and Gale, who are now married, as well as her cousin Jill and her Aunt Kate. Unfortunately, Sidney's appearance also brings about the return of Gh …ostface, putting Sidney, Gale, and Dewey, along with Jill, her friends, and the whole town of Woodsboro in danger. (Read More)

Subgenre:
post modernconspiracysuspenseblack comedycult film
Themes:
murder of a police officergreedhome invasionsurveillancedeath of motherpsychopathdeceptioninvestigationescapedrunkennessjealousybetrayalloverevengedeath …murder (See All)
Mood:
slasherhigh schoolsatiregore
Locations:
police stationelevatorsmall townhospital
Characters:
shooting a police officerself referentialaunt niece relationshipself mutilationex boyfriend ex girlfriend relationshipcousin cousin relationshipsheriffserial killerfemale protagonisthusband wife relationshipteenagerpolice
Period:
2010s
Story:
villain not really dead clichesole black character dies clichereference to facebookbook signingparty crashingthreatened with a knifefoot chasewatching a horror moviestabbing a police officeractress shares last name with charactercrashing through windowrunning into a wallgarage door openerself inflicted woundreference to bruce willis …draw bladesudden disappearancehiding evidencestabbing a womanreference to jeffrey dahmermise en abymethrown off a balconyschool clubdead teenagertelephone terrorthrown through a glass doorphone terrorthreatening telephone callweb cameramillennial generationfourth in seriesmystery killermotivestabbed in the foreheadunmaskingstabbed in the bellypublicistclichebreaking down a doorgeneration ystartleddefibrillatorstabbed in the footpretending to be deadspitting bloodbloggeraccomplicedeeply disturbed persondoorbelldead woman on floorbullet proof vestmovie fanred herringwoman in dangerbreaking through a doortauntingstupid victimshot in the crotchhiding under a bedreference to twitterfemale copstabbed in the shoulderfilmed killingcamcorderclimbing through a windowdeputystabbed in the armfacebookwhodunitwebcamhiding in a closetsequel to cult favoritestabbed in the handlaptop computerintestinesmedia coveragecharacters killed one by onemasked killerdead woman with eyes openlens flarebody landing on a cardeath threatbookstorestabbed in the legdisembowelmentpunched in the stomachstabbed in the neckstabbed in the throatunderage drinkingduct tape over mouthcrime scenetensionfemale killerstrong female leadparking garagepress conferencekicked in the stomachimpersonationfourth partstabbed in the stomachwalkie talkiesecurity cameragroup of friendsred dressbarnfamesociopathfalling down stairsanswering machinerevelationstrong female charactervigilantesuspicionpolicewomanfilm within a filmhigh school studentknocked outfired from the jobcharacter repeating someone else's dialogueelectrocutionstabbed in the backvirginauthorpolice officer killedshot in the foreheadnews reportfemme fataleno opening creditstied to a chairstabbed in the cheststabbed to deathdeath of friendthroat slittingvideo cameraambulancedisguisebound and gaggedflashlightf wordreporternumbered sequelheld at gunpointbookfalling from heightmaskpunched in the facerescueshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingchaseknifepartynumber in titlebloodviolencesequel (See All)

Scream (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream (1996)

1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)

Subgenre:
post modernconspiracysuspenseblack comedycult filmcoming of ageslasher flickteen movieteen horrorpsychological thrillerhorror spoof
Themes:
home invasiondeath of motherpsychopathinvestigationescapedrunkennessbetrayalrevengedeathmurderfriendshipinfidelityfearextramarital affairdivorce …brutalityparanoianear death experiencedeath of daughter (See All)
Mood:
slasherhigh schoolsatiregoredarkness
Locations:
police stationsmall townforestwoodskitchenschool bus
Characters:
self referentialsheriffserial killerfemale protagonisthusband wife relationshipteenagerpolicefamily relationshipsfather son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boy …villainsingle fatherslasher killer (See All)
Period:
1990s
Story:
villain not really dead clichethreatened with a knifefoot chasewatching a horror moviedead teenagertelephone terrorphone terrorthreatening telephone callmystery killermotiveaccomplicered herringwoman in dangerclimbing through a windowdeputy …whodunithiding in a closetintestinesmedia coveragemasked killercharacters killed one by onelens flarestabbed in the legdisembowelmentunderage drinkingduct tape over mouthcrime scenestrong female leadkicked in the stomachgroup of friendsfalling down stairsanswering machinerevelationstrong female charactersuspicionhigh school studentelectrocutionstabbed in the backvirginshot in the foreheadnews reportno opening creditstied to a chairstabbed in the cheststabbed to deathdeath of friendthroat slittingambulancedisguisebound and gaggedflashlightf wordheld at gunpointfalling from heightmaskpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifepartyviolencebloodf ratedone word titlebare chested malecigarette smokingtitle spoken by characterfirecar accidentblondeface slapshot in the headslow motion scenewatching tvcomputercatarrestshowdownbeercar crashinterrogationhandcuffstelevisiontelephonesubjective camerasurvivalcaliforniaweaponbrunettefalse accusationdisarming someonevanstalkerdangersuburbwidowerfirst of seriescharacter's point of view camera shotproduct placementscreamhangingprankshot in the shoulderamerican flagstalkingcheerleaderpremarital sexfirst partcult directorgaragesingle parenteavesdroppingropeteen angstnipples visible through clothingloss of virginityheroinelifting someone into the airvideotapegossipcovered in bloodfaked deathcrushed to deathsocial commentaryhomicidemasked manpresumed deaddamsel in distresscameohaunted by the paststealing a carpower outageevacuationplot twistescape attemptframe upfat manjumping through a windowblood on shirtconvictfemale reporterframed for murdernews reporteranniversaryyellingdirector cameohigh school teacherhomagevideo storediscoverypopcorncameramancrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linewrongful arrestbreaking a bottle over someone's headquestionwater fountainsittingfalling off a roofdutch anglerookie copgeneration xcut armcurfewloss of girlfriendhigh school principalabandoned carhomoeroticteen violencefake bloodmurderer duovideo store clerkhanged bodyend credits roll callknife in backreflection in eyehit with a doorhiding in a bathroomtrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakereference to jamie lee curtis (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Scream 2 (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 2 (1997)

Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list  …of suspects goes down. (Read More)

Subgenre:
post modernconspiracysuspenseblack comedycult filmslasher flickteen movieteen horrorhorror spoof
Themes:
murder of a police officerpsychopathdeceptioninvestigationescapedrunkennessbetrayalrevengelovemurderdeathfearvoyeurismparanoiainsanity …sadismtheatrenear death experience (See All)
Mood:
slashersatiregore
Locations:
police stationhospitalbicyclepolice carfire truck
Characters:
self referentialex boyfriend ex girlfriend relationshipserial killerfemale protagonistteenagerpoliceboyfriend girlfriend relationshippolice officerdetectivehostagekillerpolice detective
Period:
1990s
Story:
villain not really dead clichethreatened with a knifefoot chasereference to jeffrey dahmermise en abymethrown off a balconytelephone terrorthrown through a glass doorphone terrorthreatening telephone callmystery killeraccomplicered herringstupid victimstabbed in the shoulder …whodunithiding in a closetsequel to cult favoritemedia coveragemasked killercharacters killed one by onelens flarestabbed in the throatduct tape over mouthcrime scenestrong female leadpress conferencestabbed in the stomachgroup of friendsfamefalling down stairsstrong female charactersuspicionfilm within a filmknocked outcharacter repeating someone else's dialoguestabbed in the backauthorpolice officer killedshot in the foreheadnews reportno opening creditsstabbed in the cheststabbed to deathdeath of friendthroat slittingvideo cameraambulanceflashlightf wordreporterheld at gunpointmaskpunched in the facerescueshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingchaseknifepartynumber in titlesequelbloodviolencef ratedinterviewbare chested malekisscigarette smokingsingingbeatingcar accidenturinationface slapshot in the headslow motion scenewatching tvcomputerbrawlshowdownsunglassessecond partcar crashcollegehallucinationvoyeurtelevisiontelephonegood versus evilsurvivalgay slurbedroomjournalistambushaxestabbingimpalementinternetfalse accusationdisarming someonehit by a cardouble crossvanshot in the legnecklaceracial slurattempted murderlibrarystalkermicrophonecostumescreamingattackpay phoneproduct placementstatuecover upkicked in the facecollege studentlightningprankscarbodyguardstalkingisolationstagecharacter says i love youshot in the armbare chested male bondagecult directorpizzatwenty somethingeavesdroppingtv newsheroineshot in the stomachcatfightsurvivorcrucifixmovie theatervillainessvideotapeblockbusterrehearsalinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorcameohaunted by the pastconstruction sitemercilessnessevacuationfalling to deathescape attemptstabbed in the heade mailfemale reporterplayethnic slurkilling spreeclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex copohiocafeteriafake identitypolice chieffemale psychopathpopcorncameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendshot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous lineclimbing out a windowvcrthrown from a car555 phone numberfemale journalistsittingfilm schoolwoman punching a mangeneration xcult figurecut armfilm studentmob of reportersbroken handreference to charles mansonthrown from heightdeath by impalementauditoriumstab woundinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonstabbed in the earreference to ted bundytheater directorcopycatvalley girlmetafictiontv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All)

Scream 3 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 3 (2000)

A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.

Subgenre:
post modernblack comedyindependent filmmartial artshorror spoof
Themes:
home invasiondeceptioninvestigationescapedrunkennessjealousybetrayalrevengemurderdeathkidnappingfearfilmmakingvoyeurismtheft …brutalityparanoiacelebritycourage (See All)
Mood:
slashersatiregorenightmare
Locations:
police stationbarswimming poolhelicopterlos angeles californiaapartmentpolice car
Characters:
self referentialex boyfriend ex girlfriend relationshipserial killerfemale protagonistpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshippolice officerdetectiveactorhostageactresssecurity guardpolice detective …film directordeath of girlfriendpregnant from rape (See All)
Period:
1990s2000s
Story:
villain not really dead clichesole black character dies clichethreatened with a knifefoot chasethrown off a balconytelephone terrorthrown through a glass doorphone terrorthreatening telephone callmystery killerbullet proof vestred herringstupid victimstabbed in the shouldercamcorder …stabbed in the armwhodunithiding in a closetsequel to cult favoritemedia coveragecharacters killed one by onemasked killerstabbed in the legstabbed in the throatduct tape over mouthcrime scenestrong female leadkicked in the stomachstabbed in the stomachred dresssociopathfalling down stairsanswering machinerevelationstrong female charactersuspicionfilm within a filmknocked outcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadnews reportno opening creditstied to a chairstabbed in the cheststabbed to deaththroat slittingambulancebound and gaggedflashlightf wordreporterheld at gunpointfalling from heightmaskpunched in the facerescueshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingchaseknifepartynumber in titleviolencesequelbloodf rateddogbare chested malefightcigarette smokingphotographshowerbeatingfistfightcar accidentshot in the headwatching tvbrawlsecretshowdownsunglassesbirthdaycar crashhallucinationhandcuffsvoyeurrevolvershot in the backsurvivaljournalistambushstrangulationmansiontoiletfalse accusationdisarming someonecoffindouble crossbirthday partythird partshot in the legmarriage proposalracial slurstalkerbeaten to deathcostumescreamingrace against timecover upkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingexploding bodyisolationbasementpremarital sexactingobscene finger gesturecult directoreavesdroppingentertainmentsabotagehead buttsurvivorhollywood californiavideotapewristwatchjumping from heightrape victimfaked deathmexican standoffmasked manpresumed deadfemale warriormovie theatrebarefootcameobraverymobile phonepartnermercilessnessmovie setfalling to deathframe upsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reporterkilling spreenewspaper clippinglingerie sliphit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserlecturegolf clublighterquick drawtrailer homepopcornhearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a mangasmetal detectorexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanwrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidefemale journalistsittinghidden gunwomen's bathroomtalk show hosthit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillfaking own deathfaxcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All)

Halloweenviii: Resurrection (2002) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
cult filmindependent filmslasher flickteen horroramerican horror
Themes:
murder of a police officersurveillancepsychopathdeceptionrevengedeathmurderfearevil
Mood:
slashersatiregore
Locations:
forestwoodskitchenwheelchairrooftopfire truck
Characters:
serial killerteenage girlteenage boynursekillersecurity guardvillainpsychiatristslasher killercoroner
Period:
2000s
Story:
threatened with a knifefoot chasedead teenagerbreaking through a doorstupid victimfilmed killingclimbing through a windowwhodunitwebcamhiding in a closetsequel to cult favoritecharacters killed one by onemasked killerstabbed in the throatsecurity camera …electrocutionstabbed in the backpolice officer killednews reportstabbed in the cheststabbed to deaththroat slittingambulanceflashlightf wordfalling from heightmaskblood splattercorpsecell phonesurprise endingchaseknifeviolencesequelbloodfemale nudityflashbacktwo word titlefightfirefistfightmirrorwatching tvcomputercameraundressingbrawlshowdownsubjective cameradecapitationgood versus evilhalloweenstrangulationaxemontageimpalementinternetsevered headcharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurderersevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the headblack brae mailrainstormraised middle fingergasolinebody countaxe murdercasual sexkilling spreenewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offold dark househuman monsterabandoned househomicidal maniachanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roompeep holebreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myerslifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

I Still Know What You Did Last Summer (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Still Know What You Did Last Summer (1998)

Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.

Subgenre:
black comedyteen movieteen horror
Themes:
deceptionescapebetrayaldeathmurderrevengefearparanoiaguiltnear death experience
Mood:
slashergorenightmare
Locations:
small townhospitalbarrestaurantchurchswimming poolhotelhelicoptercemeteryairplaneboatnightclubairportkitchenstorm …singing in a car (See All)
Characters:
serial killerteenagerfather son relationshipboyfriend girlfriend relationshipdoctornursemaidfisherman
Period:
1990syear 1988
Story:
villain not really dead clichethreatened with a knifestabbed in the footred herringstupid victimhiding under a bedsequel to cult favoritestabbed in the handcharacters killed one by onelens flarestabbed in the legpunched in the stomachstabbed in the throatkicked in the stomachcharacter repeating someone else's dialogue …stabbed in the backno opening creditsstabbed in the cheststabbed to deathdeath of friendpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifeviolencesequelbloodflashbackbare chested malefightdancingshowerfistfightcar accidentbikinibrawlvomitingshowdownsecond partmarijuanahallucinationislandrevolvercleavagesurvivalambushaxedrug dealerimpalementfalse accusationdream sequencescantily clad femaleroommatebartenderattempted murderscreamingpay phonevacationrace against timecollege studentlightninggymfireplacespearheavy rainlooking at oneself in a mirrorlifting someone into the airpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facepower outagebroken glasskaraoketitle appears in writingstabbed in the headaccidental killingatticrainstormpiervoodoofemale in showermannequinengagement ringtombmarijuana jointyellingconfessionalcomic reliefstonerradio stationhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshopfourth of julyseason in titlefemale bartenderreference to richard nixontoothbrushhookarm slingno endingfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodhotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerdark and stormy nightfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All)

The Purge: Election Year (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Purge: Election Year (2016)

It's been seventeen years since Leo Barnes (Frank Grillo) stopped himself from a regrettable act of revenge on Purge Night. Now serving as head of security for Senator Charlie Roan (Elizabeth Mitchell), his mission is to protect her in a run for president and survive the annual ritual that targets t …he poor and innocent. But when a betrayal forces them onto the streets of D.C. on the one night when no help is available, they must stay alive until dawn...or both be sacrificed for their sins against the state. (Read More)

Subgenre:
conspiracysuspenseblack comedymartial artsdystopiasurvival horrorpolitical conspiracy
Themes:
home invasionsurveillancepsychopathdeceptionescapebetrayalrevengedeathmurderfriendshipkidnappingpoliticsfearcorruptionbrutality …paranoiainsanitysadismexploitationhopepaniccourageself sacrificenear death experiencemurder of family (See All)
Mood:
slashergorenight
Locations:
churchhelicopterairporturban settingtruckrooftoptunnel
Characters:
self mutilationafrican americantattoopriesthostagetough guywarrioraction herosniperrussiansniper rifle
Period:
near future
Story:
threatened with a knifefilmed killingstabbed in the armmedia coveragebody landing on a carstabbed in the neckstabbed in the throatparking garagepress conferencekicked in the stomachwalkie talkiesecurity camerasociopathknocked outcharacter repeating someone else's dialogue …electrocutionstabbed in the backshot in the foreheadnews reportno opening creditstied to a chairstabbed in the cheststabbed to deathdeath of friendambulancebound and gaggedflashlightf wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolchaseknifebloodsequelviolenceflashbackbare chested malefightphotographexplosionfireshootoutbeatingfistfightmachine gunshot in the headshotgunslow motion scenewritten by directorswordgunfightbrawlshowdownriflebeerhand to hand combatbombcar crashrevolvercombatshot in the backdecapitationsurvivalgangambushaxemassacremontagemixed martial artspoliticianimmigrantmapsevered headman with glassesanti herodisarming someoneone man armyhit by a carritualvanthird partshot in the legracial sluron the runflash forwardattempted murderdrug addictbinocularsdangercostumeprologueperson on firefugitivemissionproduct placementrace against timeevil mankicked in the facebaseball batstreet shootoutshot in the shouldermanipulationamerican flagbodyguardexploding bodythreatlaptoptrapelectionmercenaryshot in the armsilencerobscene finger gesturesacrificeclass differenceswashington d.c.ak 47chainsawhand grenadeburned aliveassassination attemptmass murdermacheterace relationstouristhelmetoverallswristwatchrebelcovered in bloodrebellionmexican standoffwhite housegun fuinterracial friendshippreachercrushed to deathsocial commentarymasked manmexicandamsel in distressshopliftingbraverycynicismministerresistancedual wieldhatredhit in the crotchmanhuntmercilessnesschaosconvenience storeshot in the facestabbed in the headspecial forcessenatorpunched in the chestassault rifleghettobooby trapaerial shotknife fightblood on shirtcommandoschoolgirl uniformbulletproof vestraised middle fingertied feetduct taperescue missionjuvenile delinquentethnic slurburned to deathmoral dilemmapolitical corruptiongatling gunbullet timetracking devicetext messagingshot through a windowhappy endingface maskfinal showdownreturning character killed offbrainwashingtasershot in the neckskinheaddronemilitiayoung version of characterneo nazicommando unitparamedicanarchyhit by a truckwhistlingstreet fighthanged manbullet woundfight the systempresidential electioncathedralshot in the throatcommando raidstabbed in the facetragic pastdeath of familygarbage truckgang memberresistance fighterassassination plotsocial decayattempted robberyguillotinemaceslow motion action scenedetonatorwriting in bloodcrushed by a carbarricadeipodreference to george washingtonwashington monumentwhite supremacistmasked womanprotectorsouth africansecret tunnelfemale politicianhanged bodyritual sacrificependulumdelineo fascismbutterfly knifehit by a vanlincoln memorialemergency broadcast systemburning bodyhotwiringaid workerarrow through the headfemale senator (See All)

Prom Night (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prom Night (2008)

Donnas senior prom is supposed to be the best night of her life, one of magic, beauty, and love. Surrounded by her best friends, she should be safe from the horrors of her dark past. But when the night turns from magic to murder there is only one man who could be responsible, the man she thought was … gone forever. Now, Donna and her friends must find a way to escape the sadistic rampage of an obsessed killer, and survive their Prom Night. (Read More)

Subgenre:
suspensecoming of ageslasher flickteen movieteen horror
Themes:
murder of a police officerhome invasionpsychopathescapedrunkennessmurderlovedeathfriendshipdanceobsessionrivalrymurder of family
Mood:
slasherhigh schoolnightmarehorror movie remake
Locations:
police stationelevatorhotelfire truck
Characters:
aunt niece relationshiphusband wife relationshippoliceteenagerfriendboyfriend girlfriend relationshipteenage girlteacherdetectivekillerpolice detectiveuncle niece relationshipdeath of girlfriend
Story:
threatened with a knifeclichestupid victimhiding under a bedhiding in a closetcharacters killed one by oneunderage drinkingcrime scenehigh school studentvirginpolice officer killednews reportstabbed in the cheststabbed to deathdeath of friend …throat slittingambulancedisguiseshot in the chestblood splattershot to deathcorpsecell phonepistolchaseknifepartyviolencebloodmale nudityflashbackmasturbationdancingtitle spoken by charactershowermirrorremakeslow motion scenehallucinationsurvivalorphanstrangulationaxebridgejokedream sequencelimousinestalkerclownrace against timekicked in the facedeath of childstalkingloss of loved oneswat teampsychologistrapistbarefoothaunted by the pastfloodevacuationpedophileblood on shirtmurder of a childone dayuncleengagement ringparentsdjpervertauntgraduationfire extinguisherhigh school teacherpedophiliacomic relieftrashflaskescaped convictbody in a trunkmtvpromdeath of boyfriendgarbagemugshotdeath of familychild molesterbreaking a mirrorrookie copsexual predatorrenovationcliquebitten handsex offenderflasherbad actinghotel suitemedicine cabinetbroken dishblack stereotypeprom queenbathroom mirrorcut telephone linecockinesserotomaniaprom kinghotel staffmaster keybridgeport connecticutstupid cop (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Morgan (2016) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Morgan (2016)

Subgenre:
conspiracysuspenseindependent filmmartial artscorporate conspiracy
Themes:
surveillancedeceptioninvestigationescapebetrayalrevengemurderdeathsuicidekidnappingfearangerbrutalityparanoiapanic …artificial intelligence (See All)
Mood:
car chase
Locations:
forestwoodskitchenfarmlakelaboratoryresearch station
Characters:
boyfriend girlfriend relationshipdoctorhostageinterracial relationshippsychiatristchinesesuicide by hangingbabe scientistfemale scientistgeneticist
Period:
near future
Story:
threatened with a knifefoot chasefilmed killingclimbing through a windowstabbed in the armcharacters killed one by onestabbed in the neckfemale killerkicked in the stomachsecurity camerafalling down stairsrevelationsuspicionknocked outcharacter repeating someone else's dialogue …stabbed in the backshot in the foreheadstabbed in the cheststabbed to deathdeath of friendf wordheld at gunpointpunched in the facerescueshot in the chestblood splattercorpsecell phonepistolsurprise endingchaseknifeviolencebloodcharacter name in titleone word titleinterviewflashbackbare chested malefighttitle spoken by charactershowerbeatingfistfightcar accidentmirrorshot in the headcomputercamerabrawlshowdownriflehand to hand combatbedinterrogationriversciencekung fuscientistshot in the backbedroomassassinambushstrangulationimpalementmixed martial artsdinerman with glassesdisarming someonedouble crossdrowninglatex glovesattempted murdertreebeaten to deathdangerkaratesuitcasecover upkicked in the faceshot in the shoulderinjectionisolationlaptopneck breakingdirectorial debutsubtitled scenetrustsabotagehead buttelectronic music scorehypodermic needlelooking at oneself in a mirrorcatfightmutantjoggingcookbeardpsychologistcompassionandroidpresumed deadfull moonrampagestealing a carblood on facefight to the deathgash in the faceevacuationpunched in the chestaerial shotdeerstabbed in the eyefemale doctorpiertied feetcorporationmutationkilling spreeclonestick fightmoral dilemmasouthern accentimprisonmentclose up of eyesfemale assassinforename as titlefinal showdownpistol whipsuper strengtheuthanasiaabandoned houseyoung version of characterbunkerhired killergenetic engineeringmercy killingwoman kills a mandeath of boyfriendexperiment gone wronghigh techmysterious womangeneticsdistrustcloningimprovised weaponunwanted kisslocked in a roombroken necksolitary confinementscience runs amokbilingualisminnocent person killedsurveillance footagebitten in the throatwoman's neck brokendeoxyribonucleic acidthroat rippingcorporate executivebritish actor playing american charactermanor househumanoidvideo recordingtranquilizer dartsuper soldierhybridlethal injectionscience experimentsecret laboratoryhunting rifleprototypehead held underwaterresearch facilitysmothered to deathhooded sweatshirttranquilizer gunstabbed with a pencar crashing into a treebloody hand printkilling a deerbehavioristmutant humanbody in waterstrapped to a bedwoman kills a womanrisk management (See All)

8mm (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

8mm (1999)

A small, seemingly innocuous plastic reel of film leads surveillance specialist Tom Welles down an increasingly dark and frightening path. With the help of the streetwise Max, Welles relentlessly follows a bizarre trail of evidence to determine the fate of a complete stranger. As his work turns into … obsession, he drifts farther and farther away from his wife, family and simple life as a small-town private eye. (Read More)

Subgenre:
conspiracysuspensecult filmfish out of waterpsycho thriller
Themes:
home invasionsurveillancepsychopathdeceptioninvestigationescapebetrayalrevengemurderdeathsuicidekidnappingmoneyprisonfear …torturefilmmakingangercorruptionbrutalityobsessionparanoiasadismevilhollywoodcrueltypanicdeath of daughter (See All)
Mood:
neo noirdarkness
Locations:
small townhospitalnew york citybarswimming poolcemeterylos angeles californiabustaxiairportwheelchairmotelstrip clubbrothelfire truck
Characters:
husband wife relationshiptattooprostitutedetectivebabyhostagelawyerfilm directorpimp
Period:
1990s
Story:
threatened with a knifefoot chasestabbed in the shoulderfilmed killingclimbing through a windowmasked killerbookstorestabbed in the neckduct tape over mouthkicked in the stomachstabbed in the stomachsociopathanswering machinerevelationstabbed in the back …stabbed in the cheststabbed to deaththroat slittingambulancebound and gaggedf wordheld at gunpointfalling from heightmaskpunched in the faceshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingchaseknifenumber in titlebloodviolencesexfemale nuditymale nuditymale frontal nuditymale rear nuditybondagebare chested malegunfemale rear nudityfightfemale full frontal nuditycigarette smokingnipplesphotographtitle spoken by charactermale full frontal nuditytelephone callfirebeatingfistfightbrawlbare buttlettershootingshowdownsunglassesinterrogationprostitutioncriminalstrippertelephoneshot in the backgay slurstrangulationmansionimpalementwidowprisonerman with glassesnundisarming someoneacronym in titledouble crosslimousinelibrarybinocularsbeaten to deathdangersuburbperson on firepay phoneundercovermissing personcover upevil mankicked in the facelightningdiaryshot in the shoulderbodyguardthreatpremarital sexcharacter says i love yousilencerarsonrunawayprivate detectiveeavesdroppingpornographyuziundergroundburned aliveheavy raintape recorderscene during opening creditssexual abuserecordinghollywood californiavideotapedesperationsadomasochismbrooklyn new york cityfaked deathhomicidemasked manmechanicthugcrossbowcynicismhatredkickingheadphonesmiami floridabutlersenatorpunched in the chestsafethrown through a windowknife fightfilm producerrainstormgasolineburned to deathprivate investigatorsouthern accentdead girlimpersonating a police officerpervertabandoned buildingmysterious mansidekickporn magazineshot in the neckpistol whipvideo storepictureporn industryloss of daughterbrooklyn bridgesexual perversionfilm projectormasochismdegradationmessageunderworldbody in a trunkpornographercrashing through a windowsnuff filmpalm treekicked in the headdecadencegarbage truckknife murderwatching a videosex shopprivate eyecleveland ohiocriminal investigationabandoned warehousewiretappingguillotinedepravityvinylred light districtmistreatmentsuper 8mmsexual sadismsexual torturesexual crueltyfilm reelporn directorvideotaped sexfiendviolent sexwall safemicrofilmpornographic videodeviant sexunusual sex act8mmpainful sexporno shopsadomasochism clothingback alleyadult bookstoregimp maskhall of recordsmeat processing plantharrisburg pennsylvania (See All)

P2 (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

P2 (2007)

The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.

Subgenre:
suspenseblack comedyindependent filmpsycho thrillerslasher flickpsychological thrillerholiday horrorchristmas horror
Themes:
surveillancepsychopathdeceptioninvestigationescapedrunkennessbetrayalrevengemurderdeathkidnappinginfidelitychristmasfearloneliness …obsessionparanoiainsanitymental illnessabductioncrueltypanicmadnessnear death experience (See All)
Mood:
slashergoreneo noircar chasedarknessone night
Locations:
elevatornew york citycarsnowwatertaxiurban settingpolice carcityoffice
Characters:
female protagonistpolicepolice officerpolicemanhostagesecurity guardpolice detectiveslasher killermysterious villain
Period:
winter
Story:
foot chasedeeply disturbed persontauntingstupid victimstabbed in the shoulderintestinescharacters killed one by onedisembowelmentduct tape over mouthtensionparking garagekicked in the stomachimpersonationsecurity camerasociopath …answering machineknocked outelectrocutionstabbed in the backtied to a chairvideo cameraambulancebound and gaggedflashlightf wordpunched in the faceblood splatterdigit in titlecorpsecell phonesurprise endingchaseknifepartynumber in titleviolencebloodone word titledogfightexplosiontelephone callfirecryinghigh heelsbeatingfistfightcar accidentmirrorbrawlplace name in titlerunningcar crashhandcuffsvoyeurmanhattan new york citysubjective cameracleavagesurvivalnewspaperwinestrangulationaxestabbingwomannonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimescreamingperson on fireattackcharacter's point of view camera shotproduct placementkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodyisolationdie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppingburned alivekilling an animalcaptivevideotapecovered in bloodteddy bearfaked deathanimal attackcrushed to deathbarefootwoman in jeopardydamsel in distressfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdownburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkdruggedhandcuffedwoman kills a manmurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passionchristmas decorationstragic villainwrench911power failurebipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signalduct tape gaglock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Don't Say A Word (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Don't Say A Word (2001)

A group of thieves steal a rare gem, but in the process, two of the men double cross the leader of the thieving group, Patrick, and take off with the precious stone. Ten years later, prominent psychiatrist Nathan Conrad is invited to examine a disturbed young woman named Elisabeth. Patrick immediate …ly kidnaps Nathan's daughter, forcing Nathan to attempt to get Elisabeth to reveal a secret number which will ultimately lead Patrick to the whereabouts of the precious gem that has eluded him. (Read More)

Subgenre:
suspenseblack comedyheist
Themes:
greedhome invasionsurveillancedeceptioninvestigationescapebetrayalmurderdeathrevengefriendshipkidnappingmoneyfeartorture …voyeurismrobberyangertheftdeath of fatherparanoiainsanitypanicpolice investigationnear death experience (See All)
Mood:
neo noir
Locations:
police stationelevatornew york citytrainmotorcyclecemeteryurban settingapartmentpolice carmotorcycle accident
Characters:
husband wife relationshippolicefather daughter relationshipmother daughter relationshiptattoopolice officerdetectivephotographerhostagethieflittle girlsecurity guardpolice detectivepsychiatristolder man younger woman relationship …police shootoutdoctor patient relationshipdeath of girlfriendcoroner (See All)
Period:
1990s2000syear 1991
Story:
sole black character dies clichethreatened with a knifefoot chasered herringfemale copstabbed in the armhiding in a closetstabbed in the legpunched in the stomachcrime sceneparking garagekicked in the stomachsecurity camerasociopathrevelation …suspicionpolicewomanknocked outcharacter repeating someone else's dialoguepolice officer killedstabbed in the cheststabbed to deathdeath of friendambulanceflashlightf wordheld at gunpointpunched in the facerescueshot in the chestshot to deathcorpsecell phonepistolsurprise endingchaseknifebloodviolencebased on novelflashbackmasturbationdogfightcigarette smokingphotographtitle spoken by characterexplosionsingingshootoutbeatingfistfightshotgunslow motion scenewatching tvcameraarrestgunfightbrawlvomitingshowdowntearshandcuffsvoyeurislandrevolverrivermanhattan new york citycriminaltelephoneshot in the backorphangangambushaxebridgesubwaymapexploding carcoffindrawingchild in perildouble crossvangraveyardracial slurgunshotflash forwardattempted murdergravedangerprologuerace against timedollopening action scenescreamskeletonbankshot in the shouldermanipulationscarinjectiontragic eventstalkinglaptoploss of fatherbank robberyex convictshot in the armhenchmanclaim in titlesyringefireplacehead butthypodermic needleheavy rainscene during opening creditsloss of friendpatientmorguewristwatchdesperationskullbrooklyn new york cityparadefollowing someoneburialschizophreniabroken legmasked manbikermental institutionthughaunted by the pastdiamondexplosivesurveillance cameraitalian americankicked in the crotchshovelpost traumatic stress disorderautopsydark pastlanternbruiseethnic slurferrysirennewspaper clippingfemale detectivethanksgivingplaying cardsenglishman abroadmental patientfinal showdownburied aliverobberimperative in titlestuffed animalspit in the facelong hairsubway stationcrutchessubtitlescomputer crackerarmed robberybrooklyn bridgebank robberhearing voicesnarcissismoffscreen killingcripplemacguffinmarching bandmotorboatski maskwoman kills a manpsychiatric hospitaltwo way mirrorhit with a shovelspeedboatmugshottragic pastwoman fights a manoutlaw gangmotorcycle copjewelimprovised weaponschizophrenicbroken neckhummerwiretappinginnocent person killedhide and seekcryptgrave diggingreference to sigmund freudhit by a traindutch anglepost traumatic stressdisabled personbank vaultbank heistjewel thiefnypdel trainpagerloss of girlfriendrepressed memorystowawayempire state building manhattan new york citysafe deposit boxdeadlineleg bracenumberbreakfast in bedjewel theftdiamond theftjewelry heistlock pickrubyhidden messagegetaway carpolice escortsanatoriumleg castleg in a castplastic explosivethanksgiving dayburned with a cigarettefaking illnessgemstonementally disturbed personjewelry theftsemtexchild psychiatristescape from a mental institutionwilliamsburg bridgehit by a subway (See All)

Wrong Turn (2003) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
suspenseblack comedycult filmindependent filmfish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller
Themes:
murder of a police officerhome invasionpsychopathescapedeathrevengemurderfriendshipkidnappingfeartorturebrutalityparanoiainsanitypanic …cannibalismcouragehuntingwildernessnear death experience (See All)
Mood:
slashergore
Locations:
forestbathtubwoodspolice cartruckcavegas station
Characters:
self mutilationteenagerboyfriend girlfriend relationshipteenage girlteenage boypolice officerhostageinterracial relationshipslasher killer
Period:
2000s
Story:
villain not really dead clichethreatened with a knifefoot chasedead teenagerclichestupid victimstabbed in the shoulderdeputycharacters killed one by onegroup of friendsstabbed in the backpolice officer killedstabbed in the cheststabbed to deathdeath of friend …bound and gaggedflashlightfalling from heightrescueblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifeviolencebloodsexcigarette smokingexplosionfirecryingbeatingcar accidentshot in the headshotgunslow motion sceneshowdownriflecar crashmarijuanacollegeshot in the backdecapitationsurvivalambushaxemountaintoiletmapexploding carsevered headdisarming someonehit by a carshot in the legtreestalkerdangerprologuescreamingperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partwaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutanttied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legarrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyehillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendtow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned carwest virginiaham radiostate trooperlatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

You're Next (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

You're Next (2011)

When a gang of masked, ax-wielding murderers descend upon the Davison family reunion, the hapless victims seem trapped... until an unlikely guest of the family proves to be the most talented killer of all.

Subgenre:
conspiracyblack comedyslasher flickdeadpan comedy
Themes:
home invasiondeath of motherpsychopathdeceptionmurderdeathdeath of fatherdeath of wifepanicinheritance
Mood:
slashergore
Characters:
serial killerhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipaustralian
Story:
foot chasethrown through a glass doorstartledstabbed in the foothiding under a bedstabbed in the shoulderstabbed in the armcharacters killed one by onemasked killerstabbed in the neckcharacter repeating someone else's dialoguestabbed in the backpolice officer killedshot in the foreheadno opening credits …stabbed in the cheststabbed to deaththroat slittingflashlightpunched in the faceblood splattershot to deathcorpsecell phonesurprise endingknifeviolencebare breaststwo word titlebare chested malecigarette smokingtopless female nudityslow motion sceneneighborshot in the backwineaxemansionimpalementargumentbeaten to deathcollege studentshot in the shoulderdeath of brotherbasementtrapclaim in titlefireplaceheroinemachetefaintingcovered in bloodmasked mancamera shot of feetcrossbowdark humorkicked in the crotchtitle appears in writingstabbed in the headsibling rivalryjumping through a windowthrown through a windowbooby trapdeath of sistertitle at the endstabbed in the eyelooking at self in mirroraxe murderarrowmale in showerclose up of eyesman cryingshot through a windowwoman cryingfamily reunionbroken windowhired killerhead bashed inwoman in bra and pantiespatricidecrashing through a windowman punching a womancollege professordeath of boyfriendstabbed in the facemasked villainmatricidefilm starts with sexbloody violencebutcher knifesole survivorwedding anniversaryflash camerafratricideleg woundsaying gracethroat cutbrickwoman wearing black lingeriejumping out a windowwoman punching a manstabbed multiple timeswriting in bloodbig familybitten handrich familyloud musichit with a frying panmale in a showerno cellphone signalcleaversurvivalistblenderfacial cutfamily portraithit in the throatstabbed with a screwdrivervictim invited to dinnervicodinclotheslinedvictim fights backpiano wirestabbed with a glass shardlooking under a bedstepping on a nailbreaking a lightbulb (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Guest (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Guest (2014)

Subgenre:
suspenseblack comedyindependent film
Themes:
death of motherpsychopathdeceptionbetrayalmurderdeathrevengefriendshipdeath of fatherblackmailgriefbullying
Mood:
high schoolcar chase
Locations:
small townbarrestaurantrural settingfarmfire truck
Characters:
husband wife relationshipteenagerfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipbrother sister relationshipteenage boytough guybullywaitressex soldier …military police (See All)
Story:
villain not really dead clichehiding under a bedstabbed in the legstabbed in the neckunderage drinkingsuspicionhigh school studentcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadno opening creditsstabbed in the cheststabbed to deathdeath of friendthroat slitting …ambulanceflashlightf wordpunched in the faceshot in the chestblood splattershot to deathcorpsepistolsurprise endingknifepartybloodviolencebare breastsbare chested malesex scenekisscigarette smokingphotographexplosionfireshootoutwoman on topbeatingfistfightmachine gunshot in the headshotgunslow motion scenewatching tvarrestbrawlbeercar crashmarijuanaclassroomrevolvershot in the backsubjective camerahalloweengay slurstrangulationdrug dealerdinerone man armydouble crossshot in the legbartenderone against manyhalloween costumeshot in the shoulderdeath of brotherdeath of sonlaptoppremarital sexcharacter says i love youmercenarykissing while having sexnewspaper headlinepickup truckpot smokinggrenadeelectronic music scorejoggingnosebleedstrangerfaked deathfollowing someonefalse identitybar fightbroken legstealing a carbloody noseguestpost traumatic stress disorderspecial forcesjumping through a windowassault rifletitle at the endcellphonebruisekilling spreehalloween partyframed for murderfirefighterberettabeing followedshot through a windowvillain played by lead actorharassmentmysterious manshot in the neckmazehomagearms dealermajorbully comeuppancemedalcdcrashing through a windowscarecrowexperiment gone wrongshot in the footoverhead camera shotdetentionbreaking a bottle over someone's headman with no namejack o'lantern555 phone numberescaped mental patientwoman wearing black lingeriejob promotionprotective malestrobe lightdog tagquarryrunning for your lifebritish actor playing american characterhundred dollar billshot through a wallbalisonghigh school principaldrink thrown into someone's faceclotheslinepumpkin carving20 year oldhalloween decorationfalse accusation of murderbeer kegman wearing a towelhomemade haunted house attraction360 degree well shothall of mirrorsunderground parking garagebloody footprinthead on collisionneo 80scrawling on the floorface spattered with bloodbashing someone's head into a wallchained doorhit with a pool cuecosmopolitan the drink (See All)

Bride Of Chucky (1998)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bride Of Chucky (1998)

Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.

Subgenre:
conspiracyblack comedycult filmsupernatural
Themes:
murder of a police officerpsychopathdeceptionescapebetrayaldeathrevengelovemurdersurrealismkidnappingmarriagemoneypregnancyfear …weddingseductionrobberybrutalitysupernatural powerparanoiaredemptionsadismunrequited lovepanicpolice brutalitypolice corruptionnear death experienceregret (See All)
Mood:
slasherhigh schoolgorecar chasepoetic justice
Locations:
police stationhotelcemeterybathtubwaterkitchenpolice carroad tripmotel
Characters:
self referentialex boyfriend ex girlfriend relationshipserial killerteenagerpolicehomosexualboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepriesthostage …thiefpolice detectivemaidgay teenageruncle niece relationshipgay friendmurder of girlfriend (See All)
Period:
1990s
Story:
villain not really dead clichestupid victimsequel to cult favoritedead woman with eyes openfemale killerfourth partsociopathsuspicionfilm within a filmknocked outcharacter repeating someone else's dialogueelectrocutionstabbed in the backpolice officer killednews report …femme fataletied to a chairstabbed in the chestthroat slittingflashlightf wordheld at gunpointrescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifeviolencebloodsequelsexcharacter name in titlebare chested malegunkissfightcigarette smokingphotographfirecryingbeatingcar accidentmirrorslow motion scenewatching tvbare buttlettershowdownrock musiccar crashdead bodymarijuanahandcuffsrevolvertelephoneorphanambushstrangulationmansionmontagebridgeimpalementexploding carfalse accusationdisarming someonecoffindrawinghit by a cardouble crossritualvangraveyardmarriage proposalon the runattempted murderargumentstalkerdangerscreaminglocker roompay phonefugitiveumbrellarace against timedollbaseball batlightningskeletonringscarfishnet stockingsstalkingchildbirthexploding bodypremarital sexrattied upobscene finger gesturenewspaper headlinearsoncorrupt copmaniacprivate detectiveflirtingchainsawpot smokingsabotagefireplacehead buttgothicheavy rainscene during opening creditsragemutilationtoyspiderphone boothskullbirthblack humormexican standoffback from the deadmale underwearpresumed deadwoman in jeopardydamsel in distressnicknamesevered fingernew jerseyblood on facemisunderstandingdual wieldgash in the faceresurrectionconvenience storedark humorshot in the faceescape attemptcigarette lighterframe upcon artistlaughterthrown through a windowbooby trapwisecrack humortitle at the endrainstormdisfigurementknife throwingraised middle fingertrailertied feetvoodooframed for murderprivate investigatorengagement ringclose up of eyesspellgothmarijuana jointabandoned buildingblood on camera lenssuffocationharassmenthysteriaface maskfinal showdownteenage lovescene before opening creditsabuse of powerpicturelighterpolice chieftelling someone to shut uphomicidal maniacdisposing of a dead bodytrailer homeframedmasturbation referenceburnt facebody in a trunkhit by a truckcookietrailer parkmacguffinwoman kills a mandomestic abusecleaning ladyburnt bodycar set on firechapeldisfigured facehit with a shovelrepeated linemultiple murderamuletknife murderrecreational vehiclepillowhandymantongue in cheekpentagrammurder of a nude womanmass murdererinnocent person killedproposalgrave diggingovenasphyxiationdecomposing bodyabusive relationshipevil dollnail polishfemale serial killernailwine bottlereference to frankensteinchange of heartdead parentshockey maskfragments of glassanti villainfemale thiefstabbed in the heartknife wounddeath of unclewaterbedplanting evidenceevil laughterfalse accusation of murderhandcuffed to a bedkiller dollairbagsoul transferencedumb policereference to martha stewartincantationlovers on the lamsee you in helltwo killersaccused of murdermultiple stabbingrunaway teensmothered with a pillowknife in backchief of policesmothered to deathwoman electrocutedexploding trailerfemale sociopathreference to jerry springerhunkbreaking a plateburnedtalking dollbig nosebiting handpiercing ripped outcleaning up bloodelectrocuted in bathtublegal guardianalpha maleelectrical firereference to bonnie and clydetight dressbreathalyzernose piercinghidden bodycriminal duoerieloss of unclemeatballspushed through a windowshot through the headbindsuitebiting an earelopingtreatcrayon drawinglip piercingreference to christian slatersinister coupleplanting drugswater bed (See All)

The Devil's Rejects (2005) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
black comedycult filmindependent filmpsycho thrillersadistic horror
Themes:
murder of a police officerdeath of motherpsychopathdeceptionescapebetrayaldeathrevengemurderfriendshipsuicidekidnappingrapefeartorture …seductionangerdeath of fatherbrutalityparanoiainsanityhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessnear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
police stationbarbathtubfarmroad tripmotelgas stationtexasbrothel
Characters:
aunt niece relationshipsheriffserial killerhusband wife relationshippolicefamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitute …police officernursehostagetough guyvillainmaidterrorpolice shootoutpimpsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
sole black character dies clichethreatened with a knifefoot chasedeputystabbed in the handmedia coveragestabbed in the legstabbed in the neckstabbed in the throatcrime scenefemale killerkicked in the stomachstabbed in the stomachknocked outelectrocution …stabbed in the backpolice officer killedshot in the foreheadnews reporttied to a chairstabbed in the cheststabbed to deathdeath of friendthroat slittingbound and gaggedf wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolchaseknifeviolencesequelbloodflashbackmale rear nuditydogbare chested malesex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionpantiesshowerfireshootoutwoman on topbeatingdreammachine gunhorseface slapshot in the headshotgunslow motion scenewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownriflebeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backsurvivalgay slurambushstrangulationaxedrug dealerimpalementcocainefemale pubic hairwhite pantiescultdream sequenceanti herochild in perildouble crosscigar smokingshot in the legracial sluron the runbeaten to deathscreamingclownpay phonefugitiveevil manopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererchickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatphone boothcovered in bloodgrindhouserapistinterracial friendshipmasked mangas maskwatching televisionrampageredneckstealing a carhatredhit in the crotchcannibalmercilessnessbutcherescape attemptreference to satancigarette lighterdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingsouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckman kills a womantrailer parkman punching a womanfemale villainmacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Dracula 2000 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dracula 2000 (2000)

In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)

Subgenre:
suspenseblack comedycult filmmartial artscoming of agesupernaturalheist
Themes:
home invasionsurveillancedeceptionescapebetrayaldeathrevengemurderfriendshipsurrealismsuicidekidnappingfearseductionrobbery …death of fathersupernatural powerparanoiaevilpanic (See All)
Mood:
gorenightmare
Locations:
police stationschoolchurchcemeteryairplanelondon englandtaxiairportshiprooftopcatholic church
Characters:
father daughter relationshipdoctorpriesthostagethiefvampirewarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest
Period:
2000s
Story:
threatened with a knifefoot chasestupid victimfilmed killingstabbed in the armstabbed in the throatparking garagekicked in the stomachsecurity camerarevelationknocked outstabbed in the backpolice officer killednews reportfemme fatale …stabbed in the cheststabbed to deathdeath of friendthroat slittingdisguiseflashlightf wordheld at gunpointfalling from heightpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifepartynumber in titlebloodviolencesexcharacter name in titleflashbackbare chested malegunfightphotographexplosionlesbian kissdreamfistfightmirrorshotgunslow motion sceneswordarrestbrawlpaintingshowdownhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backdecapitationgood versus evilsurvivalbedroomcandleambushold manstrangulationmassacreimpalementmixed martial artssuicide attemptmapsevered headcoffindouble crosssearchtransformationracial slurflash forwardattempted murderlibrarypilotcursekeyperson on fireproduct placementrace against timeevil mankicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexdirectorial debutsevered armundeadstylized violencewerewolfropetraitordestinywolfburned alivehypodermic needlegothicscene during opening creditscrucifixstealingjumping from heightskullmind controlcarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglaryhatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All)

Cabin Fever (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
suspenseblack comedycult filmindependent filmb movieabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
home invasionescapedrunkennessrevengemurderdeathfriendshipdrinkingfearbrutalityparanoiaguiltinsanityillnessunrequited love …exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
goreraincar chaseambiguous ending
Locations:
hospitalforestbathtubbicyclewaterwoodsfarmlaketruckcavegas stationcampfirebackwoodsshed
Characters:
self mutilationsheriffpolicefather son relationshipafrican americanboyfriend girlfriend relationshipdoctorpolice officerhomeless mankiller dog
Period:
2000s
Story:
threatened with a knifefoot chaseclichespitting bloodstabbed in the footstupid victimdeputycharacters killed one by onestabbed in the legdisembowelmentstabbed in the neckstabbed in the throatunderage drinkingtensiongroup of friends …vigilanteknocked outstabbed in the backshot in the foreheadtied to a chairstabbed in the cheststabbed to deathdeath of friendambulancef wordheld at gunpointpunched in the faceshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifepartyviolencebloodfemale nudityfemale frontal nudityflashbackmasturbationdogbare chested malesex scenefemale rear nuditycigarette smokingfingeringphotographpantiesshowerfirewoman on topbeatinghorsecar accidenturinationblondeshot in the headshotgunslow motion scenewritten by directorbikinibrawlbare buttvomitingriflebeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backswimmingdecapitationcleavagesurvivalgay slurambushaxemassacreimpalementbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the leglatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathkaratescreamingperson on fireproduct placementstorytellingvacationbaseball batcollege studentscene during end creditsisolationpigpremarital sexdirectorial debutsevered armshot in the armobscene finger gesturecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagestealing a carconvenience storerowboatescape attemptmedical examinationstabbed in the headscene after end creditspunched in the chestinfectionracistslaughterdeerdisfigurementranchsevered legflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootinghillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footcamera focus on female buttblond boyno survivorsbanjodecomposing bodybitten handposseskatergeneral storeleft for deadlemonadeblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

The Purge (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Purge (2013)

In an America wracked by crime and overcrowded prisons, the government has sanctioned an annual 12-hour period in which any and all criminal activity-including murder-becomes legal. The police can't be called. Hospitals suspend help. It's one night when the citizenry regulates itself without thought … of punishment. On this night plagued by violence and an epidemic of crime, one family wrestles with the decision of who they will become when a stranger comes knocking. When an intruder breaks into James Sandin's (Ethan Hawke) gated community during the yearly lockdown, he begins a sequence of events that threatens to tear a family apart. Now, it is up to James, his wife, Mary (Lena Headey), and their kids to make it through the night without turning into the monsters from whom they hide. (Read More)

Subgenre:
suspensedystopiapsycho thrillersurvival horror
Themes:
home invasionsurveillancepsychopathdeceptionbetrayalmurderdeathrevengefeartorturedeath of father
Mood:
slashersatireneo noirone night
Characters:
husband wife relationshippolicefamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiphomeless manneighbor neighbor relationship
Period:
2020s
Story:
hiding under a bedfilmed killinghiding in a closetmedia coveragelens flarestabbed in the legduct tape over mouthstabbed in the stomachsecurity cameracharacter repeating someone else's dialoguestabbed in the backnews reporttied to a chairstabbed in the cheststabbed to death …death of friendbound and gaggedflashlightf wordheld at gunpointrescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifeviolencebloodtitle spoken by charactershootoutbeatingmachine gunshot in the headshotgunwritten by directorinterrogationneighborrevolvershot in the backsurvivalaxemansionchild in perildouble crossshot in the legattempted murderbeaten to deathsuburbstalkingthreatdeath of husbandbasementdie hard scenariocharacter says i love youfirst partclass differencesmacheteshot in the stomachscene during opening creditsnosebleedsocial commentaryclockmasked manmoralitypower outagepool tabletitle appears in writingjumping through a windowone dayschoolgirl uniformfamily dinneraxe murderkilling spreemoral dilemmahit with a baseball batblood on camera lensminimal castself defense18 year oldfilm starts with textupper classdeath of boyfriendbroken nosetormenttreadmillsocial decaycat and mousechild with a gundog tagsecurity systemfamily in dangerleft for deadsingle set productionmasked womanremote controlled toy cartooth knocked outcontainmentemergency broadcast systemmasked intruderhit with a pool cueunder the bed (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Escape Plan (2013) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Escape Plan (2013)

Ray Breslin is the world's foremost authority on structural security. After analyzing every high security prison and learning a vast array of survival skills so he can design escape-proof prisons, his skills are put to the test. He's framed and incarcerated in a master prison he designed himself. He … needs to escape and find the person who put him behind bars. (Read More)

Subgenre:
conspiracyblack comedymartial arts
Themes:
surveillancedeceptionescapebetrayaldeathrevengemurderfriendshipkidnappingmoneyprisontorturesadismself sacrificeprison escape
Locations:
beachhotelhelicopterairplanelos angeles californiashipcar explosioncar bombfire truckprison fightwater tortureship fireprison ship
Characters:
sherifffather daughter relationshipdoctortattoolawyertough guywarriorbiblesnipermuslimsniper rifleship captainescape artist
Period:
2010s21st centuryyear 2013
Story:
threatened with a knifefoot chasestabbed in the shoulderstabbed in the legpunched in the stomachwalkie talkiesecurity camerasociopathfalling down stairscharacter repeating someone else's dialogueelectrocutionauthorshot in the foreheadno opening creditstied to a chair …stabbed in the chestdisguiseflashlightf wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifebloodviolenceflashbacktwo word titlebare chested malefightcigarette smokingexplosionfireshootoutbeatingfistfightmachine gunshot in the headshotgunslow motion scenearrestbrawlletterhand to hand combatinterrogationhandcuffsshot in the backsubjective cameragay slurstrangulationaxebasketballprisonermapexploding carone man armydrawingdouble crossunderwater sceneshot in the legbinocularsperson on firepay phonecharacter's point of view camera shotundercovershot in the shoulderinjectionneck breakingmercenaryex convictshot in the armsilencersubtitled scenefreeze framemachismoburned alivehead butthypodermic needleshot in the stomachjail cellphone boothfalse identitymasked manfull moonprison guardfloodexplosivedual wieldpower outagenew orleans louisianafalling to deathmiami floridaescape attemptassault riflewisecrack humore mailundercover agentconvictraised middle fingerlasersightfirefightertracking deviceclose up of eyessatelliteshot through a windowblood on camera lenscia agentprayingface maskbag over headcafeteriatwist endingcomputer crackerfemale spycoloradofemale lawyercomputer hackermoroccocar set on firehigh techairfieldpsychological torturecockney accentprison wardensolitary confinementfinger gunslow motion action sceneprison riotescaped prisonergas grenadeplanninguh 1 huey helicopterreference to allahgun fightwaterboardingcargo shipmaximum security prisonprison gangescape planreference to houdinihit with a wrenchmisdirectiontaseredclimbing a ladderchocolate milksuturereference to the three musketeersinjected in necksadistic wardenkeypaddiversionary tacticfiring guns from both handssecurity expertmotion detectorsextantlocked in a carmorpho butterflytransponder (See All)

Sorority Row (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sorority Row (2009)

"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.

Subgenre:
black comedy
Themes:
drunkennessbetrayaldeathmurderfriendshipguilt
Mood:
slashergorehorror movie remake
Locations:
kitchenfire truck
Characters:
serial killerfather son relationshipboyfriend girlfriend relationshipbrother sister relationshipinterracial relationshipalcoholicmysterious killerdeath of a friend
Story:
reference to facebookfilmed killingwebcamhiding in a closetlaptop computercharacters killed one by onedead woman with eyes openstabbed in the legstabbed in the neckstabbed in the throatsociopathcharacter repeating someone else's dialoguestabbed in the chestdeath of friendthroat slitting …ambulanceflashlightheld at gunpointpunched in the faceshot in the chestblood splattercorpsecell phonesurprise endingchaseknifepartyviolencebloodfemale nudityfemale frontal nuditymale rear nuditybare chested malefemale rear nuditypantiesshowerfiremirrorblonderemakeshotgunslow motion scenebare buttsecretvomitinglingeriecollegehallucinationhandcuffsvoyeuralcoholcleavagestrangulationaxeimpalementaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiesperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardyironygash in the facestabbed in the headsenatoraccidental killinghot tubraised middle fingercanered pantiesmisogynyfemale in showerlyingfirefightervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailmisogynistdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All)

Green Room (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Green Room (2015)

A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.

Subgenre:
suspenseindependent filmpunksurvival horror
Themes:
deceptionescapebetrayalmurderdeathrevengefriendshipkidnappingfearracismtheftbrutalityparanoiapanicnear death experience
Mood:
gore
Locations:
barrestaurantforestbicyclewoodsrural settingpolice carcampfire
Characters:
cousin cousin relationshippoliceboyfriend girlfriend relationshiptattoosingerpolicemanhostagetough guywarriorjewishreference to godgermanblonde girlkiller dog
Period:
2010s
Story:
threatened with a knifestabbed in the foreheadstabbed in the armstabbed in the handcharacters killed one by onedisembowelmentstabbed in the neckstabbed in the throatcrime scenetensionstabbed in the stomachsociopathrevelationpolicewomanstabbed in the back …shot in the foreheadno opening creditsstabbed in the cheststabbed to deathdeath of friendthroat slittingflashlightf wordheld at gunpointshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifeviolencebloodinterviewdogtwo word titlefightcigarette smokingphotographshootoutshot in the headshotgunslow motion scenewritten by directorgunfightbrawlshowdownbeercollegecolor in titlerevolvershot in the backsurvivalgay slurbandambushconcertstrangulationdrug dealermontagedinerman with glassesdisarming someonedrawingvanshot in the legbartenderracial slurattempted murdermicrophonedangerrace against timecover uptough girlbaseball batinjectionwitnessisolationstagedie hard scenarioheroinrecord playerhenchmantraitorhypodermic needlemachetetape recordermutilationguitaristdesperationcrying mananimal attackeaten alivefemale warriorthugpromisepump action shotgunstealing a cartrappedface paintcouchmercilessnesspower outageshot in the faceevacuationdrummerescape attemptstabbed in the headcigarette lighterframe upaerial shotone daycellphonegasolinedressing roombroken armduct tapeethnic slurposterdrumsfire extinguisherswastikagateshot in the neckremorseblackoutskinheadstandoffdisposing of a dead bodybunkertrailer homeneo naziself defensetape recordingcornfieldshot in the eyeelectric guitarman kills a womann wordwoman kills a manbleeding to deathmurder witnesssleeping in a caroregonbouncerfart jokemusic gigpool of bloodimprovised weapongang leaderanimal killingportland oregonclimbing out a windowreference to madonnavinylthroat rippingpunk musiccut armpacific northwestheld hostagegreen hairmohawk haircutradio hostreference to britney spearsconfederate flagshot in the kneewhite supremacistbar ownerbassistpep talk911 calldragging a dead bodymulletcleaverpitbullpunk bandbass guitarhuman shieldchoke holdbitten in the facebox cuttermeth labescalationmaulingrock clubbitten on the legkilled by a dogskating rinkreference to princereference to iggy popdrug labgas siphoningreference to simon and garfunkelreference to black sabbathbattle cryreference to ozzie osbournefalling asleep at the wheelgreen roomreference to odinreference to slayer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Taking Lives (2004)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Taking Lives (2004)

The film starts in the early 1980s. Young Martin Asher took a bus for Canada. He meets another teen on the bus Matt Soulsby. When the bus broke they decided to rent a car and drive to Seattle. On the road the car gets a flat tire, and Matt starts changing the tire Martin comments on how he and Matt  …are about the same height and he quickly pushes Matt in the way of an oncoming truck causing a huge accident where Matt and the driver both die. He took Matt's guitar and left singing like Matt did. Twenty years later, an FBI profiler, Illeana Scott comes to Canada to help hunting down a serial killer Martin Asher who killed multiple men and lived by their identities. Martin's mother claims that she saw Martin in Quebec city and she tells the police that Martin is evil. The police also has an eyewitness James Costa who saw Asher kill his last victim... (Read More)

Subgenre:
suspensepsychological thriller
Themes:
murder of a police officerhome invasionsurveillancepsychopathdeceptioninvestigationescapejealousybetrayaldeathmurderrevengekidnappingfearredemption …murder investigationpolice investigation (See All)
Mood:
gorerainneo noircar chasenightdarknesspoetic justice
Locations:
police stationelevatorhospitalbarrestauranttrainhotelsnowbathtubbusnightclubapartmentfarmpolice cartrain station …singing in a carpennsylvaniabus station (See All)
Characters:
serial killerpolicemother son relationshippolice officerdetectivehostageartistsecurity guardpolice detectivefrenchamerican abroadpolice chaseyounger version of characterfrench canadiancoroner …art thief (See All)
Period:
1980s2000syear 2004year 1983
Story:
threatened with a knifefoot chasered herringhiding under a bedwhodunitlaptop computerlens flarecrime scenestrong female leadimpersonationwalkie talkiesecurity cameraanswering machinestrong female charactercharacter repeating someone else's dialogue …police officer killednews reportstabbed in the cheststabbed to deaththroat slittingdisguiseflashlightf wordheld at gunpointshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifebloodfemale nuditybased on novelfemale frontal nudityflashbackbare chested malecigarette smokingnipplesphotographtitle spoken by characterexplosionshowerfirebeatingmachine guncar accidentface slapslow motion scenepaintingshowdownsunglassescar crashinterrogationsex standing uphandcuffsrevolverguitarcriminaldecapitationsurvivalgay slurambushstrangulationmansiondrug dealermontagebridgeexploding carsevered headman with glassesdisarming someonedrawinghit by a cardouble crosscoffeebartenderflash forwardattempted murdergravedrug addictstalkerprologuefbiumbrellamistaken identityrace against timedebtcover uptough girlskeletonscaramerican flagbodyguardstalkingdeath of sonwitnesspremarital sexfireworksnewspaper headlinesubtitled scenegaragefreeze framepizzamaniacmass murdergothicheavy rainmutilationfbi agentmorgueswat teamsevered handcovered in bloodskullart galleryfestivalfalse identitypresumed deadsevered fingerconstruction sitehit in the crotchimpostorsexismescape attemptblack and white scenejumping through a windowautopsyblood on shirtdisfigurementsuspectdark pastbruisepolice inspectorkilling spreeferryflat tiredrifterinsecurityold dark houseassumed identityscene before opening creditsspiral staircasefake identityfarmhouseboy with glassestwin brotherpolice captainhead bashed inhit by a truckstakeoutscene of the crimecrashing through a windoweyeballwoman kills a manburnt bodytwo way mirroroverturning carfatal attractiontragic pastmatricidepool of bloodbulldozercar rolloverfingerprintmass murdererfinger gunbilingualisminnocent person killedextreme close upsecret roomman slaps a woman555 phone numberstabbed with scissorstragic villainmontreal quebecidentity theftmusic concertgarroterainy nightferry boatart dealerexhumationfederal bureau of investigationhidden doorthrown through a windshieldforensic evidencekilled in an elevatorstolen identitywearing a sound wirebus tripdriving in the rainpicking a lockribbondentureshit on the head with a rockson murders motherfaked pregnancyart showstitchesteapotrunaway teendecomposed bodyemployee dismissalsurgical stitchesfbi profilercanadian flaglock picking (See All)

The Bone Collector (1999) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Bone Collector (1999)

Quadripeligic ex-cop Lincoln Rhyme was looking forward to his assisted suicide when he got the news: some sicko was abducting people in a taxi and leaving them to die in particularly sadistic ways. With time counting down between each abduction and possible death, Rhyme recruits rather-unwilling Ame …lia Donaghy, haunted by her cop father's suicide and thinking she's next, into working the crime scenes to track down the killer. (Read More)

Subgenre:
suspenseblack comedycult filmpsychological thriller
Themes:
home invasionsurveillancedeceptioninvestigationescapebetrayaldeathmurderrevengesuicidekidnappingchristmasfeartortureparanoia …panicmurder investigationsuicide of fatherfuture technology (See All)
Mood:
goreneo noircar chase
Locations:
police stationnew york citybartrainhelicoptertaxiairportwheelchairapartmentpolice cartaxi drivertunnelsewer
Characters:
serial killerpoliceboyfriend girlfriend relationshipdoctortattoopolice officernursedetectivehostagelittle girllittle boypolice detectivesuicide by gunshotself doubtdeath wish
Period:
1990schristmas party
Story:
red herringfemale copwhodunitbookstoreduct tape over mouthcrime scenetensionwalkie talkiesociopathrevelationpolicewomanknocked outauthorpolice officer killedambulance …bound and gaggedflashlightf wordheld at gunpointrescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifebloodviolencebased on novelbare chested malephotographtitle spoken by characterbased on bookmachine gunslow motion scenecamerabrawlhandcuffsrevolvermanhattan new york cityshot in the backambushsubwaymapman with glasseschild in perildouble crossvanracial slurflash forwardattempted murderdangerprologuescreamingpay phonerace against timeevil manchristmas treecollege studentlightningscarrattied upex convictnewspaper headlinedismembermentchessropeundergrounddestinybulletgothicheavy rainmutilationswat teamsevered handanimal attackwoman in jeopardydamsel in distresssevered fingeritalian americanmentoraerial shotrainstormbulletproof vestpierethnic slurworld trade center manhattan new york citynewspaper clippingmoral dilemmaengagement ringclose up of eyesabandoned buildingsuffocationdirector cameoburied aliveex copparalysissubway stationbrooklyn bridgeglockhospital bedpolice captainrailroadscene of the crimebitten in the neckski maskeaglesawseizurecluemicroscopebadgetragic pastslaughterhousesubterraneannew york skylinefingerprintpool hallanimal killingboneassisted suicideinnocent person killedchrysler building manhattan new york citymad doctorfootprintrookie cophandicapped personwall street manhattan new york citycaregivernypdrescue attemptblack glovesmob of reportersnailbroken handhot dog standoxygen maskcadaverbroken fingeroystercprsteamsevered faceforensicsforensic evidenceheadsetgrand central station manhattan new york citycontemplating suicidehandcuffed to a pipewoman stabbedhidden messagequadriplegicsecret messagecopycatsubway tunnelscaldingwomen in uniformrockefeller center manhattan new york citydeductionex modelasbestoscopycat killerhand signalcomputer chesssyracuse new yorkblack woman murdereddisposable cameradead nursehuman bitesteam pipecopycat crimestockyardabandoned subway station (See All)

The Crazies (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Crazies (2010)

As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.

Subgenre:
cult filmsurvival horrordisaster film
Themes:
murder of a police officerescaperevengedeathmurderfriendshippregnancymilitarydeath of fatherinsanityexecutionself sacrificehuntingmurder of familyghost town
Mood:
high schoolgoreambiguous endinghorror movie remake
Locations:
police stationsmall townswimming poolhelicopterboatbusdesertrural settingfarmpolice carlaketruckgas stationschool buscar explosion …fire truckhumveetruck accidentcountry doctorcity on fire (See All)
Characters:
sheriffhusband wife relationshipteenagerfamily relationshipsfather son relationshipmother son relationshipboyfriend girlfriend relationshipdoctorzombiesoldiersecretarymayor
Story:
stabbed in the shoulderdeputyhiding in a closetstabbed in the handstabbed in the throatwalkie talkiebarnshot in the foreheadno opening creditstied to a chairstabbed in the cheststabbed to deathdeath of friendambulancebound and gagged …f wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifeviolencebloodbare chested malefightexplosionfireshootoutmachine guncar accidentface slapremakeshot in the headshotguncomputerriflerevolvershot in the backsurvivalstrangulationmassacrearmyimpalementdinerexploding carchild in perilcoffeeon the runperson on firefugitivecover uptankscene during end creditsfarmerdeath of husbandhandgunarsonchild murderriotdiseasevirusjail cellhuntermorguenosebleedgenocidegas maskpump action shotgunu.s. armychaosgash in the facepolice officer shotcigarette lighterswampassault rifleconcentration campinfectionautopsyparachuteblood on shirtbulletproof vestgasolinefemale doctormutationburned to deathflat tirefirefightersatelliteshot through a windowdementiaepidemicpolice officer shot in the chestlockerhomicidal maniacplane crashdouble barreled shotguncar washcornfieldhand over mouthwhistlingroadblockbaseball gamedeath of boyfriendquarantinefuneral homeopen endedoverturning carpitchforkiowanuclear explosionhouse on firebaseball fieldmortuarytrancekeystruck stopmushroom cloudcar wreckflame throwerbiological weaponset on firebottled waterhazmat suitcircular sawhigh school principalburning cargovernment coveruphanged womanlaundry drying on clothes lineno cellphone signalcatatoniamarshamerican midwestchain link fenceweird behaviorinfectious diseasemouth sewn shutcatatonic statemaniacombine harvestergift shopcontamination suiteyes sewn shutatomic explosionsemiautomatic riflestabbed with a pitchforkharvesterdead pilotknife through handfemale physicianpull the plugsatellite imageshadowy figureexposure to radiationfugitive herowheel bootwooden match (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Purge: Anarchy (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Purge: Anarchy (2014)

A couple are driving home when their car breaks down just as the Purge commences. Meanwhile, a police sergeant goes out into the streets to get revenge on the man who killed his son, and a mother and daughter run from their home after assailants destroy it. The five people meet up as they attempt to … survive the night in Los Angeles. (Read More)

Subgenre:
suspensedystopiasurvival horror
Themes:
home invasionsurveillancepsychopathdeceptionrevengedeathmurderkidnappingdeath of fatherbrutalityhomelessnessself sacrificehuntingnear death experience
Mood:
slashergoreone night
Locations:
hospitalmotorcyclelos angeles californiabusapartment
Characters:
policefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoohostagetough guywaitresssniperex husband ex wife relationshipsniper riflehomeless man
Period:
2020s
Story:
foot chasehiding in a closetmedia coveragelens flareparking garagecharacter repeating someone else's dialogueshot in the foreheadnews reportno opening creditstied to a chairstabbed in the cheststabbed to deathambulancef wordheld at gunpoint …rescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifeviolencebloodsequelbare chested malephotographexplosionfireshootoutmachine gunshot in the headshotgunslow motion scenewritten by directorsecond partcar crashrevolvershot in the backsurvivalgangambushaxemansionsubwayexploding caranti herohit by a carshot in the legon the runlimousineperson on firecharacter's point of view camera shotrace against timeshot in the shoulderdeath of sonlaptopneck breakingtrapdie hard scenariomercenaryshot in the armclass differencesak 47chainsawhand grenadesabotageburned alivemass murdermacheteshot in the stomachmasked manapartment buildinggas maskstealing a carresistanceshot in the faceassault rifleghettobooby trapone daybulletproof vestflamethrowersirengatling gunauctiontracking devicehit with a baseball batmolotov cocktailbag over headarmored cararms dealerfilm starts with textteenage daughterman punching a womanhanged mandeath of boyfriendcar set on fireshot in the throatresistance fighternight vision gogglesman with no namerunning out of gaspainted facemilitantgas grenademass deathlatin americansemi truckdune buggysororicidepirate broadcastingemergency broadcast systembody in a dumpsteryear 2023 (See All)

Atomic Blonde (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Atomic Blonde (2017)

The crown jewel of Her Majesty's Secret Intelligence Service, Agent Lorraine Broughton (Theron) is equal parts spycraft, sensuality and savagery, willing to deploy any of her skills to stay alive on her impossible mission. Sent alone into Berlin to deliver a priceless dossier out of the destabilized … city, she partners with embedded station chief David Percival (James McAvoy) to navigate her way through the deadliest game of spies. (Read More)

Subgenre:
suspenseblack comedymartial artspunk
Themes:
home invasiondeceptioninvestigationescapedrunkennessbetrayaldeathmurderrevengekidnappinglesbianismfeartortureseductionbrutality …paranoiasadismpanic (See All)
Mood:
goreneo noircar chase
Locations:
elevatorbarrestauranttrainhotelsnowmotorcycleairplaneparis francebathtubnightclublondon englandwatertaxiairport …apartmentpolice carrooftoptunneltrain stationcar firecar in watercar into waterescape from a car in water (See All)
Characters:
female protagonisthusband wife relationshippolicefather daughter relationshipmother daughter relationshiptattoosoldierpolice officerhostagehitmansniperrussiangermanamerican abroadpolice shootout …sniper riflepolice chasecoroneramerican in the uk (See All)
Period:
1980syear 1989
Story:
threatened with a knifefoot chasestabbed in the foreheadstabbed in the armbody landing on a carstabbed in the legstabbed in the throatfemale killerstrong female leadkicked in the stomachfalling down stairsrevelationsuspicionknocked outcharacter repeating someone else's dialogue …stabbed in the backpolice officer killedshot in the foreheadnews reportfemme fatalestabbed in the cheststabbed to deaththroat slittingdisguisef wordheld at gunpointfalling from heightpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifepartyviolencebloodfemale nudityf ratedbased on novelmale nuditybare breastsflashbacktwo word titlebare chested malegunsex scenefemale rear nudityfightcigarette smokingphotographexplosionlesbian kissfiretopless female nudityvoice over narrationshootouthigh heelsbeatingfistfightmachine guncar accidentblondeshot in the headslow motion scenecameragunfightbrawlbased on comicshowdownbeerhand to hand combatsunglassesbedcar crashdead bodyinterrogationbritishcolor in titlerevolverfightingtelephonekung fushot in the backspybisexualsurvivalbraassassinbased on comic bookambushstrangulationmassacrewomanmontagebridgeimpalementmixed martial artsnonlinear timelineexploding carman with glassesradiodisarming someonehit by a cardouble crossbathunderwater scenevanshot in the legdrowningbartenderlatex gloveson the rungunshotflash forwardattempted murderone against manystalkerhotel roombinocularsbeaten to deathdangerprologuekarateprotestattackpay phoneumbrellamissionundercoverproduct placementrace against timecover upkicked in the facetough girlopening action scenelong takemanipulationscarwigstalkingneck breakingpremarital sexprofanityhandgunsecret agentsilencerlove interestespionageciasubtitled scenekillingarsonstylized violencehenchmanberlin germanyriotcold waritalianiceropetraitorbullethead buttassassination attemptelectronic music scorewoundheavy rainscene during opening creditstold in flashbackbeardmorguecaucasianmovie theatereccentricwristwatchphone boothjumping from heightcovered in bloodbuttskateboardfollowing someoneaction heroinefemale warriorpassportthugstealing a carblood on facefight to the deathintrigueresistancehit in the crotchmercilessnessshot in the faceevacuationescape attemptstabbed in the headblack bracigarette lightertime lapse photographypunched in the chestassault rifleaerial shotblack eyeknife fightblood on shirtundercover agentknife throwinggasolinepolice raiddressing roombruisewilhelm screamswearingstick fightroundhouse kickfast motion scenevodkafemale assassinenglishman abroadbisexual womanblood on camera lenscia agentporn magazinehistorical fictionalleyfinal showdownset uppistol whipscene before opening creditssuit and tieblonde womanarms dealerwatchfemale spybearded manshot in the eyefilm starts with textcigarettebased on graphic novelstrong languageman kills a womangun violencekgbmacguffinraveski maskwoman kills a manaudio cassettejudocar set on fireshot in the throatmetal detectortwo way mirrorgraphic violencelighting a cigaretteoverturning carberlin wallrogue agentstabbed in the facespy herowoman fights a manmagnifying glassbloody violencedeath by drowningfrenchmanpool of bloodstrangled to deathsecret policeone woman armyimprovised weaponcar rolloverfreedom fighterresistance fighterabandoned warehouserookieanti heroineassassination plotbreaking a bottle over someone's headdouble agentknocked out with a gun buttwalkmanwiretappingbilingualismhidden gunslow motion action scenecassette tapeenglishwoman abroadwoman punches a mangarrotecrushed by a carman fights a womanbrass knucklesblond hairdefectorman punches a womanbatonblood on handsborder guardfrenchwomanbritish secret serviceaudio recordingbritish intelligencewearing a sound wireneonlistcode nameneon lightmicrofilmfake passportstasiforgerc wordstolen police carsmoking a cigarettesex on bedknife in chestrussian spymi6stabman with a ponytailghetto blastercar falls into waterdrownedtough womancivil unrestdrownlighting a cigarette for a womaneast berlinkgb agentice bathphotographic memorytrapped underwaterphoto labwearing a wirewatchmakerhand in pantieswest berlincounter espionageeurospylesbian sex scenetelevision news reportcar falling into waterreference to david hasselhoffgarrotteoni presssubmerged in car (See All)

Saw IV (2007) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Saw IV (2007)

Jigsaw and his apprentice Amanda are dead. Now, upon the news of Detective Kerry's murder, two seasoned FBI profilers, Agent Strahm and Agent Perez, arrive in the terrified community to assist the veteran Detective Hoffman in sifting through Jigsaw's latest grisly remains and piecing together the pu …zzle. However, when SWAT Commander Rigg is abducted and thrust into a game, the last officer untouched by Jigsaw has but ninety minutes to overcome a series of demented traps and save an old friend or face the deadly consequences. (Read More)

Subgenre:
survival horrorpolice procedural
Themes:
investigationmurderrevengedeathkidnappingrapepregnancytorturebrutalityobsessiondepressionsadismmadness
Mood:
gore
Locations:
police stationhospitalschoolhotelmotelabandoned factory
Characters:
self mutilationserial killerhusband wife relationshippoliceprostitutepolice officerdetectivehostagelawyerpolice detectivepolice shootoutpimpengineercoroner
Story:
threatened with a knifeintestinesdead woman with eyes openstabbed in the legdisembowelmentstabbed in the throatcrime scenefourth partsociopathrevelationelectrocutionpolice officer killedtied to a chairstabbed in the cheststabbed to death …throat slittingbound and gaggedf wordheld at gunpointrescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingknifenumber in titlesequelviolencebloodmale nudityflashbackmale frontal nudityfightphotographshootoutbeatingfistfightmachine gunshot in the headshotgunbrawldead bodyinterrogationrevolvercriminalaxemassacreimpalementsuicide attemptnonlinear timelinechild abusesevered headdrug addictbeaten to deathkeyfbirace against timemissing personkicked in the facetrapsevered armdismembermentkillingcorrupt copcomafbi agenthammerloss of wifevideotapeswat teamsevered handrapistcrushed to deathpresumed deadfight to the deathgash in the facegunshot woundmutebroken glassjunkieexploding headthrown through a windowautopsybooby trapaccidental killingone dayeye gougingdisfigurementstabbed in the eyeabusive fathersevered leglasersightpunchabusive husbandbloodbathmiscarriagemoral dilemmaphysical abusegothbarbed wirereturning character killed offshot in the neckclinicmind gamescalpelpolice interrogationglasswrist slittingdripping bloodcrushed headsawhanged manbleeding to deathshot through the mouthtwo way mirrorrighteous rageslaughterhousecut into pieceshit with a hammerblack copex wifecaptivityserial rapistfire alarmhooded figuretortured to deathevil dollmausoleumpregnant woman murderedhotel managerwriting on a wallbodily dismembermentscalpinggame of deathviolent sexexposed braindeath trapstomachpig maskmouth sewn shutseedy moteleyes sewn shutfamous themefbi profilerloss of babymeat processing factory (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Underworld: Awakening (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Underworld: Awakening (2012)

Mankind discover the existence of the Vampire and Lycan species and they begin a war to annihilate the races. When Selene meets with Michael in the harbor, they are hit by a grenade and Selene passes out. Twelve years later, Selene awakes from a cryogenic sleep in the Antigen laboratory and meets th …e Vampire David. She learns that she had been the subject of the scientist Dr. Jacob Lane and the Vampire and Lycan species have been practically eradicated from Earth. But Selene is still connected to Michael and has visions that she believes that belongs to Michael's sight. However she has a surprise and finds that she has a powerful daughter named Eve that has been raised in the laboratory. Now Selene and David have to protect Eve against the Lycans that intend to use her to inoculate their species against silver. (Read More)

Subgenre:
conspiracymartial artsdystopiafish out of watercyberpunkdark fantasy
Themes:
home invasionsurveillanceinvestigationescapemurderrevengedeathkidnappingmonstersupernatural powerpolice brutality
Mood:
goredarknesspoetic justice
Locations:
police stationelevatorhelicopterrooftopsewer
Characters:
self mutilationfemale protagonistpolicefather son relationshipmother daughter relationshipdoctordetectivehostagevampirewarriorlittle girlsecurity guardpolice detectivedaughter
Period:
2010sfuture
Story:
stabbed in the shoulderstabbed in the armbody landing on a carstabbed in the legstabbed in the throatparking garagekicked in the stomachfourth partsecurity cameracharacter repeating someone else's dialoguestabbed in the backshot in the foreheadnews reportno opening creditsstabbed in the chest …stabbed to deaththroat slittingflashlightheld at gunpointfalling from heightpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifesequelviolencebloodtwo word titlebare chested malephotographexplosionfireshootoutbeatingfistfightmachine guncar accidentshot in the headshotgunbattleswordgunfightbrawlshowdownhand to hand combatbombcar crashhandcuffsrevolvercombatkung fuscientistshot in the backsubjective cameradecapitationgood versus evilsurvivalstrangulationaxemassacreimpalementcolon in titlemixed martial artssevered headanti herochild in perilhit by a carfictional warunderwater scenecreaturesearchshot in the legtransformationone against manybeaten to deathlocker roomattackcharacter's point of view camera shotcover upkicked in the facetough girlshot in the shoulderinjectionexploding bodyneck breakingmercenarysevered armshot in the armhenchmanexperimentwerewolfhand grenadekilling an animalhypodermic needlegothicgiantjumping from heightaction heroineanimal attackgun fucrushed to deathsocial commentaryback from the deadfemale warriorstealing a carexplosivewhippartner3 dimensionalresurrectionshot in the facestabbed in the head3dpunched in the chestjumping through a windowthrown through a windowknife throwingstabbed in the eyemutationflamethrowertelepathytorso cut in halfdesert eaglesuper strengthshot in the eyescalpelgenetic engineeringdamman kills a womanscene of the crimebitten in the neckepilogueshot in the throatopen endedcurestabbed in the facewoman fights a manheart ripped outone woman armyfemale gunfighterelevator shaftanti heroineregenerationcryogenicswoman's neck brokenmegacorporationstabbed in the mouththroat rippingantidotewoman kills mansuper speeddocksdark heroineserumbitten on the armhybridstabbed in the heartfalling through a windowwoman murders a manhole in chestknife in chestpvcfalling into a riverflash grenadewoman fights manchild vampireunderwater explosionelevator crashlatex catsuiturban gothicvampire versus werewolfopening creditscut headback to lifesexy suitdropped from heightyear 2024 (See All)

Resident Evil: The Final Chapter (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Resident Evil: The Final Chapter (2016)

Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)

Subgenre:
conspiracymartial artspost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsepost apocalypticcorporate conspiracy
Themes:
surveillancedeceptionescapebetrayalrevengemurderdeathkidnappingfearmonsterangerbrutalityparanoiaredemptioninsanity …illnesshopepanicself sacrificeartificial intelligence (See All)
Mood:
gore
Locations:
motorcyclewheelchairrooftoplaboratorytunnelsewerhumveecable car
Characters:
female protagonistfather daughter relationshipboyfriend girlfriend relationshipdoctorzombiesoldierhostagesecurity guardbibleprofessorengineer
Period:
zip lineseeing the future
Story:
sole black character dies clichethreatened with a knifestabbed in the footstabbed in the armbody landing on a carstabbed in the legstabbed in the throatstrong female leadkicked in the stomachwalkie talkiesecurity camerasociopathrevelationknocked outfired from the job …electrocutionstabbed in the backshot in the foreheadno opening creditsstabbed in the cheststabbed to deaththroat slittingflashlightheld at gunpointfalling from heightpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifeviolencebloodsequelflashbackdogfightexplosionfirevoice over narrationshootoutbeatingfistfightmachine guncar accidentshot in the headslow motion scenewritten by directorbattleswordgunfightbrawlshowdownhand to hand combatsunglassesbombrunningcar crashinterrogationcombatkung fuscientistshot in the backsubjective cameradecapitationgood versus evilsurvivalambushstrangulationmassacrearmyimpalementmixed martial artsexploding carsevered headdisarming someonefictional wardouble crossunderwater scenecreaturevoice overshot in the legnecklaceone against manybinocularsbeaten to deathdangerprologuelocker roomperson on firecharacter's point of view camera shotmissionactor playing multiple rolesrace against timecover upevil mankicked in the facetough girltankopening action sceneshot in the shoulderscarexploding bodymercenarywaterfallsevered armshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanak 47missileropetraitoruzihand grenadesabotagefireplacedestructionburned alivehead buttelectronic music scoreheroinehypodermic needlemachetediseaseviruscrucifixmad scientistwristwatchdesperationjumping from heightsevered handlasergenociderocket launchertorchend of the worldaction heroineanimal attackmexican standoffwhite housegun fusocial commentaryeaten alivefemale warriorcyborgmechanicstealing a carsevered fingerfight to the deathresistancedual wieldhatredbased on video gamehit in the crotchmercilessnesspower outagechaosshot in the facebroken glassevacuationcigarette lighterpunched in the chestairplane crashinfectionbooby trapaerial shothologramknife throwingraised middle fingergasolinestabbed in the eyesevered legburned to deathsirenclonegatling gunfast motion scenebullet timerockettorso cut in halfenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownreturning character killed offfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantcommanderflarehanging upside downhelicopter crashsawed off shotgungenetic engineeringfemale herobitten in the neckwoman kills a manfight the systemfinal battleshot through the mouthshot in the footcountdownopen endedcurejumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killingsevered footanti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gundeoxyribonucleic acidmegacorporationantidotecorporate crimedetonatornail gunchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All)

Near Dark (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Near Dark (1987)

A mid-western farm boy reluctantly becomes a member of the undead when a girl he meets turns out to be part of a band of southern vampires who roam the highways in stolen cars. Part of his initiation includes a bloody assault on a hick bar.

Subgenre:
suspenseblack comedycult filmindependent filmcoming of age
Themes:
murder of a police officerpsychopathdeceptioninvestigationescapedrunkennessbetrayalrevengemurderdeathfriendshipkidnappingfearsupernatural powerredemption …insanitysadismunrequited lovehomelessnessnear death experienceregret (See All)
Mood:
goreneo noircar chasenightambiguous ending
Locations:
police stationsmall townbarbusfarmpolice cartruckmotelgas stationtexasroad moviebus stationshedcar fire
Characters:
shooting a police officersheriffteenagerpolicefamily relationshipsfather son relationshipfather daughter relationshiptattoobrother sister relationshippolice officerhostagethiefvampirewaitresspolice shootout …single fathertruck driver (See All)
Period:
1980s
Story:
threatened with a knifefoot chasedeputypunched in the stomachstabbed in the throatbarnsociopathpolice officer killedshot in the foreheadfemme fatalestabbed in the cheststabbed to deaththroat slittingflashlightf word …held at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifeviolencebloodf rateddogbare chested malegunkissfightcigarette smokingexplosionfireshootouttitle directed by femalebeatingfistfightmachine gunhorsecar accidentface slapshot in the headshotgunslow motion scenewatching tvgunfightbrawlvomitingshowdownriflebeersunglassesrunningrevolvercriminalshot in the backgood versus evilgangstrangulationmassacredinerexploding cardisarming someonechild in perilhit by a cardouble crossvancigar smokingshot in the legtransformationbartenderon the runattempted murderscreaminglocker roomperson on firecowboypay phonefugitiveon the roadproduct placementrace against timemissing persondeath of childfarmermanipulationscaramerican flagexploding bodyhorse ridingneck breakingdirectorial debutcowarsonfreeze framesingle parentpickup truckmachismoropecard gamebulletburned alivepokerelectronic music scoremass murdergothicshot in the stomachscene during opening creditscowboy hatcountry musicphone boothstrangerhitchhikerhitchhikingbar fightfull moonthugredneckgypsyreverse footagestealing a carstarhit in the crotchmercilessnesspool tablelove at first sightimmortalitypunched in the chestsunjumping through a windowoutlawblood on shirthealingdisfigurementknife throwingsiegepolice raidduct tapefemale directorburned to deathmoral dilemmaflat tiresouthern accentshot through a windowdriftermolotov cocktailveterinarianspit in the faceteenage lovehuman monsterpolice officer shot in the chestsuper strengthjukeboxquick drawstandofftrailer homedouble barreled shotgunburnt facehit by a truckexploding trucksawed off shotgunone linerwrist slittingbitten in the neckunderage smokingburnt bodykiller childstar crossed loversbadgecuremysterious womankansasrecreational vehiclevending machineshot through a doorgang leaderspray paintmass murdereroklahomainnocent person killednomadcamperchild swearingchild with a gunstabbed in the mouthlassoblood drinkingcowboy shirtmosquitobandaged handinvulnerabilityblood transfusionbalisongjumping from a carmobile homesunlightwhite horsefreight trainchild uses gunscarred facestar spangled bannerspit takestate troopercrisis of conscienceskull crushinginitiation riteamerican midwestdoomed lovebloodlustsee you in helloil wellcivil war veterantumbleweedwinnebagoblood suckingchild vampireface burntooth knocked outreflection in car mirrorconfederate soldierbutterfly knifecar showroomsleeping in a bathtubdriving through a wallsearch for sontinfoilbullet catchingslashed tiretrain trackrooster crowingspurhit with a flashlightslit wristjumping from a truckchild burningjesse jamesroaming (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Fugitive (1993) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fugitive (1993)

A well respected Chicago surgeon Dr. Richard Kimble has found out that his wife, Helen, has been murdered ferociously in her own home. The police found Kimble and accused him of the murder. Then, Kimble (without Justifiable Reason) was tried, convicted, and sentenced to death. However, on the way to … prison, Kimble's transport crashed. Kimble escapes and is now on the run. Deputy Samuel Gerard from Chicago takes charge of the chase of Kimble. Meanwhile, Kimble takes up his own investigation to find who really killed his wife, and to lure Gerard and his team into it as well. (Read More)

Subgenre:
conspiracysuspensemartial artsmedical
Themes:
murder of a police officergreedhome invasionsurveillancepsychopathdeceptioninvestigationescapedrunkennessbetrayaldeathmurderinfidelitymoneyhero …robberycorruptionparanoiadrug useguiltabductiondeath of wifeprison escapeescape from prison (See All)
Mood:
raincar chasenight
Locations:
police stationelevatorsmall townhospitaltrainforesthotelhelicoptersnowbuspolice carlakerooftopchicago illinoisusa …tunnelsewerbus accidentprison buspolice helicoptertrain explosion (See All)
Characters:
sheriffserial killerhusband wife relationshippolicedoctornursehostagethieftough guyaction heropolice detectivepsychiatristpolice shooting
Period:
1990swinter
Story:
threatened with a knifefoot chasered herringclimbing through a windowpunched in the stomachpress conferencekicked in the stomachwalkie talkiefalling down stairssuspicionpolice officer killedambulancedisguiseheld at gunpointfalling from height …punched in the faceshot in the chestblood splattershot to deathcorpsepistolsurprise endingchasebloodflashbackbare chested malefightcigarette smokingphotographtitle spoken by characterexplosionfireshootoutbeatingdreamfistfightremakeshotgunslow motion scenecomputerarrestgunfightbrawlshowdownjailhandcuffsrevolvershot in the backnewspaperassassindrug dealerbridgeweaponsubwayfalse accusationjudgedisarming someonedouble crossvancigar smokingon the runattempted murderhotel roombased on tv seriesbeaten to deathpay phonefugitiveundercovermistaken identityrace against timecover upringcourtscarspeechinjectionautomobilebasementsemiautomatic pistolex convictcorrupt copstreetbeer drinkingtape recorderloss of loved oneblockbusterjumping from heightparadecompassionmechanicjanitorprison guardhit in the crotchmanhuntheadphonesmedicationblack and white sceneawardblood on shirtconvicttough copsnowingpolice raidsurgeonreckless drivingframed for murdernews reporterbriberyhit and runlaundryneedletasersubway stationtelephone boothcomputer crackerglockx rayescaped convictknocked unconscioushead bashed instakeoutdeath rowdamdruggedscene of the crimeconventiondeath penaltymarching bandwrongful convictionwalkingseizuremicroscopecop killerillinoisbased on tv showmugshothitchcockianoverhead camera shotgarbage truckneck braceknocked out with a gun buttmiscarriage of justicelogballroomhostage situationfederal agentsittinghit by a trainfalling off a rooffoot pursuithit with a chairel trainhostilityu.s. marshalprosthetic limbrailroad crossingphoto boothblockadereceptionfake idskylinetrain crashpharmaceutical companysearchlightexploding busone armed manplanting evidencesentenced to deathwet jeanshandcuffed to a pipepolice departmentreference to peter pancontrol roomescapeechain link fencepolice escortescape from custodysound recordingoffice workstorm drainpanhandlingbulletproof glassprosthetic armhiding in a bathroomprosthetic body parthit with a metal pipefalling through a rooftop windowflip bookst. patrick's dayarm amputationfalling through a glass rooforganismrunning into a treetracing a telephone callcorrupt lawyerfalling down a shaftprosthesisapplication formbeneficiaryknocked down stairsmaking a scenehusband suspected of murdering his wiferenting a roomsanitationsound recorderradiologycomputer databaseemergency brakex ray imageelevated trainhiding in plain sighthusband suspected of killing his wifekicking in a windowlistening to a tape recordingorange peelchicago skylinecrash victimpicture of suspect (See All)

Total Recall (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Total Recall (2012)

For a factory worker named Douglas Quaid, even though he's got a beautiful wife who he loves, the mind-trip sounds like the perfect vacation from his frustrating life - real memories of life as a super-spy might be just what he needs. But when the procedure goes horribly wrong, Quaid becomes a hunte …d man as he finds himself on the run from the police. (Read More)

Subgenre:
post apocalypsedystopiacyberpunk
Themes:
murder of a police officersurveillancedeceptionescapedrunkennessbetrayaldeathmurdertortureamnesiaartificial intelligence
Mood:
rainnightmarecar chase
Locations:
elevatorbarhotelhelicopterapartmenttrain explosion
Characters:
self mutilationhusband wife relationshippoliceprostitutetough guyaction herosecurity guardpolice shootoutpolice chaseex soldier
Period:
future
Story:
villain not really dead clichefoot chasestabbed in the handmedia coveragelens flarestrong female leadstabbed in the stomachstrong female charactercharacter repeating someone else's dialogueshot in the foreheadnews reportno opening creditstied to a chairambulancedisguise …held at gunpointfalling from heightpunched in the faceshot in the chestshot to deathcell phonepistolsurprise endingknifeviolenceinterviewflashbacktwo word titlebare chested maletitle spoken by characterexplosionshootoutfistfightmachine gunremakeshot in the headslow motion scenebrawlhand to hand combatbombcar crashinterrogationrobotpianoshot in the backspyassassinarmymixed martial artssubwaydream sequenceanti heroone man armydouble crosson the runbased on short storyfactoryfugitivetough girlopening action scenebankshot in the shouldermanipulationscarinjectionexploding bodycharacter says i love yousevered armshot in the armsecret agentstylized violencegrenadecatfightvillainessswat teamphone boothjumping from heightrebellionrailway stationaction heroinegas maskresistancejumping through a windowknife fighthologramundercover agentbulletproof vestlasersightgovernment agentpolitical corruptiongatling gunreference to barack obamatorso cut in halffemale assassindesert eagleabandoned buildingoppressiontaserpiano playingworld dominationmegalomaniacfemale spyfilm starts with textreluctant herofactory workershot in the handfight the systemcorrupt officialresistance fighterelevator shafthusband murders wifedouble agenttotalitarianismkiller robotmegacorporationlassowoman punches a manstun gunremake of american filmbig ben londonzero gravityflying carrepressed memorysafe deposit boxbody armorman punches a womangrand pianofake idfalse memoryremake of cult filmflash grenadesurvivinghit in the throatfalling through a rooftop windowimplanted memorychancellorfuturistic trainbritish colonialismrobot soldierbody scannerpeace symbolreference to ian flemingfacial reconstructionbrain scannerthree breasted womantotal recall (See All)

Oldboy (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Oldboy (2013)

An advertising executive is kidnapped and held hostage for 20 years in solitary confinement. When he is inexplicably released, he embarks on an obsessive mission to discover who orchestrated his punishment, only to find he is still trapped in a web of conspiracy and torment.

Subgenre:
conspiracy
Themes:
home invasionsurveillancedeceptioninvestigationescapedrunkennessdeathrevengemurdersuicidekidnappingrapetortureincestanger …dysfunctional familyexploitationfather daughter incest (See All)
Mood:
gorerainneo noirmurder suicide
Locations:
new york citybarswimming poolmotelchinese restaurantcar bicycle chase
Characters:
father son relationshipfather daughter relationshipdoctortattoonursehostageactresssecurity guardbibleex husband ex wife relationshipyounger version of characterchinese food
Period:
year 2001year 1997year 2000year 1993year 2005year 2013year 2003
Story:
foot chasefilmed killingstabbed in the handstabbed in the legstabbed in the throatrevelationknocked outcharacter repeating someone else's dialoguestabbed in the backnews reporttied to a chairstabbed in the cheststabbed to deaththroat slittingf word …held at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingknifebloodviolencefemale nuditymale nudityflashbackmale rear nuditytwo word titlebare chested malesex scenefemale rear nuditycigarette smokingshowerbeatingfistfighturinationface slapremakeshotgunwatching tvswordbrawllettervomitinghand to hand combatinterrogationhallucinationvoyeurstrangulationmansionmontageinternetanti heroone man armycoffeebartenderracial slurskinny dippingbeaten to deathbased on mangaumbrellarace against timekicked in the faceattempted rapeshot in the shoulderlong takescarlaptopnewspaper headlinestylized violencehenchmaneavesdroppingaddictionmousecrucifixvideotapedesperationpresumed deaddiamondmale masturbationitalian americaniraq warkicked in the crotchescape attemptstabbed in the headpunched in the chestlooking at self in mirrorframed for murderimprisonmenthit with a baseball batvodkafemale assassinvideo surveillancehead blown offwebsitebillionaireretirement homepush upsgreenhousewrist slittingcelloheld captivejockaudio cassettegasshot through the mouthtv studiostabbed in the facepsychological torturehit with a hammerstrangled to deathhusband murders wifedelivery boysolitary confinementbreaking a mirrorstraight razorwoman punching a manhundred dollar billpenthousesnorricamtied to a tablepreparatory schoolfilicideincestuous sexsevered tonguebusiness executiveenglish accentkilled in an elevatoroutnumberedfootball fieldyearbookhenchwomanremake of cult filmmillenniumbellhopwoman wearing a thongbroken anklechinatown manhattan new york citybox cutterplaying celloburning a letterdumplingluxembourgabandoned schoolcctv camerafather son incesthit with a crowbarknockout gaspet mouseworkout videoreference to the count of monte cristodouble barrel shotgunreference to hurricane katrinaremake of korean filmretired teacher (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cursed (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cursed (2005)

Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)

Subgenre:
suspenseblack comedycult filmindependent filmabsurdismcreature featureteen movieteen horrormonster movielgbt horror
Themes:
home invasionescapedrunkennessjealousydeathmurderrevengesurrealismfearmonsterseductionsupernatural powerparanoiawrestlingrivalry
Mood:
high schoolsatirenightmare
Locations:
elevatorbarlos angeles californianightclubpolice carofficemuseumfire truck
Characters:
teenagerpolicehomosexualboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature
Period:
2000s
Story:
foot chasepublicistbody landing on a carstabbed in the throatparking garagekicked in the stomachhigh school studentknocked outelectrocutionshot in the foreheadnews reportstabbed in the cheststabbed to deathambulancefalling from height …punched in the facerescueshot in the chestshot to deathcorpsecell phonepistolsurprise endingchaseknifepartyviolencebloodnuditymale nudityone word titlemale rear nuditydogbare chested malekissfemale rear nudityfightphotographtitle spoken by characterbeatingfistfightcar accidentshot in the headshotgunslow motion sceneswordbrawlbare buttshowdowncar crashdead bodybathroomdecapitationgay slurorphanambushcaliforniamassacredinerinternetsevered headhit by a carcreaturetransformationpublic nuditylimousinecursecoming outattackproduct placementkicked in the faceshot in the shoulderscargymcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzawerewolfactor playing himselfwolflooking at oneself in a mirrorscene during opening creditscatfightcomic bookhollywood californiavillainessnosebleedclubcarnivalanimal attackeaten alivefull moonrampagecameoblood on facepower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hosthuman becoming an animalcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalahowlingwoman hits a mangay jokesilvertroubled productiongay athletelycanthropypalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationlycanthropeburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All)

Criminal (2016) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Criminal (2016)

Bill Pope (Ryan Reynolds) is a CIA agent on a mission in London tracking down a shadowy hacker nicknamed "The Dutchman." When he gets mysteriously ambushed and killed, an experimental procedure is used to transfer his memories into dangerous convict Jericho Stewart (Kevin Costner). When he wakes up  …with the CIA agent's memories, his mission is to find The Dutchman and make the deal with him before the hacker launches ICBM's and starts World War III. But complications soon arise and the mission turns personal. (Read More)

Subgenre:
conspiracysuspenseblack comedyindependent filmfish out of water
Themes:
home invasionsurveillancepsychopathdeceptioninvestigationescapebetrayalrevengemurderdeathkidnappingmoneyprisonfeartorture …weddingmemoryrobberydeath of fatherbrutalityterrorismparanoiaredemptionpanicunlikely hero (See All)
Mood:
rainneo noircar chase
Locations:
beachrestaurantchurchhelicoptermotorcycleairplanebuslondon englandtaxiairportpolice cartaxi driverlaboratorysubmarinecar explosion …suvfire truckfishing boatabandoned factorycar firehumveecar in waternuclear submarinecar into water (See All)
Characters:
husband wife relationshippolicefather daughter relationshipmother daughter relationshipdoctorteachersoldierhostagetough guywarrioraction herosecurity guardprofessorsniperrussian …germanamerican abroadsniper riflepolice chaseamerican in the ukself destruct (See All)
Period:
2010s
Story:
foot chasedeath threatstabbed in the throatduct tape over mouthfemale killerkicked in the stomachwalkie talkiesecurity camerasociopathknocked outelectrocutionpolice officer killedshot in the foreheadnews reportno opening credits …tied to a chairstabbed in the cheststabbed to deathambulancebound and gaggedf wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifeviolencebloodone word titleflashbackbare chested malefightcigarette smokingphotographtitle spoken by characterexplosionshowerfireshootoutbeatingfistfightmachine guncar accidentshot in the headshotgunarrestgunfightbrawlshowdownsunglassescar crashinterrogationcafepianohandcuffscriminalshot in the backsubjective cameraspyterroriststrangulationaxebridgeimpalementwidowprisonersubwaynonlinear timelineexploding caranti herodisarming someoneone man armychild in perildouble crossunderwater scenevanshot in the legon the runattempted murderone against manylibrarybeaten to deathdangerkeyfugitivecharacter's point of view camera shotmissionundercoverproduct placementmistaken identityrace against timeopening action scenestreet shootoutshot in the shoulderscarbodyguardinjectiondeath of husbandlaptoploss of fatherratmercenarysemiautomatic pistolsecret agentobscene finger gestureespionageciasubtitled scenearsoneavesdroppingmissilesabotageburned aliveassassination attemptelectronic music scorehypodermic needlelooking at oneself in a mirrortold in flashbacktied to a bedbeardswat teamwristwatchschizophreniacrushed to deathpassportthugcameoprison guardnicknamestealing a carburglarymanhuntmercilessnessspecial forcespunched in the chestassault rifleaerial shotcommandoundercover agentconvictraised middle fingergasolineduct tapeloss of husbandrelease from prisonterrorist plotgovernment agentplaying pianomoral dilemmashot multiple timestracking devicefemale assassinsatellitetext messagingshot through a windowcia agentbag of moneygardeningpickpockettaserstuffed animalpistol whipsubway stationarmored carcomputer crackermegalomaniacfemale spycommando unitpharmacycomputer hackerhit by a truckgun actionembassydeath rowhead injuryman kills a womanmacguffinwoman kills a mansubmachine gunbullet woundbleeding to deathgurneyanarchistcar set on firepawnshoptwo way mirrorcommando raidoverturning carrepeated lineairfieldtied up while barefootprivate jetcockney accentimprovised weaponcar rolloverceoexploding airplaneprison wardenabandoned warehousesolitary confinementnuclear weaponsbilingualisminnocent person killedx rayed skeletonthrown from a carnuclear threattortured to deathspaniardbig ben londonbrain surgerybritish actor playing american characterex special forcesfire fightcareer criminalchange of heartflash drivewest virginiatranquilizer dartcomputer programmermultiple personality disorderthrown through a windshielduh 1 huey helicoptergoateepiano lessonhenchwomanimplanthit with a car doorcode namepack of moneyair force basemaximum security prisonlondon undergroundbrain scanuh 60 blackhawk helicopterlondon eyecattle prodescape from custodyneurosurgeonaxe throwingplane shot downreference to george orwellshackledimplanted memorytelevision interviewexperimental technologyintelligence officerhelmet camerauniversity campusdelawareball peen hammerbrain implantcar off bridgedeath row inmateeurocopter as355 twin squirrelhairbrushcyber terroristcyberterrorismcell phone tracesilent alarmstealing a motorcycledefense system (See All)

Prisoners (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Prisoners (2013)

How far would you go to protect your family? Keller Dover is facing every parent's worst nightmare. His six-year-old daughter, Anna, is missing, together with her young friend, Joy, and as minutes turn to hours, panic sets in. The only lead is a dilapidated RV that had earlier been parked on their s …treet. Heading the investigation, Detective Loki arrests its driver, Alex Jones, but a lack of evidence forces his release. As the police pursue multiple leads and pressure mounts, knowing his child's life is at stake the frantic Dover decides he has no choice but to take matters into his own hands. But just how far will this desperate father go to protect his family? (Read More)

Subgenre:
suspense
Themes:
home invasioninvestigationrevengesuicidekidnappingchristmastortureangerbrutalityparanoiaabductionhuntingpolice investigationmissing child
Mood:
rainneo noirambiguous ending
Locations:
police stationhospitalforestsnowwoodsgas stationpennsylvania
Characters:
husband wife relationshippoliceteenagerfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother sister relationshipdetectivepriesthostagepolice detectivepolice chase …suicide by copsuicide by shooting one's self in the head (See All)
Period:
2010s
Story:
foot chasered herringmedia coverageduct tape over mouthcrime scenepress conferencesociopathrevelationvigilantecharacter repeating someone else's dialoguenews reportno opening creditstied to a chairambulancebound and gagged …flashlightf wordheld at gunpointpunched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseviolencebloodone word titleflashbackdogphotographshootoutbeatingcar accidentshot in the headarrestvomitingriflecar crashinterrogationhandcuffsrevolveralcoholdinersnakedream sequencedrawingshot in the legrace against timemissing personmanipulationstalkingshot in the armnewspaper headlinepickup truckkilling an animalbreaking and enteringhypodermic needleheavy rainhammerdesperationinterracial friendshipapartment buildingbible quotetitle at the enddeerintrudermannequinthanksgivingdrugged drinkabandoned buildingbag over headgun in mouthmazemental retardationwhistleanimal crueltydepartment storeanimal abusepolice captainvigilante justiceworkshopwhistlingheld captivetrumpetshot through the mouthtwo way mirrorcarpenterfamily manfemale criminalrecreational vehiclememorialman childreference to batmanchild abductionpitmissing daughtermissing girlhamsterpower drillgun held to one's headlord's prayersex offenderstar spangled bannersockinterrogation roommotor homespeeding vehiclereference to bruce springsteenprime suspectcharacter appears in newspaperquestioned by policeradiatorvigilcandlelight vigilchristian manwoman shoots a manmale torturing malesearch for missing personone week time spanfather searches for missing daughterunlawful confinementlyesearching for a missing girlact of desperation (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Strangers (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Strangers (2008)

After returning from a wedding reception, a couple staying in an isolated vacation house receive a knock on the door in the mid-hours of the night. What ensues is a violent invasion by three strangers, their faces hidden behind masks. The couple find themselves in a violent struggle, in which they g …o beyond what either of them thought capable in order to survive. (Read More)

Subgenre:
suspenseindependent filmsurvival horror
Themes:
home invasionpsychopathmurderfeartortureparanoiapanic
Mood:
slasherone night
Locations:
rural settingkitchenshedcar fire
Characters:
serial killerboyfriend girlfriend relationshipterror
Period:
year 2005
Story:
foot chaseunmaskingbreaking through a doortauntinghiding in a closetmasked killerfemale killerstabbed in the stomachbarnknocked outno opening creditstied to a chairstabbed in the cheststabbed to deathdeath of friend …disguiseflashlightblood splattershot to deathcorpsecell phonesurprise endingknifeviolencebloodflashbackcigarette smokingdancingbeatingshot in the headshotgunwritten by directorcar crashpianoalcoholbedroomcandleaxenonlinear timelinemarriage proposalchampagneevil manstalkingthreatisolationrecord playerpickup truckfireplaceice creamvandalismcovered in bloodstrangermasked manpump action shotgunconfrontationblood on shirtswingintruderwedding receptionflat tireengagement ringmormonwoman in bathtubinterrupted sexharassmentbag over headvery little dialoguehomicidal maniaccottagemind gamebubble bathfilm starts with textcabin in the woodsscene of the crimebleeding to deathcountry housemasked villainknife murderpsychological torturebutcher knifecut handcat and mousestarts with narrationnightgownwriting in bloodred lightham radiocrawlingbroken windshieldmasked woman911 callwind chimecandlelight dinnershower curtaintwisted ankleloading a gunheld at knifepointsmoke alarmrose petalmasked intruderassembling gunsack maskflannel (See All)

Child's Play (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play (1988)

When Charles Lee Ray needs to get quick escape from cop Mike Norris, he takes his soul and buries it into playful, seemingly good guy doll Chucky. Little does he know a little boy by the name of Andy Barclay will be the new owner of him soon-to-come. Charles confides in Andy while he commits numerou …s murders. Once the adults accept Andy's story as truth, it's too late. (Read More)

Subgenre:
cult filmindependent filmpsycho thrillerstop motion animationslasher flick
Themes:
psychopathescaperevengemurdersupernatural power
Mood:
slasher
Locations:
police stationelevatorcarapartmentchicago illinois
Characters:
serial killermother son relationshipboypolice detectivehomeless manwitch doctor
Period:
1980swinter
Story:
villain not really dead clichesole black character dies clichefoot chasebreaking through a doortauntinghiding under a bedwhodunithiding in a closetstabbed in the handbody landing on a carstabbed in the legtensionknocked outelectrocutionstabbed in the chest …death of friendfalling from heightblood splattershot to deathcorpsepistolknifebloodcigarette smokingpunctuation in titleshootouturinationbirthdayapostrophe in titlecar crashshot in the backsubjective cameradecapitationwidowsubwayfalse accusationsevered headchild in perilshot in the legperson on firefirst of seriescharacter's point of view camera shotpossessiondolllightningattempted rapeshot in the shoulderfirst partsevered armdismembermentfreeze framemaniactv newsburned aliveelectronic music scoregothicbabysitterlifting someone into the airtoyback from the deadbroken legreverse footagechild's point of viewdark humorfalling to deathmental hospitalthrown through a windowsevered legvoodooblack magicgunfireframed for murderplanthit with a baseball batpresenthead blown offhuman monsterdepartment storescalpelelectric shockpolice interrogationbitten in the neckbumburnt bodyexploding househit with a hammerfootprintjewelry storemuraltrail of bloodbandaged handevil dolltoy storebitten on the armremadevoodoo dollchantfalling through a windowbreakfast in bedskipping schoolevil laugharm blown offnude paintingmatcheskiller dollfloursoul transferencegingershot in the hearttwo killersdisbelieving adultleg blown offanimatronicattempted strangulationclaw hammerskid rowpeddlerelectroconvulsive therapyhead spinlightning stormmurder disguised as accidenttalking dollcartoon on televisionfalling on a carstalking victimjammed guncar cigarette lighterchild psychiatristelectric batterydisbelieving authoritiesfalling down a chimneyloss of aunt (See All)

House On Haunted Hill (1999) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

House On Haunted Hill (1999)

When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their … courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)

Subgenre:
conspiracyblack comedysupernaturalsurvival horror
Themes:
surveillancedeceptionescapedrunkennessbetrayalrevengemurderdeathsurrealismmarriagemoneyghostdrinkingfearseduction …supernatural powerparanoiainsanityunemploymentcourageself sacrificenear death experience (See All)
Mood:
goreone nighthorror movie remake
Locations:
elevatorbarlos angeles californiabathtubwheelchaircave
Characters:
husband wife relationshipafrican americandoctornursesecurity guardalcoholic
Period:
1990s1930s
Story:
bullet proof veststupid victimcamcorderstabbed in the handstabbed in the necksecurity camerasuspicionknocked outelectrocutionfemme fatalestabbed in the cheststabbed to deathflashlightf wordheld at gunpoint …punched in the facerescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifepartybloodfemale nudityfightphotographtitle spoken by characterfirefistfightremakewatching tvcomputerdrinkbrawlsunglassesbirthdaydemonhallucinationsubjective cameradecapitationsurvivaljournalistambushaxeimpalementfalse accusationsevered headdouble crossbirthday partycreatureracial slurflash forwardattempted murderprologuescreamingcharacter's point of view camera shotskeletonbasementhauntinghaunted houseriotsurgeryfireplacegothiceccentriccovered in bloodstrangerskullfaked deathpresumed deadmental institutioncameobraveryguestimpostorbroken glassmental hospitalescape attemptblack and white sceneframe upscene after end creditsbooby trapatticblood on shirtone daybulletproof vestfemale reportersevered legethnic slurcellarsurgeongeekframed for murdersurprise after end creditsgothfake identityevil spiritabandoned houseroller coastertv reporterbillionairecameramaninsane asylumbubble bathscalpeloffscreen killingpsychiatric hospitalcut into piecestheme parkhuman experimentinvitationelectric chairpencilhillclimbing out a windowmad doctorpoltergeistcheckgold diggersurgical operationtrophy wifedecomposing bodytorture chamberancestorfragments of glassrich snobdeus ex machinaabandoned hospitalrotting corpseshape shiftingparty invitationdescendantstabbed with a pencilcriminally insanemulti millionairescheming wifereference to jim jonesstrapped to a bedhaunted hospitalpractical jokerex baseball playermovie studio executivestabbed through the necksurgery without anesthetic (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Saw: The Final Chapter (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Saw: The Final Chapter (2010)

Detective Matt Gibson chases the psychotic Detective Mark Hoffman while Jigsaw's widow Jill Tuck tries to kill him as assigned by her husband. However he escapes and Jill meets Gibson and offers to sign an affidavit listing the murders committed by Hoffman. In return, she requests protection. Meanwh …ile, the prominent Jigsaw survivor and leader of a support group Bobby Dagen is abducted with his wife and friends and forced to play a mortal game to save himself and his beloved wife. (Read More)

Themes:
deceptionrevengedeathkidnappingfeartorturedeath of wifepolice brutalitypolice investigationpolice corruptionrevenge murder
Mood:
gore
Locations:
police stationbar
Characters:
self mutilationhusband wife relationshipboyfriend girlfriend relationshipdoctorpolice officerlawyerlove triangleinterracial relationshippolice detectivecoroner
Period:
2010s
Story:
book signingpublicistintestinescharacters killed one by onedisembowelmentstabbed in the neckstabbed in the throatkicked in the stomachknocked outcharacter repeating someone else's dialogueelectrocutionpolice officer killednews reporttied to a chairstabbed to death …numbered sequelheld at gunpointfalling from heightmaskshot in the chestblood splattershot to deathdigit in titlecorpsecell phonepistolsurprise endingknifenumber in titleviolencesequelbloodinterviewflashbackbare chested maleexplosionmachine gunshotgunslow motion scenebombshot in the backcleavageimpalementdream sequencehit by a carconfessiondrug addictkeydollmanipulationneck breakingcharacter says i love yousevered armcorrupt copburned alivemass murdercagesurvivorvideotapefraudswat teamcovered in bloodcrushed to deathredneckwoman in jeopardy3 dimensionalgash in the facejunkiepolice officer shotthrown through a windowbooby trapblood on shirte mailracisteye gougingstabbed in the eyecanebody countburned to deathlyingtorso cut in halfshot through a windowreturning character killed offjunkyardblindfoldedpolice officer shot in the chestskinheadx raygroup therapyfemale lawyershot in the eyeheld captivemale protagonistsawaudio cassettebody baghanged manextreme violencefemale police officercut into piecessupport grouptape3d in titlemass murderersevered footgrindhouse filmpolice officer shot in the headwoman's neck brokensoundseventh partpolicewoman killingarm ripped offtrail of blooddeath by hangingbear trapstabbed in the mouthhidden roomevil dolllawnmower3 dstabbed in the sidetricyclewriting on a wallprosthetic limbcircular sawsafe houseinternal affairslast of seriesthrown through a windshieldabsurd violencegame of deathwhite supremacisthorror iconprosthetic legpublic executioncaught in a lieelectric fencepolice officer stabbedrotting corpsetooth pullingskin rippingkilled by a propellerbolt upright after nightmarepig mask8 trackboyfriend girlfriend conflicteye surgeryhung from a hookjaw ripped offman murders a womantooth extractionbulletproof glassprosthetic armhead crushing3d sequel to 2d filmwriting on mirrortape deckpolice officer neck brokenwriting on a mirroreyes sewn shutlocked in a bathroomskin torn offbuzzsawcauterizationleft to diewoman leading a man onsupergluemale antagonistpolice internal affairsself help gurufish hookkilled with a lawnmowerexposing fraudreference to the fbiexploding warehousestitching one's own woundloose endsplexiglastight blouse (See All)

The Colony (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Colony (2013)

Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.

Subgenre:
suspenseindependent filmmartial artspost apocalypsedystopiacreature featuresurvival horror
Themes:
surveillancedeceptionescapebetrayaldeathmurdersuicidefearnaturebrutalitysadismexecutionpaniccannibalismcourage …self sacrificenear death experiencestarvation (See All)
Mood:
gorenightmaredarknesssavage
Locations:
helicoptersnowwaterfarmtunnel
Characters:
husband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagetough guywarrioraction herointerracial relationshiplittle boysecurity guardengineerex soldier
Period:
futurewinternear future
Story:
sole black character dies clichethreatened with a knifefoot chasebreaking through a doorstabbed in the shoulderlens flarestabbed in the legstabbed in the neckstabbed in the throattensionkicked in the stomachsecurity camerastabbed in the backshot in the foreheadstabbed in the chest …stabbed to deaththroat slittingflashlightf wordheld at gunpointfalling from heightpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifeviolencebloodflashbacktwo word titlegunkissfighttitle spoken by characterexplosionfirevoice over narrationshootoutbeatingdreamfistfightfoodshot in the headshotgunslow motion scenewritten by directorbattlegunfightbrawlshootingshowdownriflehand to hand combatdead bodyhandcuffsrevolvercombatshot in the backdecapitationgood versus evilsurvivalorphanambushaxebridgeimpalementmixed martial artssevered headdream sequenceanti herodisarming someonecreaturesearchshot in the legattempted murderbeaten to deathdangerscreamingkeyfactorymissionrace against timerabbittough girlshot in the shoulderpursuitexploding bodydeath of sonthreatlaptopchickenprofanitydismembermentblood spatterchessiceundergroundhead buttspearmachetesurvivormutantdiseasevirusbeardmagazineexploding buildingladderbald maneaten alivefemale warriorculturereverse footagehaunted by the pastexplosivebraveryfight to the deathcannibalmanhuntmercilessnesspower outagemutehungerbutcherenvironmentalstabbed in the headcigarette lighterenvironmental issuedynamiteinfectionknife fightdark pastaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefinal showdownfemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorbullet woundquarantinetragic pastintergenerational friendshippsychotronic filmcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudsfrozen bodycollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All)

Allegiant (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Allegiant (2016)

After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)

Subgenre:
conspiracysuspensemartial artspost apocalypsedystopiafish out of watercyberpunkfuturisticscience fantasy
Themes:
surveillancedeceptionescapebetrayalloverevengedeathmurdersurrealismkidnappingpoliticsprisonfearmilitarymemory …corruptiondeath of fatherterrorismparanoiaexecutionexploitationhopepanicamnesiacouragetechnologynear death experienceprison escapeutopiaradioactivityfuture warnuclear holocaust (See All)
Mood:
rain
Locations:
elevatortrainforestairplanedesertairportvillagewoodsrooftopcavechicago illinoistunnelairshipwalled cityairplane chase
Characters:
female protagonistteenagerfamily relationshipsmother son relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipteenage girlsoldierhostagelawyertough guywarrioraction herosecurity guard
Period:
futurenear future
Story:
foot chaseclichestabbed in the shoulderstabbed in the neckstabbed in the throatstrong female leadkicked in the stomachsecurity camerafalling down stairsrevelationstrong female charactersuspicionknocked outcharacter repeating someone else's dialogueelectrocution …shot in the foreheadno opening creditsstabbed in the cheststabbed to deaththroat slittingheld at gunpointfalling from heightpunched in the facerescueshot in the chestshot to deathcorpsepistolsurprise endingchaseknifesequelviolencebloodfemale nuditybased on novelone word titlebare chested malefemale rear nudityfighttitle spoken by characterexplosionshowershootoutbeatingfistfightmachine guncar accidentshot in the headslow motion scenebattlearrestundressinggunfightbrawlshowdownhand to hand combatbombhallucinationhandcuffsrevolverfightingcombatscientistshot in the backsubjective cameragood versus evilsurvivalorphanambusharmyimpalementmixed martial artsprisonerexploding cartrialanti herodisarming someoneone man armypart of serieschild in perilfictional wardouble crossthird parton the runtrainingattempted murderone against manypilotbeaten to deathdangerattackfantasy sequencefugitivecharacter's point of view camera shotmissionrace against timetentcover upevil mankicked in the facetough girlmanipulationscarinjectionfemale removes her clothesloss of fatherbrothercharacter says i love youbattlefieldhenchmancivil warexperimenteavesdroppingmissiletraitordestinysabotagehead buttelectronic music scoreheavy rainjail cellvirtual realitylasercgigenocideaction heroinemexican standoffsocial commentarybroken legfemale warriorgas maskreverse footageshieldprison guardtarget practiceexplosivebraverycynicismblood on facechaosgash in the faceescape attemptpunched in the chestassault rifleaerial shotcommandohologrambulletproof vestdisfigurementrescue missionlasersightdictatormoral dilemmalaser gunmemory lossshot through a windowfemale soldierabandoned buildingvideo surveillancebad guyinvisibilityfinal showdownreturning character killed offbrainwashingbag over headbureaucracycafeteriafemale fighterspiral staircasearmored carcomputer crackerdronecomic reliefplane crashwallknocked unconsciousanarchycommando missioncrash landingman kills a womanoffscreen killingvolunteerwoman kills a manaltered version of studio logofight the systemgasexperiment gone wronghigh techpart computer animationcommando raidnuclear waropen endedcamouflageoverturning carroofgeneticsvaultaircraftsubterraneanjailbreakdogfightone woman armytargetchosen onedreadlocksforce fieldanti heroineknocked out with a gun buttsocial decayarmoryteenage heropower struggletotalitarianismwastelandleaving homeloss of memorycityscapedeoxyribonucleic acidleadershipbubbledetonatorbiological weapontyrannyshot through a wallserumblockadeorbpoison gascouncilbased on young adult novelheadsetpulp fictioneugenicsindividualityscience experimentstrong womanpolitical unrestelectromagnetic pulsegrappling hookdeus ex machinasphereexplosive decompressionlovers reunitedelectric fencehovercrafterased memoryescalationclimbing up a wallvideo messagechemical weaponssocial differencestoxintruth serumcalling parent by first namefuturistic cityteenage heroinelawlessnessnerve gasbody suitgenetic experimentationbarcodepower generatorshuttle crafturban warfareagainst the systemabseilingdevastated landscapemock executionkey cardbarcode tattoogas attackgenetic manipulationglass elevatordecontaminationmass surveillanceshow trialwire cuttersprovidencecity stategenetic modificationriver of blooddestroyed buildingallegiance (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Jason X (2001) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason X (2001)

Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks  …the colonists in a whole new environment. (Read More)

Subgenre:
suspenseblack comedyindependent filmmartial artsdark comedyb movieabsurdismfish out of waterteen horror
Themes:
psychopathescapedeathmurderfearmonstermilitarybrutalitysupernatural powerparanoiaself sacrificeartificial intelligencespace travelclaustrophobia
Mood:
slashergoreambiguous ending
Locations:
woodslakeouter spacelaboratoryspace stationresearch stationship explosion
Characters:
teenagerboyfriend girlfriend relationshipdoctorteachersoldiertough guyvillainteacher student relationshipprofessorterrorengineerbabe scientist
Period:
2000s
Story:
villain not really dead clichethreatened with a knifewoman in dangerstupid victimstabbed in the shouldercharacters killed one by onemasked killerkicked in the stomachstabbed in the stomachelectrocutionstabbed in the backstabbed in the cheststabbed to deaththroat slittingflashlight …numbered sequelheld at gunpointfalling from heightmaskpunched in the facerescueshot in the chestblood splattershot to deathcorpsepistolsurprise endingchaseknifenumber in titlesequelbloodviolencefemale nuditycharacter name in titlefemale frontal nudityflashbackbare chested malesex scenekissfightnipplesexplosionfirebeatingfistfightmachine gunface slapshot in the headshotguncomputershowdownriflehand to hand combatrobotkung fuscientistshot in the backdecapitationsurvivalambushstrangulationmassacreimpalementmixed martial artssevered headdisarming someonespaceshipunderwater scenecreatureshot in the legtransformationlatex glovesflash forwardpilotstalkerbeaten to deathdangerprologuekaraterace against timeevil mankicked in the facetough girlinjectionstalkingexploding bodyneck breakingmercenarysevered armlove interestkissing while having sexdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatmutilationroman numeral in titlespacecraftsergeantexploding buildingcovered in bloodvictimvirtual realityback from the deadandroidmasked manpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirthologramslaughterdisfigurementknife throwingfemale doctorsevered legtank topgatling gunshot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headextreme violencemicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimmurder of a nude womanarmy basemass murdererscience runs amokarmoryspacesuitx rayed skeletonregenerationearth viewed from spacecryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacehuman in outer spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyspaceship crashfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All)

Ghost Ship (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ghost Ship (2002)

After discovering a passenger ship missing since 1962 floating adrift on the Bering Sea, salvagers claim the vessel as their own. Once they begin towing the ghost ship towards harbor, a series of bizarre ocurrences happen and the group becomes trapped inside the ship, which they soon learn is inhabi …ted by a demonic creature. (Read More)

Subgenre:
suspensecult filmsurvival horror
Themes:
greeddeceptiondrunkennessbetrayalmurderdeathghostangersupernatural powerguilt
Mood:
gorerain
Locations:
barseaoceanghost ship
Characters:
little girllustghost in mirror
Period:
1960syear 1962zip line
Story:
villain not really dead clichesole black character dies clichestartledstabbed in the footstabbed in the legstabbed in the throatknocked outcharacter repeating someone else's dialoguestabbed in the backshot in the foreheadfemme fataledeath of friendthroat slittingambulanceflashlight …held at gunpointfalling from heightpunched in the faceshot in the chestblood splattershot to deathcorpsepistolbloodviolencefemale frontal nudityflashbackfemale rear nuditycigarette smokingphotographtitle spoken by characterexplosionmachine gunshot in the headshotgunvomitingislandsubjective cameradecapitationmassacrewomanimpalementmapsevered headradiochild in perilunderwater scenecigar smokingnecklacedrowningbinocularsperson on firepoisonstorytellingdeath of childskeletondisappearanceexploding bodyhauntingratsevered armdismembermentchild murderitaliangoldcaptainburned alivemass murderlooking at oneself in a mirrorshot in the stomachtreasurebuttocksfemale singersevered handwatching televisionsoulsintorso cut in halfapparitionfemale removes her dressshipwreckburnt faceshot in the eyetavernpoisoningdripping bloodrazor bladescuba divingpassengeraltered version of studio logocruise shipmaggotshape shifterimmortalexploding shipcut into piecessole survivorpool of bloodlocketradarballroomstraight razorballroom dancingcruiseexploding boatfalling through the floorc4 explosivessliced in twohundred dollar billfall to deathlocked inblowtorchmorphingfreak accidentocean linerrock paper scissorssinking shiphead cut in halfshaving headspear gungold barindoor swimming poolrat poisonwoman wearing a red dresssalvagehanged childhung from a hookconstruction cranepile of moneytugboathit with a metal pipeavaricefalling to one's deathrustshell casingchild ghostlogbookdigital watchluxury linerpoisoned foodevil markfall through floorbering straitcan of beansfalling into poolhiding in a freezership collisionbenevolent spirittug boat (See All)

Split (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
suspenseblack comedysuperherotragedypsycho thrillersurvival horrorteen horrorpsychological thrilleramerican horror
Themes:
surveillancepsychopathdeceptionescapebetrayaldeathmurderfriendshipsurrealismkidnappingrapefearfuneralmonstervoyeurism …death of fatherbrutalityparanoiainsanitymental illnesspaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
trainforesttaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
serial killerteenagerfather daughter relationshipafrican americandoctorteenage girlpolice officerhostagekillersecurity guardvillainpsychiatristterroruncle niece relationshipslasher killer …serial murdererpolice dog (See All)
Period:
2010s
Story:
sole black character dies clichedead teenagercharacters killed one by onewalkie talkiesecurity camerasociopathrevelationsuspicionhigh school studentknocked outnews reportdeath of friendambulanceflashlightheld at gunpoint …rescueshot in the chestshot to deathcorpsecell phonesurprise endingchaseknifepartysequelviolencebloodone word titleflashbackdogbare chested maledancingtitle spoken by characterpantiesshotgunwatching tvcomputerwritten by directorpaintingriflesecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomdinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partyold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shotmissing persontentevil manbaseball batflowersscarinjectiontragic eventstalkingbasementlaptoploss of fathermurdererkillingmaniachypodermic needleheavy rainlooking at oneself in a mirrorcagerageloss of friendcaptivehuntercaucasiantherapisteccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countkilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardianmacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Solace (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Solace (2015)

A psychic doctor, John Clancy (Sir Anthony Hopkins), works with an F.B.I. Special Agent (Jeffrey Dean Morgan) in search of serial killer Charles Ambrose (Colin Farrell). After having lived in isolation for two years, since the death of his daughter, Clancy is asked by his friend Joe, an F.B.I. Speci …al Agent to help him solve several murders committed by a serial killer. The problem is that Ambrose is also psychic, and far ahead of Clancy. (Read More)

Subgenre:
suspenseindependent filmsupernatural
Themes:
home invasiondeceptioninvestigationdeathmurderfriendshipfearfuneraldeath of fatherbrutalitysupernatural powerparanoiacancerdeath of daughtermurder of daughter
Mood:
goreneo noircar chase
Locations:
elevatorhospitalbartrainchurchhotelcarbathtubtaxiapartment
Characters:
serial killerhusband wife relationshippolicehomosexualfather son relationshipmother son relationshipfather daughter relationshipdoctorpolice officerchristianmysterious killerpolice dog
Period:
seeing the future
Story:
foot chasered herringwhodunitcrime scenewalkie talkiesociopathcharacter repeating someone else's dialoguepolice officer killedshot in the foreheadno opening creditsdeath of friendf wordheld at gunpointrescueshot in the chest …blood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifebloodviolencefemale nudityone word titlebare breastsfemale frontal nudityflashbackdoggunfemale rear nuditytopless female nudityshootoutmachine guncar accidentshot in the headshotgunslow motion scenegunfightbare buttlettershowdowncar crashhandcuffsrevolvershot in the backambushsubwayanti heroshot in the leglatex glovesfbipoisonrace against timedeath of childtough girlshot in the shoulderscardeath of husbandpsychicnewspaper headlinechild murderterminal illnesswolfbulletheavy rainfbi agentswat teampsychologistdriving a carmexican standoffhaunted by the paststealing a carvisionpolice officer shotdark heroassault rifleautopsybulletproof vestnotepolice raiddark pasttragic herolasersightnude woman murderedmoral dilemmabullet timedrugged drinkclose up of eyesblood on camera lensshot in the neckpolice officer shot in the chesteuthanasiafilm starts with texthivpremonitionmercy killingleukemiapsychic powertwo way mirroroverturning cartragic pastprophetmind readingclairvoyantpolice officer shot in the headbrain tumorcoming out of retirementhot dog standfax machinetelling a joketroubled productionhand gunshot in the eartoxinvision of the futuredead daughterchild cancerprojectorfemale psychologistchild with cancerdivinationpredicting the futurealtering the futurechild with leukemiadiviner (See All)

Jack Reacher (2012) is one of the best movies like Scream 4 (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jack Reacher (2012)

In an innocent heartland city, five are shot dead by an expert sniper. The police quickly identify and arrest the culprit, and build a slam-dunk case. But instead of confessing, the accused man writes the words, "Get Jack Reacher." Reacher himself sees the news report and turns up in the city. The d …efense is immensely relieved, but Reacher has come to bury the guy. Shocked at the accused's request, Reacher sets out to confirm for himself the absolute certainty of the man's guilt, but comes up with more than he bargained for. (Read More)

Subgenre:
conspiracysuspenseblack comedymartial artsmurder mystery
Themes:
surveillancedeceptionescapebetrayalmurderdeathkidnappinginfidelitygangstermurder investigation
Mood:
rainneo noircar chaseambiguous ending
Locations:
police stationelevatorhospitalbarbusurban settingmoteltunnel
Characters:
self mutilationpolicefather daughter relationshipprostitutesoldierhostagetough guyaction herohitmanpolice detectivesniperrussianamerican abroadsniper riflepolice chase …ex soldiermysterious villainrussian gangster (See All)
Story:
lens flarepunched in the stomachcrime sceneparking garagesecurity cameravigilanteknocked outcharacter repeating someone else's dialoguepolice officer killedshot in the foreheadnews reportheld at gunpointpunched in the facerescueshot in the chest …shot to deathcorpsecell phonepistolsurprise endingknifebloodviolencecharacter name in titlebased on novelflashbacktwo word titlebare chested maletitle spoken by charactershootoutbeatingfistfightmachine gunshot in the headwritten by directorarrestbrawlshowdownhand to hand combatcar crashshot in the backsubjective cameraassassinambushbridgearmydinerprisonerfalse accusationanti heroone man armychild in perilone against manyorganized crimebeaten to deathpay phonecharacter's point of view camera shotcover upkicked in the faceshot in the shoulderscarthreatcorrupt copcrime bossmachismohead buttcomabar fightbroken legthugdamsel in distressstealing a carsevered fingeru.s. armyconstruction sitekicked in the crotchtitle appears in writingpolice officer shotassault rifleeye gougingdisfigurementlonerdeath of loved oneframed for murderprivate investigatorhit with a baseball batsuffocationmysterious manex copdriftertaserohiovigilantismgunslingerfemale lawyervigilante justicedistrict attorneyman kills a womanman punching a womancleaning ladypawnshopoverhead camera shotaikidocrowbarmemorialshooting rangeblack copwrongful arrestsurveillance footagepittsburgh pennsylvaniaex marinecorporate crimequarrybritish actor playing american characterbroken handobituarybolt action rifledefense attorneybaghdad iraqkeysi fighting methodfiring rangemilitary veteranhit on the head with a rockreference to mike tysoniraq veteranmeth labparking meterwaking up from a comaafghanistan veteransmothered to deathauto shoprandom killingshooting spreestalled car (See All)

Scouts Guide To The Zombie Apocalypse (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scouts Guide To The Zombie Apocalypse (2015)

A reckless janitor accidentally releases a zombie from a laboratory of research. Meanwhile, the teenagers scouts Ben Goudy and Carter Grant decide to camp for the last time since they are too old to be scouts. The problem is that they do not want to harm the feelings of their friend Augie Foster and … the Scout Leader Rogers. They have a flat tire after hitting a deer on the road and Carter's sister Kendall Grant, her boyfriend and her friend Chloe stop their Jeep to see whether they need a ride. They invite Ben and Carter to go to a party in the night. The two scouts leave the camping during the night to go to the party. When they drive through the town, they do not see a living soul and they decide to visit a night-club since the bouncer is not at the door. They discover that people have turned into zombies and they team-up with Ben's recent acquaintance Denise Russo, who is bartender in the nightclub, and Augie that was left alone at the camp and came to the town. Soon they discover that the non-infected inhabitants have been evacuated and the town will be bombed by the government. They decide to rescue Kendall but they find that the address her boyfriend gave to them is wrong. What can they do to save Kendall? (Read More)

Subgenre:
black comedycoming of ageb movieabsurdismslapstick comedyteen movieteen comedyzombie apocalypseurban fantasy
Themes:
murder of a police officerhome invasiondeceptionescapedrunkennessbetrayalmurderrevengedeathfriendshipfearmilitaryrivalryunrequited loveexploitation …apocalypsecouragenear death experienceunlikely heroghost town (See All)
Mood:
high schoolgorebreaking the fourth wallone night
Locations:
police stationsmall townbarschoolforesthelicoptermotorcyclebuswoodsstrip clubcampfirelaboratory
Characters:
self mutilationteenagerboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacherzombiesoldierpolice officerhostagebest friendwaitressalcoholicolder woman younger man relationship …homeless manneighbor neighbor relationship (See All)
Story:
threatened with a knifefoot chasestabbed in the foreheadgeneration ystupid victimshot in the crotchstabbed in the legstabbed in the neckstabbed in the throatunderage drinkingwalkie talkiefalling down stairspolicewomanhigh school studentcharacter repeating someone else's dialogue …stabbed in the backvirginpolice officer killedshot in the foreheadtied to a chairstabbed in the cheststabbed to deathflashlightf wordrescueshot in the chestblood splattershot to deathcorpsecell phonepistolsurprise endingchaseknifepartyviolencebloodbare breastsmale frontal nuditymale rear nuditybare chested malegunkissfightphotographexplosionlesbian kissfiretopless female nuditymachine guncar accidentshot in the headshotgunslow motion scenecatwritten by directorcondombare buttpaintingbeerbombcar crashjailclassroomalcoholstripperscientistshot in the backdecapitationsurvivalambushcaliforniaaxemassacremontageimpalementmapaccidentsevered headradiohit by a carvanshot in the legold womanon the rungunshotattempted murderbeaten to deathdangerportraitprologuekeysuburbperson on fireattackuniformproduct placementrace against timemissing persontentscene during end creditsdiarygymamerican flagbodyguardwigsplit screenexploding bodybasementloss of fatherpremarital sexcharacter says i love yousevered armdismembermentundeadmonkeygaragetopless womanhand grenadefireplaceburned alivekilling an animalhead buttcagediseasevirusjail cellexploding buildingbarefoot malecovered in bloodgrindhouseteenage protagonistback from the deadeaten alivereverse footagejanitorstealing a carbraveryu.s. armycrossbowblood on faceobesityhit in the crotchhomelessresurrectionconvenience storeshot in the facebroken glassevacuationstabbed in the headmentorcigarette lighterexploding headrivaljumping through a windowinfectionaerial shotwisecrack humorblood on shirtfriendship between boysone daydeerdisfigurementgasolinestabbed in the eyeclassmatebody countaxe murdermutationtrophysevered legflat tiremale virginheroismdjblood on camera lensearphonesflagfire extinguisheroutcastshot in the neckdead animalhomagedefecationhead blown offarmored carjournallightermale friendshipabandoned housemallblood stainburnt facehead bashed inreluctant herobitten in the neckshot in the handaltered version of studio logohead cut offevil womantrampolinebadgesitting on a toilettraffic accidentbouncerstabbed in the facecellreference to star warscut into piecesscatological humorvending machineimprovised weaponburn victimhouse on fireanimal killingpunch in faceknocked out with a gun buttteenage heromale male hugoutbreakzombie attackscreaming womanscientific researchselfiehardware storeliquor storestabbed in the mouththroat rippingnight clubpaddlesurprise during end creditsbechdel test failednail gunaxe in the headlearning the truthbarricademan wearing a wigfalse teethcorporalscientific experimenthand through chestscouttoupeeblood on handsboy scoutreference to britney spearssevered penisbustid cardtoilet stallabsurd violenceclassmate classmate relationshipstabbed in the crotchcleanerhit with a frying pantire ironvulgar languagehit with a car doorgory violencedead deerfirst aidscreaming girltaking off underwearmarshmallowmopwoman hits manmillennialrecruitmentcampsiteknothole in chestteeth knocked outfertilizeractor talks to audiencehordejaw ripped offmale female fightbiting someonerunning out of ammoface burntooth knocked outescape out a windowgarbage chutescoutingbank notecopped feelreference to dolly partonescape out windowhomemade explosivekilling a deerobscene hand gesturecat ladyescaping out a windowpenis ripped offlock pickingcagedweed whackerescape by the windowrecruitment videoreference to bambibitten in the armreading someone's diaryface blown offwater treatment plantgearing upzombie animalevil old womanheart massagescoutmasterstabbed through the neckzombie cat (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Scream 4?
<< FIND THEM HERE! >>