Please wait - finding best movies...
Shooting a vampire flick in an old, abandoned manor house should have worked like a dream, but the film crew is out of their depth, over schedule and desperate to get the shoot finished and go home. However, as the moon turns full, the nightmare begins. Blood flows and the body count rises as cast a …nd crew meet the manor’s resident werewolf… (Read More)
Mood: | nightmare |
Characters: | vampire |
Story: | abandoned manorbody countmanor housethe moonscheduledesperateshootabandonedcountmanorfilm crewbodyhomewolfwerewolf …moonscreamhousedream (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody |
Themes: | murderdeathfriendshiprevengesurrealismkidnappingfearescapevoyeurismseductionbrutalitydeath of mothertime travelbullyingpanic …self sacrificenear death experience (See All) |
Mood: | satirespoofhigh schoolparodyslasherambiguous ending |
Locations: | hospitalforestwoodssinging in a car |
Characters: | homosexualteenagermother daughter relationshipdoctortattooteenage girlteenage boyfemale protagonistgirlserial killernursehostagekillermotherex boyfriend ex girlfriend relationship …parent child relationshipslasher killerself referentialparty girl (See All) |
Period: | 1980syear 1986year 1987 |
Story: | body countcountbodyscreamviolenceflashbacktwo word titlebare chested malecigarette smokingdancingexplosionknifechasethree word titlesurprise ending …pantiesfirecell phoneshot to deathcar accidentshot in the chestblonderescueslow motion sceneundressingvomitingshowdowncar crashvoyeurf worddecapitationgood versus evilcleavagesurvivalfoot chasegay slurorphansword fightambushmontageimpalementstabbed to deathdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivingsevered headscantily clad femalehit by a cardouble crossvanflash forwardattempted murdervirgindangerstabbed in the backprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazinemercilessnessescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinedark pastcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendsummer campmovie actressfilm in filmshot with an arrowhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowgrindhouse filmwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen buscamp counselorouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
Subgenre: | independent filmcult filmslasher flickteen movieteen horroramerican horrorindependent horror |
Themes: | murderrevengesurrealismfuneralpsychopathsupernatural powerevil |
Mood: | nightmaregorehigh schoolavant gardeslasher |
Locations: | cemeterybathtubpolice station |
Characters: | husband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlserial killerkilleralcoholicvillainterrorpolice chaseself mutilationslasher killermysterious villain …serial murdererpolice lieutenant (See All) |
Period: | 1980s |
Story: | body counthousedreambloodviolencebare chested malecigarette smokingsurprise endingcorpseblood splattermirrorface slapslow motion scenearrestfalling from height …beddemonjailclassroomtelephonesubjective cameragood versus evilfoot chasestrangulationdeath of friendstabbed in the chestcoffeeperson on firefirst of seriescharacter's point of view camera shotevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youfirst partreference to william shakespearecult directorstrong female charactermaniacfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixpsychogrindhousevictimstrong female leadseriesswitchbladesevered fingerbutcherheadphonesbooby trapdisfigurementcharacters killed one by onecellaralarm clockserial murderpsychopathic killerbad guymadmanvigilantismhomicidal maniacloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clichebutcherygrindhouse filmplant in titlecreepglovetrail of bloodhit with a chairface ripped offpsycho terrorchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All) |
In the early 70's, Commander Nathan Walker, Captain Ben Anderson and Lieutenant Colonel John Grey are assigned in a secret mission to the Moon to protect the USA from USSR using detectors. Nathan and Ben land on the Moon in the Liberty module while John stays in orbit in the module Freedom. They col …lect rock samples and bring them to the Liberty. They also find footprints and the body of a Soviet cosmonaut on the moon. Soon they hear weird noises and they find that they are not alone in the satellite. (Read More)
Subgenre: | mockumentaryfound footagepseudo documentary |
Themes: | deception |
Mood: | archive footage |
Locations: | outer spacespace |
Characters: | alien |
Period: | 1970syear 2011year 1969year 1972year 1970 |
Story: | the moonbodymoonnumber in titlebloodtwo word titlebare chested maletitle spoken by charactersurprise endingcorpsedigit in titleblood splattercameravideo cameraspaceship …creaturetalking to the cameramissioncover upamerican flagthreatisolationblindfoldsurgerywhat happened to epiloguehelmethammerspiderhome movietensionlandscapearchival footageastronautinfectionbarbecuenasaclose up of eyes12 year oldset upminimal casttop secrethammocksecret missionwalkmanalien creaturespacesuitfootprintsnoringearth viewed from spaceno survivorscassette tapetrapped in spacecreepymoon landingcosmonaut2012craterunknownrocket launchingspaceship crashcreaturesmotion sensorsaturn v rocket2013u.s. department of defensealien infectioncamera footageinterferencewalking on the moonmoon rockmotion detectorsoviet flagapollo spacecraftfamous speechalien threatmoon buggy (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | murderdeathghostfuneralmonsterpsychopathsupernatural powerinsanitysadismevil |
Mood: | nightmaregoreslasher |
Locations: | barchurchcemeteryschool boy |
Characters: | father daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlsingle motherkillervillainterrorself mutilationslasher killeralcoholic father …serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | body countdreamfemale nuditynumber in titleviolencesequelbondagebare chested malecigarette smokingsurprise endingfirecorpsedigit in titleblood splatter …slow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed to deathsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backscreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyecharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn …that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)
Subgenre: | cult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talegothic horrorfolk horror |
Themes: | murderdeathlovefriendshiprevengekidnappingbetrayalfeartortureescapedeceptionseductionangerdeath of fathersupernatural power …death of motherparanoiahumiliationunrequited loveexecutionpaniccouragedeath of daughterautism (See All) |
Mood: | nightmaredarkness |
Locations: | churchforestsnowboatvillagewoodslakecavelog cabin |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierpriesthostagesister sister relationshiplove trianglegrandmother granddaughter relationshiphunting party …woodcutter (See All) |
Period: | winter |
Story: | wolfwerewolfmoondreamf ratedcharacter name in titlebloodviolenceflashbackdancingpartyknifechasethree word titlesurprise ending …firevoice over narrationtitle directed by femalecorpseblood splatterhorseshot in the chestrescueslow motion sceneswordarrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalfoot chaseorphanambushaxemassacremountainarmyimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossritualflash forwardtreecursedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherwaterfallloss of mothercaptainsabotagerevelationgothichelmetjail cellhuntersevered handtorchanimal attackpreacherfull moonrampageshieldvisionbraveryarranged marriagecrossbowhatredrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithunttaverncabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arrestglowing eyeshatchetcard trickhorse drawn carriagestagecoachmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All) |
The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil …dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)
Subgenre: | independent filmcult filmblack comedydark comedypsycho thrillersurvival horroramerican horror |
Themes: | murderdeathkidnappingdeceptionincestpsychopathinsanitymental illnesssadismevilhome invasiongreedcannibalismwealthstarvation …claustrophobia (See All) |
Mood: | goresatireslasherdarknesssocial satire |
Locations: | los angeles californiaslum |
Characters: | policefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipvillainterrorkiller dog |
Period: | 1990s |
Story: | body counthomehousebloodviolencedogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathblood splattershot in the chestface slap …shotgunbirthdayflashlightmansionimpalementchild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil mandeath of childskeletonbasementcharacter says i love youcult directorterminal illnessmaniacfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachspiderpsychosevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticperversionmurder of a childsouldead boycellarlasersightlandlordpsycho killergothpervertserial murderpsychopathic killerbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterhomicidal maniacfemale psychopathclimbing through a windowslashinganimal abusebayonetslingshotpondfuneral homemurderessroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathmurder spreedisturbed individualgrindhouse filmstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handpsycho terrorfemale serial killershot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childbad girlpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
Themes: | murderdeathtortureescapepsychopathbrutalityinsanitysadismevilhome invasionexploitationcrueltymurder of a police officer |
Mood: | gorenightslasherblood and gore |
Locations: | strip clubtrying to escape |
Characters: | husband wife relationshipfather daughter relationshipteenagermother daughter relationshipteenage girlserial killerhostagethiefkillervillainterrorself mutilationtalking to oneself in a mirrormysterious villainthe family …mysterious killerkiller dogdirector of photography (See All) |
Story: | body counthomescreamhousefemale nuditycharacter name in titlebloodviolencebare breastsfemale frontal nudityflashbacktwo word titlefightcigarette smokingnipples …knifelesbian kisssurprise endingpistolbeatingcorpseblood splattermirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingimpalementstabbed to deathstabbed in the chesttied to a chairscantily clad femalechild in perilhit by a cardangerscreamingelectrocutiondebtevil manactor shares first name with characterisolationneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationpsychocovered in bloodvictimteddy bearanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyeboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The … only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)
Subgenre: | cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy |
Themes: | deathherovoyeurismseductionsupernatural powerfaithpolice investigation |
Mood: | gorespoofnight |
Locations: | small townnightclub |
Characters: | vampirepolicemother son relationshipteenagerboyfriend girlfriend relationshipteenage boyserial killerdetectivepolicemanactorsingle mothervillaingirlfriendparent child relationshipneighbor neighbor relationship |
Period: | 1980s |
Story: | wolfwerewolfhousefemale nuditynuditybloodmale nudityviolencemale rear nuditytwo word titlebare chested maleguntitle spoken by characterchase …surprise endingpistoltopless female nudityshot to deathmirrorshot in the chestpunched in the facewatching tvwritten by directorundressingfalling from heightpaintingheld at gunpointneighborvoyeurgood versus eviltoplessimpalementstabbed in the chestsevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginsuburbskeletonscarhigh school studentstalkingcrossexploding bodywitnessbasementcharacter says i love youfirst partundeadfalling down stairsburned alivelifting someone into the aircrucifixhunterteenage protagonistwoman in jeopardyreverse footagehypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingbloody violencevampirismhomosexual subtextvampire hunterpsychotronic filmblack copghoullifting person in airglowing eyesgrindhouse filmholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starremadewashed up starstabbed in the heartshort haired femalevampire bitehorror movie remadered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All) |
Jonathan Harker is sent away to Count Dracula's castle to sell him a house in Wismar where Jonathan lives. But Count Dracula is a vampire, an undead ghoul living off of men's blood. Inspired by a photograph of Lucy Harker, Jonathan's wife, Dracula moves to Wismar, bringing with him death and plague. ….. An unusually contemplative version of Dracula, in which the vampire bears the curse of not being able to get old and die. (Read More)
Subgenre: | cult filmgothic horror |
Themes: | deathsurrealismmarriagefearlonelinessdepressioninsanityillnessevilamnesiaself sacrifice |
Mood: | nightmarehorror movie remake |
Locations: | hospitalbeachcemeterysmall townvillageseashipcastlegermanytown |
Characters: | vampirehusband wife relationshipdoctorlustemployer employee relationship |
Period: | 19th century |
Story: | housebased on novelbloodknifesurprise endingcorpsehorsemirrorremakecatarrestfalling from heightbookbeddead body …voyeurmansionwomandinnernuncoffinforeign language adaptationjourneynecklacecurseevil mandiarycrosshorse ridingpigratcaptaininjuryagenthammervisitsheepviolinclockwoman in jeopardygypsyimmortalitysuperstitionshadowexistentialismhorse and carriagemelancholyviolinistbatcontractreflectionreal estate agentharbordraculaplaguereal estatemarried coupleinsane asylumkittensunrisefeverinnpsychotronic filmsleepwalkingescaped mental patientbitebaldnessfuneral processionblood drinkingtransylvaniadrinking bloodstakemaster servant relationshipbusiness tripnew neighborruinvampire biteriding a horsebaltic seanew german cinemacity councilblack seagerman expressionismestate agentgypsiespsychic linktown squarenosferatuwatching through a windowevil spellpallbearerpeststraitjacketlong fingernailssucking bloodmultiple language versionpointy earssigning a contractbiting someone's necksleeping in a coffin (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | independent filmcult filmblack comedysupernaturaldark comedyparanormalpsycho thrilleramerican horrorindependent horror |
Themes: | murderdeathsurrealismdrugsghosttorturepsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia |
Mood: | nightmaregorerainhigh schoolslasherdarkness |
Locations: | small townairplaneroad trip |
Characters: | family relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderergerman american …evil father (See All) |
Period: | 1990s1970s1960s1940s1950s |
Story: | body countdreamf ratedcharacter name in titlebloodviolencesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in titletitle directed by femaleblood splatter …rescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | martial artscult filmcoming of ageblack comedysuspensesupernaturalheist |
Themes: | murderdeathfriendshiprevengesurrealismsuicidekidnappingbetrayalfearescapedeceptionseductionrobberydeath of fathersupernatural power …paranoiasurveillanceevilhome invasionpanic (See All) |
Mood: | nightmaregore |
Locations: | schoolchurchcemeteryairplanelondon englandtaxiairportpolice stationshiprooftopcatholic church |
Characters: | vampirefather daughter relationshipdoctorpriesthostagethiefwarriorinterracial relationshipchristianitysecurity guardbibleprofessorsecretarycatholiccatholic priest |
Period: | 2000s |
Story: | wolfwerewolfdreamsexcharacter name in titlenumber in titlebloodviolenceflashbackbare chested malegunfightphotographexplosionparty …knifelesbian kisschasesurprise endingpistolcorpseshot to deathblood splatterfistfightmirrorshot in the chestshotgunrescueslow motion scenepunched in the faceswordarrestbrawlfalling from heightpaintingshowdownheld at gunpointhand to hand combatbedinterrogationhallucinationhandcuffsreference to jesus christshot in the backf worddecapitationgood versus evilsurvivalfoot chasebedroomflashlightcandleambushold manstrangulationmassacredisguisedeath of friendthroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headcoffindouble crosspolice officer killedsearchfemme fatalenews reporttransformationracial slurflash forwardattempted murderlibrarypilotcursestabbed in the backkeyperson on fireproduct placementrace against timeevil manknocked outkicked in the facecollege studentlightninghangingsensualitymanipulationinjectioncrossneck breakingpremarital sexthreatened with a knifedirectorial debutsevered armundeadstylized violenceropetraitordestinyburned aliverevelationhypodermic needlegothicscene during opening creditssecurity cameracrucifixstealingkicked in the stomachjumping from heightskullmind controlparking garagecarnivalback from the deadrampageinterracial romancereverse footageexplosivecrossbowburglarystabbed in the throathatredmercilessnessnew orleans louisianaresurrectionimmortalityhypnosismentorswamppunched in the chestjumping through a windowairplane crashbooby trapwisecrack humorstabbed in the eyefemale reporterkilling spreeburned to deathtelepathybullet timebatenglishman abroadimpersonating a police officernews reportertombgothlevitationcrucifixiondraculasuper strengthcomputer crackertelevision newsconfessionalstabbed in the armfemale vampirecameramancomputer hackergreenhousepolice interrogationone lineroffscreen killingcrashing through a windowbitten in the necksunrisewoman kills a manbody bagfilmed killingtwo way mirroropen endedwoman fights a manvaultdeath of title charactercockney accentmind readingtelevision reporterfingerprintstupid victimglowing eyesregenerationrecord storevampire slayermistmushroom cloudinvulnerabilitycoming out of retirementman fights a womanstakeblood transfusionweaponryneon signsunlightleechmardi grassilverstabbed in the heartout of body experienceantique dealerneongarden shearsestranged daughtervoice recording1790ssilver bulletbloodlustmaster apprentice relationshipfangreference to judasblood suckingvan helsingjourney shown on mapreference to judas iscariotturbulenceindestructibilitysexy female vampireretina scanantique gundeath of mentornude female silhouetteantique storeretina scan fakedreference to bram stokerancient vampirestabbed through the backzero gravity sex (See All) |
Is becoming a woman analogous, in some deep psychological way, to becoming a werewolf? Ginger is 16, edgy, tough, and, with her younger sister, into staging and photographing scenes of death. They've made a pact about dying together. In early October, on the night she has her first period, which is …also the night of a full moon, a werewolf bites Ginger. Within a few days, some serious changes happen to her body and her temperament. Her sister Brigitte, 15, tries to find a cure with the help of Sam, a local doper. As Brigitte races against the clock, Halloween and another full moon approach, Ginger gets scarier, and it isn't just local dogs that begin to die. (Read More)
Subgenre: | independent filmcult filmcoming of ageblack comedydark comedycreature feature |
Themes: | murderdeathsuiciderapepregnancydrinkingtorturedrunkennessobsessionsupernatural powerdrug usecancerphotography |
Mood: | nightmaregoresatirehigh schoolsocial satire |
Locations: | schoolforestbathtubwoodsschool nurse |
Characters: | policefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipboyteenage girlteenage boyfemale protagonistteachernursestudentdancerphotographersister sister relationship …witchgirl fightself cutting (See All) |
Story: | bodywolfwerewolfmoonsexf ratedcharacter name in titlebloodviolencemasturbationdoggunkissfightcigarette smoking …dancingphotographpartyknifepantiesbeatingcorpseblood splatterurinationwatching tvcameradrinkcondomvomitingshowdownrunningdead bodymarijuanaclassroomhalloweenflashlightcandlestabbingdrug dealerthroat slittingimpalementtoilethit by a carvanlatex glovespaincursevirginsuburblocker roomfirst of seriespoisonmissing personbaseball batflowershanginginjectionexploding bodybasementfirst partclassobscene finger gesturefireworksredheadgaragechainsawfalling down stairspot smokingloyaltywoundhypodermic needlegothicinjuryvirusstabbed in the stomachwatching a moviecovered in bloodburialanimal attackmilkdrug dealingfull moonpromisejanitorsevered fingerplaygroundstabbed in the throatkickingshovelinfectionswingfamily dinnerbroken armdead boymutationhalloween partydead dogdead girlgothporn magazinemenstruationhairkilling a dogpubertypolaroidbeast16 year oldurinepiercinggreenhousewormsense of smellbleedingbiologyteethloss of sistermicroscopecureclawbechdel test passedpitchforkshapeshiftingcoughing bloodgoth girlbludgeoningx rayed skeletonbitten in the throatslide showfurdrugstoretamponflickering lighthuman becoming an animallawn moweroathdrinking bloodface ripped offdark heroineslide projectorhowlingroadkillsuicide pacttea partysilverfake bloodfake suicidefield triptailhockey stickschool lockercanuxploitationentrailsguidance counselorlearning to driveneon lightlycanthropyvowwatching a movie on tvmenarchepactlaxativerocking horsesilver bulletboys' bathroomstdfemale werewolfsupernovableachgirls' bathroomdetoxtesticular cancerfingernaillycanthropespilled milkbelly button piercingpmslocked in a bathroomsandboxaccidental stabbinggasoline cannavel piercingcheckout clerkpicket fenceeating a wormraking leavesspinestreet hockeysuspected paedophilecrampteaching someone how to drivecanadian gothicfield hockeyhomeopathykicking a dogovulationathletic fieldmetabolismsanitary napkingrowing marijuanawhite blood cellhair curlerinjection into one's neckpawclaw markdeep freezerobsessed with deathurinating bloodbitten by an animalblood sisterdiet pillshit with a hockey stickscrewdriver the toolwolfsbane (See All) |
Michael Myers is still at large and no less dangerous than ever. After a failed reunion to reach his baby sister at their old home, Laurie Strode is immediately taken to a hospital to be treated by the wounds that had been afflicted by her brother a few hours ago. However, Michael isn't too far off …and will continue his murdering 'Halloween' rampage until he gets his sister all to himself. (Read More)
Themes: | deathsuicideghostdrunkennesspsychopathbrutalityinsanityevilexploitationhomelessnessmurder of a police officerdeath of daughter |
Mood: | nightmaregorerainslasherdarkness |
Locations: | hospitalhelicopterstrip club |
Characters: | mother son relationshipfather daughter relationshiptattoosingerserial killerpsychiatristsniper riflecoroner |
Story: | body counthomedreamfemale nuditynumber in titlebloodviolencesequelfemale frontal nudityinterviewflashbackfemale rear nuditysingingpartychase …pistolbeatingcorpseblood splattercar accidentshot in the chesturinationshotgunslow motion scenecameramaskbookvomitingheld at gunpointsecond partcar crashcafehallucinationstripperf worddecapitationhalloweenflashlightbandstrangulationstabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestexploding carhit by a carlatex glovesflash forwardstalkermicrophonestabbed in the backportraitclownattackevil manhalloween costumescarstalkingglassesneck breakingmurdererprofanitypizzamaniacsurgerykilling an animalwoman with glasseshidingcovered in bloodvictimsheepschizophreniamental institutiongirl with glassesduct tape over mouthrampagecorsetblood on facehippiegash in the facetaking a picturestabbed in the headtime lapse photographybroken armaxe murdercharacters killed one by onekilling spreeswearinghalloween partymusic bandhit with a baseball batinterrupted sexserial murderpsychopathic killerbad guybeheadinggroupg stringreturning character killed offmedical masksurgical maskhuman monstersexual violencehomicidal maniacslashingdental maskhead bashed infilm starts with textassistantstrong languagebody baghanged manhead cut offcountry houseextreme violencegraphic violenceoverturning carstabbed in the facebloody violencefemale victimsadistic psychopathpentagramschizophrenicbreaking through a doormurder of a nude womanmass murdererbreaking a mirrorpole dancingjack o'lanterncrime spreereturning character with different actorshackbook signingscreaming in fearmirror ballbrandymichael myersshaky camwhite horsethrown through a windshielddemonicsadisticpublic speakingboogeymangory violencesequel to remakesatanicaxe murderertape over mouthwoman wearing glassesjumpsuitstitchesknife in the headbad jokebleeding from eyespigletmultiple versionsserial teen killerclown maskaxe in the backgirl wearing glasseswhite maskthroat slitnitrile glovesstomped to deathdictionary definition in screen textpublic speakertraumatic shockultraviolenceremake of sequel (See All) |
Wisbourg, Germany based estate agent Knock dispatches his associate, Hutter, to Count Orlok's castle in Transylvania as the Count wants to purchase an isolated house in Wisbourg. They plan on selling him the one across the way from Hutter's own home. Hutter leaves his innocent wife, Ellen, with some … friends while he is away. Hutter's trek is an unusual one, with many locals not wanting to take him near the castle where strange events have been occurring. Once at the castle, Hutter does manage to sell the Count the house, but he also notices and feels unusual occurrences, primarily feeling like there is a dark shadow hanging over him, even in the daytime when the Count is unusually asleep. Hutter eventually sees the Count's sleeping chamber in a crypt, and based on a book he has recently read, believes the Count is really a vampire or Nosferatu. While Hutter is trapped in the castle, the Count, hiding in a shipment of coffins, makes his way to Wisbourg, causing death along his way, which most attribute to the plague. Hutter himself tries to rush home to save his town and most importantly save Ellen from Nosferatu's imminent arrival. In Wisbourg, Ellen can feel the impending darkness as Nosferatu gets closer. But she learns that a sinless woman can sacrifice herself to kill the vampire. Will Hutter be able to save Ellen either from Nosferatu and/or her self-sacrifice? (Read More)
Subgenre: | supernaturalsilent filmdark fantasymonster moviegothic horrorsilent movie |
Themes: | deathsurrealismfearescapemagicobsessionsupernatural powergreedpanicself sacrificemadness |
Locations: | beachforestsmall townwoodsseashipcastlegermanyghost ship |
Characters: | vampirehusband wife relationshipdoctornurselustprofessorterror |
Period: | 19th century1830s |
Story: | counthomewerewolfhousebloodphotographchasebased on bookcorpseletterrivergood versus evilcandleaxemountain …bridgemapcoffinlegendcountrysideisolationrattied upundeadropedestinyfireplacegothicfaintingloss of loved oneloss of wifespiderburialwoman in jeopardywhipdrummerrowboatsuperstitionblack and whitesailorhorse and carriageasylumbatreal estate agentpeasantdraculafountainromaniatowerfreakabandoned housereal estaterafthospital roomcottageflyhusbandnewspaper articlepredatorsunrisedocumenthammockroosterinnshapeshiftingwriting a letterpsychotronic filmabandoned warehouseghoulpet catlocketsleepwalkingstreamsailing shipexpressionismangry mobwebbedriddenstagecoachremotetransylvaniamaster servant relationshipnew neighborseashorephantomhorror iconfiendsea captaindeliriumhorror movie remadecroquettravellerhorsebackhyenavampire batgerman expressionismstop motion scenegypsiesbite markcoded messagesea voyagenative dressbook of the deadmass hysteriaburial at seabuying a housenosferatublack deathescaping out a windowreflection in mirrorschoonerdunesquill pencreepy neighborbremen germanyday for nightvenus flytrappointy earsdeath by sunrisesitting on a roofsleeping in a coffinworried wife (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
Themes: | murderdeathfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressioninsanitysadism …eviltrauma (See All) |
Mood: | nightmaregoreslasher |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | father son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboyfemale protagonistgirlserial killernursebaby …artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | body countscreamdreamsexfemale nudityf ratednuditybloodviolencebare breastssequelflashbackbare chested malegunfemale rear nudity …photographpartyknifechasesurprise endingpistolshowertelephone calltopless female nuditycryingblood splatterfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalegay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All) |
For the past 20 years, Frank Harrington has grudgingly driven his family to celebrate Christmas with his mother-in-law. This year, he takes a shortcut. It's the biggest mistake of his life: The nightmare begins. A mysterious woman in white wanders through the forest, leaving death in her wake. A ter …rifying black car - its driver invisible - carries the victims into the heart of the night. Every road sign points to a destination they never reach. The survivors succumb to panic, to madness; deeply buried secrets burst to the surface, and Christmas turns into a living hell. (Read More)
Subgenre: | black comedyghost storysupernatural horrorchristmas horror |
Themes: | marriagechristmaspregnancydysfunctional familybreak updeath of wifemadnessdeath of baby |
Mood: | nightmarenight |
Locations: | forestcarwoodscar driver |
Characters: | family relationshipsfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipbabypregnant womancrying baby |
Story: | body countmoonfemale nuditybloodmasturbationfemale rear nuditycigarette smokingsurprise endingcar accidentshotgunsecrethallucinationgay slurdream sequenceshot in the leg …gunshotdeath of brotherdeath of soncabinpornographysurvivormutilationloss of wifestrangervictimcelebrationfull moonwhiskeymale masturbationloss of sonunfaithful wifelostchristmas eveloss of brothersurprise after end creditsdead girlbarbed wirefencereference to the beatlescabin in the woodsecstasybody bagdeath of boyfriendstation wagonshockin lawsslaptime loopchristmas carolman slaps a womanman slaps womansevered earmarital crisisdead babybaby carriagegay jokegrandparentsno cellphone signalmarital discordblood on mouthdrivemarital argumentmarital strifebarbed wire fencepotato chiproad signmale wearing an earringman in blackasleep at the wheelout of gasunfaithfulgoing in circlesjingle bellsreference to marilyn mansonfractured skulldark roaddestinationchristmas vacationfalse scarepumpkin piefalling asleep at the wheel (See All) |
Worn down and out of luck, aging publisher Will Randall is at the end of his rope when a younger co-worker snatches both his job and wife out from under his nose. But after being bitten by a wolf, Will suddenly finds himself energized, more competitive than ever, and possessed with amazingly heighte …ned senses. Meanwhile, the beautiful daughter of his shrewd boss begins to fall for him - without realizing that the man she's begun to love is gradually turning into the creature by which he was bitten. (Read More)
Subgenre: | cult filmblack comedy |
Themes: | murderdeathrevengemarriageinfidelitybetrayaladulterypsychopathwealthhuntingpolice investigation |
Mood: | satiremyth |
Locations: | new york cityhotelsnowelevatorkitchenurban settingpolice stationoffice |
Characters: | husband wife relationshippolicefather daughter relationshippolice officerwriterlawyersecurity guardpolice detectivesecretaryolder man younger woman relationshipemployer employee relationshipolder woman younger man relationship |
Period: | 1990swinter |
Story: | wolfwerewolfbloodone word titlephotographtitle spoken by characterpartypantiespistolshot to deathhorseurinationslow motion scenewatching tvcomputer …brawlbookshowdownanimal in titleinterrogationhandcuffsrevolvermanhattan new york cityjournalistambulancemansiontoiletnews reporttransformationparkfired from the jobattempted rapehorse ridingpremarital sexhypodermic needlebarnloss of wifejumping from heightfull moonsevered fingerunfaithful wiferejectionzooco workermedical examinationsexy womandeerowllingerie slipphoto albumcontractfire extinguisherloss of jobhairpublishermetaphorcrisisphysicianeditorbillionaireyuppiemetamorphosisdnasense of smellstablemuggingcleaning ladywoman wearing only a man's shirtfatal attractionamuletpitchforkhypocritenew york skylinetycoonchrysler building manhattan new york citysnoringbitten in the throateast indianvermontdead brotherhowlingroadkillmuggerpreywolf packinstinctracehorseeyesightpublishing houseriding accidentlycanthropewerewolf biteprofessionfive senseswolf bite (See All) |
After a young, middle class couple moves into a suburban 'starter' tract house, they become increasingly disturbed by a presence that may or may not be somehow demonic but is certainly most active in the middle of the night. Especially when they sleep. Or try to.
Subgenre: | independent filmmockumentaryfound footagefake documentary |
Themes: | murderfearsupernatural powerpanic |
Mood: | nightmarenightdarkness |
Locations: | swimming poolkitchen |
Characters: | boyfriend girlfriend relationshipself mutilationself absorption |
Period: | 2000syear 2006 |
Story: | screamhousebloodinterviewtwo word titlebare chested malephotographknifesurprise endingfirecomputercamerawritten by directorlow budget filmdemon …guitarf wordsubjective camerabedroomvideo camerano opening creditslooking at the cameratalking to the cameraargumentcharacter repeating someone else's dialoguemicrophonescreamingsuburbfirst of seriescollege studentactor shares first name with characterdarkhauntingpremarital sexcharacter says i love youfirst partsevered armhaunted houseobscene finger gesturepsychicwhat happened to epiloguelooking at oneself in a mirrortied to a bedcrucifixspiderblockbusterladdermale underwearbarefoottime lapse photographyattichandheld cameratitle at the endraised middle fingerdemonic possessionexorcismfast motion sceneminimal castno title at beginningfilm starts with textactress shares first name with characterquarreldirector also cinematographersan diego californiafrightouija boardimplied sexscaredragging a bodyreference to george w. bushsleepwalkingtrancefootprintframed photographends with textno endingsecurity systementityaudio recordingevil forcepossessed humanunsolved mysterywatching someone sleepanimate objectslamming a doorstrained relationshiptripodbolt upright after nightmarepull upsparanormal phenomenonpowderbite markfootstepsfalling out of bedsubmissive womanbeadsvideo recorderpassivenesstorn photographraw footageawakened by alarm clockdark forceloud noiseno ending creditsno background scorefire placeinvisible beinglights turned offfilmed paranormal eventslamming doorcovivant covivant relationshipmazda miataday tradingtv static (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
Subgenre: | cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | murderdeathfriendshiprevengesurrealismkidnappingghostfearescapemonstervoyeurismpsychopathbrutalitysupernatural powerparanoia …sadismevilpanicmysterious deathshower murder (See All) |
Mood: | nightmaregorerainhigh schoolslasherdarknesspoetic justice |
Locations: | barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | family relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacher …girlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | body countscreamhousedreamcharacter name in titlenuditynumber in titlebloodmale nudityviolencesequelmale rear nuditybondagedogbare chested male …fightcigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |
It's one year later after the events of Halloween 4. Michael survives the shootings and on October 31st he returns with a vengeance. Lurking and stalking, Jamie, Rachel, and Rachel's friends, Michael forms a plan to lure Jamie out of the children's hospital where events lead up to the confrontation …at the Myers house. Halloween 5 is a dark, thrill ride that will scare the heck out of you! (Read More)
Subgenre: | independent filmslasher flickamerican horror |
Themes: | murderdeathfriendshipfearescapeevilself sacrifice |
Mood: | slasherdarkness |
Locations: | forestcarbathtubbuspolice stationpolice carrunning in the forest |
Characters: | policefrienddoctorgirlpolice officerserial killernursevillainpsychiatristuncle niece relationshipslasher killer |
Period: | 1980s20th century |
Story: | body countscreamhousecharacter name in titlenumber in titlebloodviolencesequeldoggunkissphotographexplosionpartyknife …chasesurprise endingcryingmirrorcatfalling from heightmaskrunningsubjective cameragood versus evilhalloweencandleambulancestabbingdeath of friendweaponexploding carchildanimalcoffinchild in perilpolice officer killedattempted murdertreedangercostumescreamingcharacter's point of view camera shotbracelethangingautomobilethreatneck breakingtrapratmurderersplatterhateholidayropehuggingheroinelooking at oneself in a mirrorslow motionlifting someone into the airbarnloss of friendhidingmasked manpresumed deaddeath threatpsychotronicscissorsstairsdead manfieldlaughingfifth partsequel to cult favoritekilling spreepumpkinlightsirenmasked killerdead dogreflectionserial murderpetbad guypresentyellingtablereturning character killed offlaundrydead animalold dark househuman monsterdiscoveryclimbingkittenglasslocked doorhanged mancapemasked villainpitchforkscythemass murdererliquidstabbed with scissorssittingemergencydustlight bulbpolice officer knocked unconsciousmichael myerscarrying someonelifting a female into the aircrawlingboogeymanpleadingcrying childjumpsuitunmaskingopening a windowstringcult film referencestrawpink dressserial teen killertrailer narrated by don lafontaineattempted child murderpolice officer strangulatedkilled with a forkteardropwhite maskblack masklaundry chuteevil unclehiding behind a treenew dresslifting a child into the airsecond sightcarrying a childcarrying a girllifting a girl into the air (See All) |
A newlywed couple Ben and Jane move to Japan for a promising job opportunity - a fashion shoot in Tokyo. During their trip on a dark forest road they experience a tragic car accident, leading to the death of a young local girl. Upon regaining consciousness, they find no trace of her body. A bit dist …raught the couple arrives in Tokyo to begin their new life. Meanwhile Ben begins noticing strange white blurs in many of his fashion shoot photographs. Jane believes that the blurs are actually spirit photography of the dead girl who they hit on the road, and that she may be seeking vengeance. (Read More)
Themes: | deathrevengesuiciderapeghostdrunkennessobsession |
Mood: | nightmare |
Locations: | new york cityjapanwedding party |
Characters: | husband wife relationshipphotographerjapaneseamerican abroadex boyfriend ex girlfriend relationship |
Story: | shootbodydreamsexbloodone word titleflashbackphotographsurprise endingcell phonecorpsecar accidentremakecamerafalling from height …vomitingmodelhit by a carpainstalkerelectrocutionactor shares first name with characterspiritcowboy hatloss of friendjumping from heightbrooklyn new york cityphoto shoottokyo japanmental hospitalgang rapeshadowdark pastapparitioncremationsubway stationpictureevil spirithoneymoonpolaroidx rayrazor bladeroad accidentfashion modeldarkroommysterious womanold photographnewlywednew yorkerwedding cakepublic phoneculture shockeye injurymagazine editorpiggy back ridefalling off a balconymount fujisubway ridewoman scorned (See All) |
In the heat of the summer, a lonesome house in the countryside between woods and corn fields, lives nine-year-old twin brothers who are waiting for their mother. When she comes home, bandaged after cosmetic surgery, nothing is like before. The children start to doubt that this woman is actually thei …r mother. It emerges an existential struggle for identity and fundamental trust. (Read More)
Subgenre: | cult filmsuspense |
Themes: | murderdeathmoneytorturedivorcedysfunctional familymental illnesssadismtrauma |
Mood: | nightmaregore |
Locations: | churchforestcemeterybathtubvillagewoodslakestormtwo in a bathtubrunning through the woodsboy in a bathtub |
Characters: | family relationshipsmother son relationshipchildrenbrother brother relationshipboypriestchristiancrying boyevil mother |
Period: | summer |
Story: | homehousefemale nudityf ratedviolencebare breastsbondagefemale rear nudityphotographsingingknifetelephone callfiretopless female nudityurination …face slapcatundressingbare buttmasklieprayerflashlightbound and gaggedaccidentapologychilddream sequencegraveyardstrippingactor shares first name with characterdomestic violencecountrysidegifttrapreunionsuspiciontwinarsonstrong female characterpizzasurgeryeavesdroppingidentitygamekilling an animalnipples visible through clothingwoundlooking at oneself in a mirrorrepetition in titletied to a bedcaptivetwinscrying womanaccidental deathvisitfull moontrappedcrossbowimpostorchild protagonistcharityplot twistdelusiondead childbathingbarefoot femaleduct tapefieldcellarburned to deathphoto albumfirefighterplastic surgerycockroachdoubtbugfish tankdomineering motherimaginary friendaustriacornfieldtaking a bathbare chested boyhead injurytaking off shirtlocked dooridentical twinskiller childcrying femaletrampolinehiding under a bedfirst person titlematricide11 year olddead catdistrustwatching a videomagnifying glasspsychotronic filmwet clothesaltardelivery manhouse on fireimmolationframed photographabusive motherburningcentral europelong haired malebirthmarkhysterical womanred crossbloody facebad dreamaustriansecretly observingbossy womancharacter says i'm sorrydead brotherlocked inhysterical outburstmother son reunionhead bandageaudio tapeemotional abusebad motheraudio recordinghouse arrestwalking in the raincounting moneybaby monitorestranged sonwatching someone sleepwetting oneselfchild as main characterlistening devicecosmetic surgerymoney countingseeing dead peopleson murders motherfeeding someonemysterious eventwoman directorimaginary personhailstormlooking glassnaked outdoorsestranged mothermother son conflictplaying accordiondisbelieving adultsetting a firetwin brothersnine year oldcult favoriteguessing gameemotionally unstablebandaged facepretending to sleepanimal masksinging alongaccordion playermajor child rolebrushing one's teethbossy mothergoogling for informationmother slaps sontv personalityabusive womanantagonist as protagonisthouse for saleviolent womanfood deliveryvacuum cleaningwet pantscrying for helpkilling a petthrowing water on someonewoman on firetagabused boyface injurytelevision presenteremotionally unstable womantied handscapgras delusionhair cuttingwoman bound and gaggedcutting one's haireating a bugfemale bondagehysterical motheridentical twinlying on the floorson killedwetting one's pantsfrozen foodlocked in a carsextonsinging a lullabytalking to a photographurinating into a bottlewoman tied to a bedcrazy boycutting someonemother hits sonpouring raincovering someone's mouthson hits mother (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
Subgenre: | cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
Themes: | murderdeathfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness …murder of a police officermurder of family (See All) |
Mood: | nightmaregoresatiremurder of a boy |
Locations: | hospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtrucktaxi driver …laboratorysex in shower (See All) |
Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant …jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
Period: | 1980s |
Story: | wolfwerewolfdreamsexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested male …sex scenefemale rear nuditycigarette smokingknifechasesurprise endingshowertopless female nuditycorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychessuziundergroundsupermarketno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
Rose Hathaway is a dhampir, half-vampire and half-human, who is training to be a guardian at St Vladimir's Academy along with many others like her. There are good and bad vampires in their world: Moroi, who co-exist peacefully among the humans and only take blood from donors, and also possess the ab …ility to control one of the four elements - water, earth, fire or air; and Strigoi, blood-sucking, evil vampires who drink to kill. Rose and other dhampir guardians are trained to protect Moroi and kill Strigoi throughout their education. Along with her best friend, Princess Vasilisa Dragomir, a Moroi and the last of her line, with whom she has a nigh unbreakable bond, Rose must run away from St Vladimir's, in order to protect Lissa from those who wish to harm the princess and use her for their own means. (Read More)
Subgenre: | martial artscoming of ageblack comedyteen romancevampire comedy |
Themes: | murderdeathlovefriendshiprevengesurrealismkidnappingbetrayalfeartorturedancedeceptionmagicsupernatural powerparanoia …redemptionsurveillancerivalry (See All) |
Mood: | nightmarehigh schoolhalf vampire |
Locations: | hospitalschoolchurchhelicoptermotorcyclecemeterybuswoodscaveschool teachersuv |
Characters: | vampirefather daughter relationshipteenagerfriendboyfriend girlfriend relationshipteenage girlteenage boyfemale protagonistteacherpriesttough guylove trianglewarriorbest friendbully …villainteacher student relationshipolder man younger woman relationshipvampire girl (See All) |
Period: | 2010s |
Story: | wolfdreambased on novelbloodviolenceflashbacktwo word titlekissfightphotographtitle spoken by characterpartyknifesurprise endingpistol …voice over narrationshot to deathfistfightcar accidentshot in the chestrescueslow motion scenecatarrestkissingbrawlhand to hand combatcar crashinterrogationhandcuffsclassroomgood versus evilstrangulationmountainmansionmontagestabbed to deathmixed martial artsstabbed in the chestno opening creditsdream sequencedouble crosscreatureroommatefemme fatalepantyhoseprincessnecklacetransformationon the runtraininglibrarycharacter repeating someone else's dialoguedangerstabbed in the backperson on firecover uptough girlgymdeath of brotherbodyguardbasementlaptopneck breakingqueenpowerstylized violencerunawaysisterundergroundsabotagesyringeloyaltyhypodermic needlesecurity camerajail cellmind controlaction heroinefemale warriorgirl with glassesbackpackstabbed in the throatshopping mallescape attemptmentorschool uniformlaughterwisecrack humoryoung loveprison cellgeekcrowpractical jokespelldead animalfemale teachertwist endingblack pantyhosefemale friendship17 year oldstabbed in the armfemale vampireschool principalbitten in the neckmonitorguardianoregonpsychic poweropen endedcurecelldead cattwistlesbian subtextvampirismblack dressmind readingpet catanti heroineglowing eyesmontanastrengthmagical girlmagical powerblood drinkingwriting in bloodacademyjudo throwhigh fivestakeblood transfusionrepressed memoryhidden doornunchucksexploding motorcycledeath of petstained glass windowbased on young adult novelsedativeheadmistressvampire bitecomputer discadrenalinetightspyrokinesishealing powerreference to jimmy carterrunaway teenfemale narratorhalf humanvampire versus vampirechild vampirepsychic linkwrist bandageblack tightspsychic visionroyalwriting on walltattoo on neckvampire teethlicking bloodstake through the heartvampire stakedcamera footagedrinking fountainanimal on fireteenage vampiredhampirneck bitepsychic girl (See All) |
Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl …osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)
Subgenre: | independent filmcult filmparanormal phenomenasupernatural horror |
Themes: | murderlovemarriageghostfearweddingtheftsupernatural powerparanoiasurveillanceevilpanicpolice investigationmurder of family |
Mood: | nightmare |
Locations: | barchurchmotorcyclecatholic church |
Characters: | husband wife relationshippriestterrorcatholic priest |
Period: | 1970s |
Story: | screamhousedreamsexfemale nuditybloodflashbackdogthree word titlepantiesbased on bookshotgunvomitingbeerplace name in title …demonriverbedroomaxeambulancetoiletwhite pantiesnunvanparktreelibrarycurseattacklightningcrosshauntingfirst parthaunted housechild murderoccultfireplacegothicbabysitterlifting someone into the airagingcrucifixbeardblockbustergrindhousemale underwearreincarnationstairsthunderstormdemonic possessionbriefswedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgirl stripped down to pantiesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storycamel toeremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | independent filmcult filmblack comedypsycho thrillersadistic horror |
Themes: | murderdeathfriendshiprevengesuicidekidnappingrapebetrayalfeartortureescapedeceptionseductionangerpsychopath …death of fatherbrutalitydeath of motherparanoiainsanityhumiliationsadismevilexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All) |
Mood: | nightmaregoreambiguous ending |
Locations: | barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitutepolice officerserial killernurse …hostagetough guyvillainmaidsheriffterrorpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All) |
Period: | 1970syear 1978 |
Story: | body countschedulehousedreambloodviolencesequelflashbackmale rear nuditydogbare chested malesex scenefemale rear nudity …female full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifechasepantiespistolshowerfireshootoutwoman on topbeatingcorpseshot to deathblood splattermachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttvomitingshowdownrifleheld at gunpointbeersecond partdead bodylow budget filminterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationaxedeath of frienddrug dealerthroat slittingimpalementcocainestabbed to deathstabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathstabbed in the backscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armobscene finger gesturewhippingcult directorcowfreeze framestylized violencemaniachead buttmass murderlooking at oneself in a mirrorscene during opening creditsragecowboy hatstabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalmercilessnessstabbed in the neckbutcherescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecueaxe murderranchsexual assaultsevered legkilling spreedeath of loved onefemale in showernewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointpervertserial murderpsychopathic killerreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripshot in the neckspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffhomicidal maniacvulgarityfemale psychopathtrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womanfemale villainsole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsknife murderbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemurder spreemass murdererbutcherygrindhouse filmevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnffemale serial killersexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | independent filmcult filmslasher flickteen horroramerican horror |
Themes: | murderdeathrevengefeardeceptionpsychopathsurveillanceevilmurder of a police officer |
Mood: | goresatireslasher |
Locations: | forestwoodskitchenwheelchairrooftopfire truck |
Characters: | teenage girlteenage boyserial killernursekillersecurity guardvillainpsychiatristslasher killercoroner |
Period: | 2000s |
Story: | body counthomehousefemale nuditybloodviolencesequelflashbacktwo word titlefightknifechasesurprise endingfire …cell phonecorpseblood splatterfistfightmirrorwatching tvcomputercameraundressingbrawlfalling from heightmaskshowdownf wordsubjective cameradecapitationgood versus evilhalloweenfoot chaseflashlightstrangulationaxeambulancemontagethroat slittingimpalementstabbed to deathstabbed in the chestinternetsevered headpolice officer killednews reportstabbed in the backelectrocutioncharacter's point of view camera shotproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armobscene finger gesturekillingmaniacchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolineaxe murdercasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexserial murderpsychopathic killervideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamhomicidal maniacclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Subgenre: | cult filmconspiracytragedyasian horror |
Themes: | deathlovefriendshipsurrealismsuicidebetrayalghostjealousypoliticsmemorybrutalityobsessionparanoiacancerredemption …guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
Mood: | nightmareraindownward spiral |
Locations: | small townbuselevatorvillagewheelchairrooftop |
Characters: | childrenboyfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship |
Story: | homehousef ratednumber in titlebloodviolenceinterviewflashbackfightcigarette smokingphotographsurprise endingpunctuation in titlecryinghorse …mirrorremakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontageaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicionhaunted housecult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydead childdeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
Subgenre: | independent filmcult filmsuspenseslasher flickaustralian horrorsadistic horror |
Themes: | murderdeathkidnappingrapedrinkingfeartorturedrunkennessescapepsychopathbrutalityinsanitysadismevilabduction …exploitationcruelty (See All) |
Mood: | nightmaregorecar chasenightslasherdarknessblood and gore |
Locations: | barbeachrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie …australian outbackcar on fireshed (See All) |
Characters: | husband wife relationshipdoctorsingerserial killerhostagekillervillainaustralianterrorself mutilationslasher killermysterious villainserial murderermysterious killer |
Period: | year 1999 |
Story: | body countwolfbloodviolencedogtwo word titlegunkisscigarette smokingphotographtitle spoken by characterexplosionsingingpartyknife …chasebased on true storysongcorpseshot to deathblood splattercar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkvomitingrifleheld at gunpointsunglassesdead bodylow budget filmcafebathroomvoyeurguitarshot in the backf wordswimminggay slurflashlightbound and gaggedmassacrevideo camerastabbingimpalementstabbed to deathfalse accusationcontroversyvanpainflash forwardattempted murderdangerstabbed in the backprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererfirst partobscene finger gesturedismembermentufokillinggaragemaniacpickup truckwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencepsychostrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingermercilessnessgunshot woundbroken glassbutcherfallblood on shirtperversionrainstormslaughtercapturecliffminetied feetopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathpsycho killerdrugged drinkreflectionpervertserial murderpsychopathic killerbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardshot in the neckhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violencehomicidal maniacslashingplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootknife murderwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermurder spreemass murdererdriving at nightvillain not really dead clichedisturbed individualbutcherygrindhouse filmexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationpsycho terrorwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All) |
In 1765 something was stalking the mountains of central France. A 'beast' that pounced on humans and animals with terrible ferocity. Indeed they beast became so notorious that the King of France dispatched envoys to find out what was happening and to kill the creature. By the end, the Beast of Gevau …dan had killed over 100 people, to this day, no one is entirely sure what it was, wolf? hyena? or something supernatural? Whatever it was, shepherds had the same life-expectancy as the red-suited guys in 'Star Trek'. The Beast is a popular myth in France, albeit one rooted firmly in reality; somewhat surprisingly it is little known to the outside world, and perhaps incredibly it has never been made into a movie. Until now... Based on the true story of the Beast of the Gevaudan that terrorized France in the mid-XVIIIth century, the movie aims to tell first and explain afterwards. In the first part, a special envoy of the King of France, altogether biologist, explorer and philosopher, arrives in the Gevaudan region, in the mountainous central part of France. The Beast has been attacking women and children for months and nobody has quite been able to harm it or even take a good look at it. In the second part, our hero Chevalier de Fronsac will not only have to fight the Beast, but also ignorance, bigotry and conspiracy and will rely on two women, one an aristocrat, the other a prostitute, as well as the enigmatic Mani, an Iroquois he met in New-France (Canada). (Read More)
Subgenre: | martial artsconspiracytragedycreature featuredark fantasyswashbuckler |
Themes: | murderrevengerapereligionmonsterincestsupernatural powervengeance |
Mood: | nightmaregorerain |
Locations: | forestsnowfrancebrothel |
Characters: | friendtattoowarriornative americanamerican |
Period: | 18th century |
Story: | wolfwerewolffemale nuditybloodviolencefemale frontal nudityflashbackdogfemale full frontal nuditynipplesvoice over narrationwoman on topblood splattermirror …swordmaskhand to hand combatanimal in titlegood versus evilsword fightaxethroat slittingimpalementmixed martial artscreatureshot in the foreheadone against manylegendcurseportraitlightningstylized violencecard gamegothiclooking at oneself in a mirrorcagetold in flashbackcrucifixwitchcraftsevered handskulltorchanimal attackgoatreverse footagetarget practicecrossbowstabbed in the throathit in the crotchcard playingaerial shotfortune tellerpumpkinfolkloresecret societyfalling into waterbeastanimal abusenaked dead womanpart computer animationmusketpitchforkpsychotronic filmepilepsyincestuous desirebludgeoninghatchetflintlock rifleflintlock pistolpainted faceflaming arrowfuneral pyretaxidermyextreme closeupilluminatibad smellcruelty to animalone armed manharpsichordrotting corpseeviscerationpulpithowl1760sbrignegative footagecostume horrorfree thinkinghansom cabspinning axethrown from a cliffsecret plotbeauty markflintlockiroquois indianupstartartistic imageryhot bathpowdered wigtricorne (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | murderdeathfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of motherinsanitysadismevil …unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | nightmaregorecar chasenightslasherdarknessblood and gore |
Locations: | hospitalforestbathtubwoodsrural settingroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendboybrother sister relationshipteenage girlfemale protagonistserial killerstudentbest friend …killervillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | body counthousedreamfemale nudityf ratedbloodviolencebare breastsfemale frontal nudityflashbackmasturbationdoggun …cigarette smokingphotographknifelesbian kisschasesurprise endingshowertelephone callcorpseblood splattercar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightbound and gaggedaxemassacrestabbingthroat slittingimpalementstabbed in the chestsevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmateaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder …s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horror |
Themes: | murderdeathrevengefearpsychopathbrutalityinsanitysadismevilexploitationpolice investigation |
Mood: | nightmaregorerainnightslasherdarkness |
Locations: | cemeterysmall townwoodsamericabackwoods |
Characters: | policemother son relationshipteenagerbrother brother relationshipserial killerkillervillainsheriffterrorslasher killermysterious villainserial murderermysterious killercountry boy |
Period: | 1980s |
Story: | body counthousesexfemale nuditynumber in titlebloodviolencebare breastssequelfemale frontal nuditykissdancingchasesurprise endingpanties …digit in titleblood splatterdead bodylow budget filmnumbered sequelsubjective cameradecapitationsword fightaxemassacrethroat slittingimpalementchild in perilgravestalkercharacter's point of view camera shotevil mandeath of brotherstalkingdeath of sonmurdererobscene finger gesturekissing while having sexmaniacchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachpsychogrindhousevictimmasked manmental institutionrampagerednecknew jerseyitalian americanbutcherpsychotroniceye gougingslaughterstabbed in the eyeaxe murdercharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerpsycho killerserial murderpsychopathic killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstersummer camphomicidal maniaccomic relieftombstoneslashinghillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villainknife murdercut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmmurder of a nude womanmurder spreedisturbed individualbutcherygrindhouse filmdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicidepsycho terrorweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musiceast coastgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All) |
A young woman, desperate to help her sickly brother, accepts a dinner invitation to what seems to be easy money. As soon as she arrives to dinner, she realizes that playing the "game" is deadly for its losers. She and several others spend the night being terriorized in a game of would you rather.
Subgenre: | slasher flickpsychological thriller |
Themes: | murderdeathsuicidemoneytorturepsychopathcancersadismwealth |
Mood: | slasher |
Locations: | water |
Characters: | father son relationshipdoctorbrother sister relationshipsoldierself mutilationdriversuicide by pills |
Story: | body countdesperateguntitle spoken by charactersurprise endingpistolshowershot to deathblood splattershot in the chestshot in the headheld at gunpointstabbed to deathdrowningbeaten to death …electrocutionattempted rapedeath of brothercontestthreatwhippingheart attackgameinjurysevered handveteranpillsbraverywhipescape attemptbutlerstabbed in the legvegetarianeye gougingcharacters killed one by onetabledinner partymake upsarcasmprizeleukemiaman punching a womanrazor bladewheelchair boundbleeding to deathshockcountdownchoicesole survivorinvitationfirecrackerdisableddinner tablerecovering alcoholictimerordersteakgame of deathplasticbreaking inwealthy familyphilanthropistholding breathholding one's breath underwatervictim invited to dinnermascaraholding one's breathholding someone's head underwatercountdown timermascara runningstabbed with an ice pickdunking head in waterhead dunked in waterforced eatingcountdown clockeye slitting (See All) |
Shadow of the Vampire is a film about the making of a German all time classic silent horror-movie from 1922 called Nosferatu-Eine Symphonie des Grauens (Nosferatu-a Symphony of Horror). The production of Nosferatu had to deal with a lot of strange things (some crew members disappeared, some died). T …his movie focuses on the difficult relationship between Murnau, the director, and Schreck, the lead actor. (Read More)
Subgenre: | independent filmcult filmgothic horrorsilent filmmaking |
Themes: | murderdeathmonsterfilmmakingobsessionparanoiaillnessgerman filmmaking |
Mood: | satirebehind the scenes |
Locations: | castlecave |
Characters: | vampireactoractressfilmmakerfilm director |
Period: | 1920s |
Story: | film crewfemale nuditybloodshot in the chestcamerastrangulationcoffinfilm within a filmneck breakingactingmaniacberlin germanydesirehypodermic needle …drug abuseimpersonationbald mantensionfilm producerscreenwriterfilm industrydraculafilm actressinfatuationteethcinematographereastern europemorphineczechoslovakiabitten in the throatbaldnessgerman accentbreast massagedeliberate crueltybloodlustnosferatulaudanumflying batnegative footagecostume horrorlong fingernailsreference to bram stokerpointy earsreference to stanislavskyreference to max reinhardt (See All) |
In December 1975, George and Kathy Lutz along with their three children move into an elegant Long Island house. What they don't know is that the house was the site of a horrific mass murder a year before. They decide to keep the house and attempt to keep the horror in the past, but are now haunted b …y a murderous presence. This is until, George starts to behave weirdly and their daughter, Chelsea starts to see people. What follows is 28 days of sheer, unbridled terror for the family with demonic visions of the dead. Based on the true story of George and Kathy Lutz, The Amityville Horror remains one of the most horrifying haunted house stories ever told - because it actually happened. (Read More)
Subgenre: | ghost story |
Themes: | murderdeathsuicideghosttortureparanoiainsanitymurder of family |
Mood: | nightmarearchive footagehorror movie remake |
Locations: | restaurantbathtubkitchenrooftop |
Characters: | family relationshipshusband wife relationshipmother son relationshipmother daughter relationshipteenage girlteenage boypriestlittle girllittle boycatholic prieststepfather stepdaughter relationshipstepfather stepson relationship |
Period: | 1970s |
Story: | screamhousesexbased on novelblooddogbare chested malegunchasepantiesblood splatterurinationremakeshot in the headshotgun …slow motion scenefalling from heightvomitingrifleplace name in titlemarijuanashot in the backaxethroat slittingsuicide attemptchild in perilshot in the foreheadattempted murderpossessionbasementunderwaterhaunted housenewspaper headlinechild murderoccultpot smokingkilling an animalbabysittercovered in bloodteddy bearfamily dinneraxe murderdemonic possessionalarm clockdead dogdead girlreal estate agentbonghead woundmotorboatpotbullet woundmoving inrealtorholy waterbloody body of a childchild killedtortured to deathtorture chamberfamily in dangerbased on supposedly true storyabusive stepfatherable to see the deadwood choppinglocked in a closetchild shotmeat hookburial groundchild shot in the headboathousechild knocked unconsciouslakesidehole in the wallhanged childvillage name in titlebackwardsdeath of a petinsect attackwalking on a roofancient burial groundrefrigerator magnetmonster in mirrorupside down crucifix (See All) |
The first remake of the paranoid infiltration classic moves the setting for the invasion from a small town to the city of San Fransisco and starts as Matthew Bennell notices that several of his friends are complaining that their close relatives are in some way different. When questioned later they t …hemselves seem changed as they deny everything or make lame excuses. As the invaders increase in number they become more open and Bennell, who has by now witnessed an attempted "replacement" realises that he and his friends must escape or suffer the same fate. But who can he trust to help him and who has already been snatched? (Read More)
Subgenre: | conspiracy |
Themes: | murderfriendshipmarriageescapeparanoiadatingsurveillance |
Mood: | horror movie remake |
Locations: | restauranttaxisan francisco california |
Characters: | policealienwriterpsychiatristbiologist |
Story: | bodyscreamfemale nuditybased on novelflashbackdogchasesurprise endingfireremakerescuejoketransformationflowercold war …sabotagebreaking and enteringhypodermic needlenosebleedplanetalien invasiondentistplaygroundstabbed in the neckdoppelgangerhit and runharbortelephone boothlost lovesleepparasitegarbage truckcold war erastairwellbanjodartremadeamazing grace hymnhorror movie remadepodneoliberalismhuman duplicationturkish bathhealth inspectortransamerica pyramidcapgras delusionalien infiltrationbook partychinese laundry (See All) |
Waking up in a undisclosed location in a unknown room two men, adam and gordon are trapped into a single room with a dead body. Given random tools with riddles hidnen around the room. Wondering who could have done this there are clues to who might of done it; the jigsaw killer. The question is not j …ust who but why would a serial killer leave two men in a room. Both adam and gordon hiding secrets they must trust and work together to get out or die...can they survive jigsaws game or die trying? (Read More)
Subgenre: | independent filmcult filmslasher flicksurvival horrorsadistic horror |
Themes: | murderkidnappingmarriageinfidelitytortureescapeextramarital affairpsychopathcancerinsanityhome invasionclaustrophobiaself harm |
Mood: | gorecar chaseslasher |
Locations: | hospitalhotelurban setting |
Characters: | husband wife relationshippolicefather daughter relationshipdoctorserial killerdetectivephotographerhostagekillerpolice detectiveself mutilation |
Story: | body countbodyviolenceone word titleflashbackgunsurprise endingpistolcorpseshotguncamerasecretbathroomrevolverbound and gagged …throat slittingstabbed to deathtoiletchild in perilpolice officer killedclownpuppetperson on firepoisonfirst partburned alivegothicslow motiontape recorderblockbusterparking garageblack humorbarefootcrime scenetrappeddisembowelmentbooby trapextortionimprisonmentvideo surveillancehiding in a closetrestroompolaroidmind gameelectric shockamputationbased on short filmsawaudio cassettechainedextreme violencemacabredarkroomtwo way mirrorpsychological torturelocked in a roomflashback within a flashbacksevered footvillain not really dead clichebludgeoningbear trappretending to be deadrepentanceevil dollorderlyforced suicidegame of deathchild in dangerdeath trappig maskbad guy winsplaying godtrapped in a roomdioramavillain escapeswalking on broken glassfamous theme (See All) |
Ellie has been taking care of her younger brother Jimmy since their parents death. One night after picking him up from a party they are involved in a car accident on Mullholland Drive. While trying to rescue a woman from the other car a creature attacks and kills her, also injuring both Ellie and Ji …mmy. After some research Jimmy realizes the creature could only have been a werewolf. (Read More)
Subgenre: | independent filmcult filmblack comedysuspenseabsurdismcreature featureteen movieteen horrormonster movielgbt horror |
Themes: | murderdeathrevengesurrealismjealousyfeardrunkennessescapemonsterseductionsupernatural powerparanoiawrestlingrivalryhome invasion |
Mood: | nightmaresatirehigh school |
Locations: | barlos angeles californianightclubelevatorpolice carofficemuseumfire truck |
Characters: | homosexualpoliceteenagerboyfriend girlfriend relationshiptattoobrother sister relationshippolice officerlove trianglebullysecurity guardgay teenagergay friendmythical creature |
Period: | 2000s |
Story: | wolfwerewolfnuditybloodmale nudityviolenceone word titlemale rear nuditydogbare chested malekissfemale rear nudityfightphotographtitle spoken by character …partyknifechasesurprise endingpistolcell phonebeatingcorpseshot to deathfistfightcar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the faceswordbrawlbare buttfalling from heightshowdowncar crashdead bodybathroomdecapitationfoot chasegay slurorphanambushcaliforniamassacreambulancestabbed to deathdinerstabbed in the chestinternetsevered headhit by a carcreaturenews reporttransformationshot in the foreheadpublic nuditylimousinecursecoming outelectrocutionattackproduct placementknocked outkicked in the faceshot in the shoulderscargymhigh school studentcheerleaderbasementcharacter says i love youobscene finger gesturecult directorgaragepizzaactor playing himselflooking at oneself in a mirrorscene during opening creditscatfightcomic bookhollywood californiakicked in the stomachvillainessnosebleedclubparking garagecarnivalanimal attackeaten alivefull moonrampagecameoblood on facestabbed in the throatpower outagegash in the faceevacuationco workerescape attemptpunched in the chestthrown through a windowbody landing on a carcanepierfortune tellergeekwrestlerfirefighterwebsitesuper strengthpicturebully comeuppancehearing voicescostume partyexhibitionistferris wheelhollywood signsense of smellwoman kills a manjockhead cut offhit with a shovelwoman fights a manshapeshiftingcut into piecesvending machinepentagramdog attackoff screen murdercar rolloveranimal killinglifting person in airglowing eyesexhibitiontv stationwomen's bathroomtalk show hosthuman becoming an animalcar wreckfairgroundrescue attemptpepper sprayhomophobedead parentsgalahowlingwoman hits a mangay jokesilvertroubled productiongay athletepublicistlycanthropypalm readingcuckoo clockwolfmanfemale werewolfraw meatbroken dishbathroom stallhall of mirrorsgoogling for informationlycanthropeburning bodycar off bridgewerewolf bitebitten in the handhigh school wrestlingwalking on the ceilingbitten in the armbroken elevatormulholland driveevil markcoming out to girlfriendbloody scratchescapitol records building hollywood (See All) |
Driving through the backwoods of Texas, five youths pick up a traumatized hitchhiker, who shoots herself in their van. Shaken by the suicide, the group seeks help from the locals, but their situation becomes even more surreal when they knock on the door of a remote homestead. It's quickly apparent t …he residents are a family of inbred psychopaths, and the unlucky youths suddenly find themselves running for their lives. In hot pursuit is a disfigured, chainsaw-wielding cannibal known as Leatherface. (Read More)
Subgenre: | independent filmsadistic horror |
Themes: | murderdeathsuicidekidnappingtorturepsychopathbrutalityinsanitysadismpolice brutality |
Mood: | goreslasherhorror movie remake |
Locations: | barbathtubwheelchairpolice carroad tripgas station |
Characters: | policemother son relationshipboyfriend girlfriend relationshippolice officerserial killercrying babyevil sheriff |
Period: | 1970s |
Story: | body countmoonbloodviolenceknifesurprise endingvoice over narrationblood splatterremakeshot in the headinterrogationpianotelephoneaxeimpalement …severed headno opening creditshit by a carpolice officer killedlocker roomevil manpigbasementchickendirectorial debutsevered armobscene finger gesturecowdismembermentmaniacchainsawfalling down stairspot smokingnipples visible through clothingheavy rainlifting someone into the airgroup of friendscowboy hatmutilationhomicidefull moonsevered fingerthrown through a windowdisfigurementalienationtank topmasked killernewspaper clippingbarbed wirecar troublecrucifixionhuman monstersexual perversionterritory name in titletrailer homehillbillymercy killingwhite trashmeat cleaversewing machineshot through the mouthwet t shirtmasked villainslaughterhousesole survivorsaltsevered footstupid victimtruckersevered eargas station attendantclothes linesmall town sheriffbodily dismembermentobese womanpinatasevered faceforensic evidenceanthropophagusone armed manremake of cult filmbody in trunkvolkswagen buslock pickmeat hookchainsaw murderteeth knocked outhole in the wallhung from a hookrotten teethleatherfacebased on ed geinsevered nosechewing tobaccogroup of fiveharbinger of deathabandoned millmeat processing factoryobject made of body partobject made of human skintool in title (See All) |
In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel … Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)
Subgenre: | suspensegothic horror |
Themes: | murderdeathfriendshiprevengesuicidebetrayalghostdrinkingfearsupernatural powergriefadoptiondeath of wifevengeanceforgiveness …madnessdeath of daughterafterlifedeath in childbirth (See All) |
Mood: | nightmarerainhorror movie remake |
Locations: | beachtrainforestcarbathtublondon englandvillagewoodsrural settingengland |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboygirlsister sister relationshipreference to godlittle girllittle boysingle fathersuicide by hangingbaby boy …ghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All) |
Period: | 1910s |
Story: | manor housemanorhousebased on novelbloodviolenceflashbackdogphotographfirecryingcorpsefoodmirrorrescue …slow motion scenedrinksecretletterpaintingtearsrunningdead bodycolor in titletelephonenewspapercandleaxemansioneatingwidowaccidentdrivingchildbirdcoffindrawingsearchjourneygraveyarddrowningflash forwardgravecurseprologuescreamingkeywidowerperson on firedolldeath of childskeletonhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepinghaunted housesingle parentfireplacelooking at oneself in a mirrorcrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardlostthunderstormsuperstitiondead childatticfogmurder of a childvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingwriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All) |
The church has long known that vampires exist. However, it is discovered that a group of vampires are searching for a powerful doom for mankind. The Vatican then secretly enlists a team of vampire-hunters, led by Jack Crow, to hunt down and destroy the vampires before they find the crucifix.
Subgenre: | martial artscult filmblack comedychristian horror |
Themes: | murderdeathrevengekidnappingbetrayalprisonfeartorturedrunkennessdeceptionvoyeurismangersupernatural powerpanicvengeance …murder of a police officerghost town (See All) |
Mood: | gore |
Locations: | bartrainchurchhotelsmall towndesertelevatormotelgas stationcampfirenew mexico |
Characters: | vampireprostitutepolice officerpriesthostagetough guyaction heroevil priest |
Period: | 1990s |
Story: | wolfscreamfemale nuditybased on novelnuditybloodviolenceone word titlebare breastsfemale frontal nudityfemale rear nuditycigarette smokingphotographtitle spoken by character …explosionpartyknifechasepistolfiretopless female nuditybeatingcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeface slapshotgunrescueslow motion scenepunched in the faceshowdownheld at gunpointcar crashinterrogationprostitutionvoyeurprayerrevolvershot in the backsubjective cameradecapitationgood versus evilcleavagegay slurbound and gaggedaxemassacreambulancethroat slittingimpalementstabbed to deathmixed martial artssuicide attemptstabbed in the chestmapsevered headanti heroscantily clad femaleritualsearchnews reportcigar smokingshot in the legtransformationshot in the foreheadpaingunshotlegendbinocularscharacter repeating someone else's dialoguestabbed in the backperson on firemini skirtpay phonecharacter's point of view camera shotmissionknocked outlightningshot in the shoulderpursuitcrossexploding bodyneck breakingtied upmercenaryshot in the armcult directorundeadpickup truckmachismoburned aliveno pantiesspearfarcemass murderjeepinjuryscene during opening creditsmutilationtied to a bedsecurity cameracrucifixhammerexploding buildingbuttocksphone boothsevered handskulleaten alivewatching televisionduct tape over mouthvisionthundercrossbowteamshot in the facehungershovelimmortalitycigarette lighterthrown through a windowslaughtergasolinelens flareburned to deathexorcismtelepathytorso cut in halfceremonystolen carsunsetcrucifixiongatebandagespit in the faceold dark housesuper strengthnudedisposing of a dead bodyfemale vampiregunslingernude girlbellsawed off shotgunlatinbitten in the neckman punching a womansunrisewindmillcarjackingriteiconvampire huntermind readingreliccamera focus on female buttvampire slayerfalling through the floorthroat rippingblood drinkingsuper speedsliced in twocardinal the priestnestarmored truckbitten on the armhand through chestmusic score composed by directorcablesteakstabbed in the heartburnt handstabbed in the foreheadover the topvampire bitevampire human lovemurdered priestcorrupt priestwooden stakebitten on the legpetrolvampire human relationshipfrenzysexy female vampirecauterizationmaster vampirenude woman tied uppadrerear end (See All) |
A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu …e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)
Themes: | murderdeathrevengesuiciderapetorturepsychopathinsanityevilcannibalismrape and revenge |
Mood: | goreslasher |
Locations: | desertwaternew mexico |
Characters: | serial killervillainterrorslasher killer |
Period: | year 2007 |
Story: | body countshootfemale nuditynuditybare breastssequelfightexplosionsurprise endingpistolfirelickingcorpseshot to deathblood splatter …shot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurstabbingarmyimpalementstabbed to deathstabbed in the chesttrainingbeaten to deathstabbed in the backevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplattermaniacropeclaim in titlemutantrageassaultaccidental deathpsychobroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingmineaxe murderkilling spreenude woman murderedpsycho killertorso cut in halffemale soldierblood on camera lensintestinesserial murderpsychopathic killergiving birthbad guymadmanhuman monsterstrandedsexual violencehomicidal maniacstabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillgrindhouse filmbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All) |
In 1977, paranormal investigators Ed and Lorraine Warren travel to London, England, where single mother Peggy Hodgson believes that something evil is in her home. When Peggy's youngest daughter starts showing signs of demonic possession, Ed and Lorraine attempt to help the besieged girl, only to fin …d themselves targeted by the malicious spirits. (Read More)
Subgenre: | supernaturalparanormalparanormal phenomenaparanormal investigationparanormal activity |
Themes: | lovechristmasghostfeardeception |
Locations: | london englandengland |
Characters: | husband wife relationshipteenage girlpriestlittle girlsingle mothercatholicterror |
Period: | 1970syear 2003year 1976 |
Story: | homescreamhousesequelinterviewbased on true storyshot to deathpaintingsecond partdemonaxenunno opening creditschild in periltransformation …screamingpossessiontentchristmas treecrossbasementhauntinghaunted housepsychicrecord playertape recorderrecordingtied to a bedcrucifixnosebleedwatching televisionarchival footagethunderstormchairdemonic possessionteleportationreference to elvis presleynarrated by characterlevitationseancebroken windowcatholicismpremonitionsoccer ballouija boardwoman smokerphonographends with biographical notesstarts with narrationrosaryjumping out a windowsing alongarchival photographscreaming in fearfalse teethmale singerjumping ropebreaking down a doorbased on supposedly true storyvideo recordingstutterconvulsiontalking to the deadspeech impedimentdriving in the rainswing setparanormal investigatorjump scareskepticdenturespsychokinesisvoice recordingsprayed with watercrucifix pendantbite markfalling out of bedblurry visionhiding under the coverslocked in jailwoman screamingbegins with historical notesrosary beadsspecterhavocstuttering charactertelevision statictoy truckchild shot in the backparanormal experthyperventilatingbrick thrown through a windowdownpourflooded basementupside down crossamityvillesitting on a swingzoetropepulled underwaterspeaking in another voiceupside down crucifixflickering lightstalkshow (See All) |
On a remote island, the FBI has a training program for their psychological profiling division, called "Mindhunters", used to track down serial killers. The training goes horribly wrong, however, when a group of seven young agents discover that one of them is a serial killer, and is setting about sla …ying the others. Can the few that are left figure out who the killer is in time? (Read More)
Themes: | murderdeathtortureparanoiagamblingpanicghost townfear of water |
Locations: | barbeachhelicoptersnowbathtubelevatorkitchenwheelchairsex in showerboat explosion |
Characters: | tattooserial killerteacher student relationship |
Period: | winter |
Story: | body countscreambloodmale nudityone word titleflashbackmale rear nuditykisscigarette smokingphotographsurprise endingpistolshowershot to deathblood splatter …fistfightmirrorshot in the chestshot in the headslow motion scenecomputercatfalling from heightsunglassesbombinterrogationhandcuffsislanddecapitationthroat slittingdinerstabbed in the chestbrunettesevered headdouble crossunderwater scenedrowningcoffeetrainingfbiopening action scenebasementtrappremarital sexsuspicionlove interestkissing while having sexrevelationsociopathloss of friendfbi agentwristwatchback from the deadfloodfogbulletproof vestbetsevered legcharacters killed one by onelasersightarrowpigeonmannequinfast motion scenemale in showertorso cut in halfdead dogvideo surveillancegroupfire extinguishershot in the neckdead animalblackoutacidponytailsimulationrainingsleeping in a cartomatoshot in the throatlighting a cigarettemaggotbettingdead catbutcher knifearmoryloudspeakerman in a wheelchairexploding boatdisabledcrossword puzzlewriting in bloodrubik's cubemost dangerous gamepuppeteeruh 1 huey helicoptercrime scene photographforensic evidencekilled in an elevatorstopwatchblood sampledecapitated headloud shirttwo in a showersplit lipunderwater fighthandcuffed to a pipedominoesliquid nitrogentrip wiresecret relationshipbeheadedprofilerwall clockbobble head dollspeed of lighttraining exercisefbi profilerhouse catmisfiring gundomino falltoy duckdrugged coffeefbi traineewool hatmilitary facilitydeath of co worker (See All) |
The Creeds have just moved to a new house in the countryside. Their house is perfect, except for two things: the semi-trailers that roar past on the narrow road, and the mysterious cemetery in the woods behind the house. The Creed's neighbours are reluctant to talk about the cemetery, and for good r …eason too. (Read More)
Subgenre: | cult filmtragedy |
Themes: | murderdeathsuicideghostfuneralmagicangersupernatural powerdeath of mothergriefdeath of wife |
Mood: | nightmaregorenightdarkness |
Locations: | hospitalschoolchurchcarcemeteryairplanebathtubairportwoodsrural settingtrucknew england |
Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother sister relationshipzombiepriestlittle girllittle boysuicide by hangingfather in law son in law relationshipdeath of boy |
Period: | 1980s |
Story: | moonhousedreambased on novelbloodviolenceflashbackdogphotographexplosionsurprise endingfiretitle directed by femalecorpserescue …punched in the facewatching tvcatsecrettearsbedbathroomneighbortelephoneflashlightold mandeath of friendwomanweaponchildcoffinpantyhosepainconfessiongraveperson on firehangingdeath of brotherautomobiledeath of sonloss of fatherloss of motherarsonfemale stockinged legsburned alivegothicinjurylifting someone into the airhatloss of friendtoyhidingloss of wifedead womanback from the deadhitchhikingcamera shot of feetpromiseloss of sonpet dogresurrectionshovelpsychotronicdead childdeath of sisterdead mandead boydead motherloss of brotherflat tirefemale stockinged feetpetdead animalsenior citizenfoot closeupscalpelhit by a truckhead injuryloss of childkitenooseloss of sisterkiller childmurder of wifeorchestral music scorehiding under a bedintentionally misspelled titledead catdead wifeanguishmainesuicide noteswinginghouse firepet catdeath of loverglowing eyesevil childairlinerscreenplay adapted by authorpick axepathclothes linedeath of parentloss of lovervisionsemaciationdeath of petlifting a female into the airconvulsionhanged womanauthor cameobased on the works of stephen kingdead songrave robbingkilling a catchild in dangerkite flyingdead ratlifting a male into the airson murders motherburial groundmusic score features pianoloss of petloss of parentatonal music scorecobwebtractor trailerwendigobumper stickerdeath of catsymphonic music scoredead loverevil cattree swingdeath of grandsondeath of womanmurder of lovercat attackdead parentdeath of patientpet cemeteryraking leaveschelsea smiledeath of relativetire swingelongated cry of nodeath of neighborindian burial groundlifting a boy into the aircat hissinglifting a child into the airdead petunholy resurrectionfeeding a catmurder of neighborcat scratchlifting a girl into the airloss of relativescratched by a catzombie cat (See All) |
A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.
Subgenre: | cult filmparanormal investigation |
Themes: | ghostvoyeurismsupernatural powerdysfunctional familyafterlifemissing childscience versus supernatural |
Mood: | moving |
Locations: | swimming poolcemeterykitchen |
Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship …blonde girl (See All) |
Period: | 1980s |
Story: | homehouseone word titleinterviewpantiescorpsemirrorblondewatching tvcameralingeriemarijuananeighborhallucinationvoyeur …televisiongood versus evilcleavagevideo camerawhite pantiesscantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingfirst parthaunted houseobscene finger gesturecult directorpsychicgirl in pantiespot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All) |
In Japan, when the volunteer social assistant Rika Nishina is assigned to visit a family, she is cursed and chased by two revengeful fiends: Kayako, a woman brutally murdered by her husband and her son Toshio. Each person that lives in or visits the haunted house is murdered or disappears.
Subgenre: | supernaturaljapanese horror filmsupernatural horrorasian horror |
Themes: | murderdeathsuicidemarriageghostfearangersupernatural powerparanoiasadismcrueltypanictraumamurder investigationmurder of a police officer …missing childmysterious deathpsychological trauma (See All) |
Mood: | goredarknessmurder suicide |
Locations: | hospitalrestaurantschoolelevatorwheelchair |
Characters: | policemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteacherpolice officerpolice detectiveghost girlmysterious girlghost in mirrorghost boy |
Story: | homehousebloodflashbackphotographshowercorpseremakewatching tvcatbedbedroomnonlinear timelinebrunettesearch …old womanpainscreamingpossessionthreatsuspicionfirst parthaunted housearsonmass murderragemutilationdesperationvisitteddy beardead womansufferingsonstairsatticgasolinesocial workerpsychoticvideo surveillanceclosetdark secretlong hairstairwayevil spiritrestroomblood stainpremonitionwrathmysterious womanmultiple murderchapter headingstenantblack catcrime investigationhusband murders wifemurder victimdeeply disturbed personmultiple homicideghost childremadehorror movie remadecatatoniamystery womansakewraithfear of ghostsretired copwoman journalisthomicidalhome care (See All) |
Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on …e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)
Subgenre: | independent filmcult filmpsycho thrilleramerican horrorindependent horror |
Themes: | murderdeathdrugsrapetortureincestpsychopathbrutalityinsanityevilexploitationmurder of family |
Mood: | goreslasher |
Locations: | chicago illinois |
Characters: | brother sister relationshipprostituteserial killerkillervillainterrorslasher killermysterious villainserial murderermurder of a prostitute |
Period: | 1980s |
Story: | body counthomefemale nuditycharacter name in titlenuditybloodviolencebare breastsgunsurprise endingshot to deathblood splattershot in the chestlow budget film …marijuanacriminaldecapitationbisexualstrangulationvideo camerastabbingdrug dealerstabbed to deathstabbed in the chestchild abusesevered headcontroversypantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplattermaniacfemale stockinged legsragemutilationstabbed in the stomachpsychorapistrampagelow budgetdark humorbutcherpsychotronicperversionmurder of a childslaughterstabbed in the eyeabusive fatherkilling spreepsycho killerpervertserial murdervillain played by lead actorpsychopathic killerbad guymadmanmysterious mankillhuman monstersexual violencehomicidal maniacslashingnaked dead womanextreme violencevideo footagematricideknife murdercut into piecessadistic psychopathoff screen murderchild rapemurder of a nude womanmurder spreebroken neckdisturbed individualbutcherygrindhouse filmexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenpsycho terrorbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All) |
In the year 1752, Joshua and Naomi Collins, with young son Barnabas, set sail from Liverpool, England to start a new life in America. But even an ocean was not enough to escape the mysterious curse that has plagued their family. Two decades pass and Barnabas (Johnny Depp) has the world at his feet-o …r at least the town of Collinsport, Maine. The master of Collinwood Manor, Barnabas is rich, powerful and an inveterate playboy...until he makes the grave mistake of breaking the heart of Angelique Bouchard (Eva Green). A witch, in every sense of the word, Angelique dooms him to a fate worse than death: turning him into a vampire, and then burying him alive. Two centuries later, Barnabas is inadvertently freed from his tomb and emerges into the very changed world of 1972. He returns to Collinwood Manor to find that his once-grand estate has fallen into ruin. The dysfunctional remnants of the Collins family have fared little better, each harboring their own dark secrets. Matriarch Elizabeth Collins Stoddard (Michelle Pfeiffer) has called upon live-in psychiatrist, Dr. Julia Hoffman (Helena Bonham Carter), to help with her family troubles. (Read More)
Subgenre: | black comedydark comedyfish out of watergothic horrorvampire comedy |
Themes: | revengesurrealismsuicideghostjealousydrunkennessmagicsupernatural powertime traveldysfunctional familyunrequited lovealcoholismmadness |
Mood: | nightmarespoof |
Locations: | barcemeterysmall townwoodsshipcastlecampfiresinging in a carfire truckabandoned factoryfishing village |
Characters: | vampirefamily relationshipsfather son relationshippoliceteenagermother daughter relationshipsingerpolice officerpolicemanpsychiatristwitcholder man younger woman relationshipfishermanship captaingo go girl |
Period: | 1970s20th century18th centuryyear 1972 |
Story: | manorwerewolfbloodflashbacktwo word titletitle spoken by characterpartyfirevoice over narrationcorpseshotgunswordfalling from heightshooting …paintingshowdownsunglassesgood versus evilorphanold manmassacreambulancemansionmontagedinerrock bandno opening creditscoffinfishingunderwater scenefemme fatalepantyhoseold womangunshotcursebased on tv seriesfactoryumbrellamanipulationreference to william shakespeareundeadstrong female characteractor playing himselfsabotagefireplacediscowarehousegothictape recorderred dresstreasureexploding buildingwitchcrafttherapistservantmobrailway stationstrong female leadmind controlblack humortorchhitchhikingmental institutionsexual desirecamera shot of feetcrime scenepump action shotgunconstruction sitecynicismblood on faceintriguehippiedark humorimmortalityhypnosisheartclifffemale doctorcanered pantiesbarefoot femalepassionate kisschainbrushing teethblack magicfamily secretimprisonmentfemale stockinged feetmarijuana jointcartoon on tvburied alivelost lovemasturbation referencehanging upside downpsychedelicfoot closeuppocket watchstrait jacketfamily businesschandelierpunsexual frustrationevil womanmanipulative behaviorbechdel test passedreference to shakespeare's romeo and julietimmortalseductive behaviorvampirismmainefemale bosslack of moneysecret passagehouse fireold housefeet on tablechainsmagic spellgas explosionpointing a gun at someonesecret roomestranged fathersailing shipseductive womanfemale antagonistfemale to male footsie playingplaying footsieangry mobselfish womanfalling off a cliffrenovationblood drinkinghidden roomlearning the truthdrinking bloodbossy womanmirror ballpassenger trainpretending to be someone elsepsychological manipulationelectroshock therapyexhumationgovernessmanipulative womanblood transfusionsecret passagewaygrand pianoforced suicidetriceratopsfemale psychiatristactor playing dual rolesmoking after sexdisco balltaking off underwearvolkswagen busliverpool englandestranged daughterlava lampbuilding explosionfemale stockinged solesreference to mcdonald's restaurantfemale werewolfactress playing dual rolesplashed with waterred lingeriefactory ownergender confusiongold watchpumpkin patch1770sbare feet on tableteen bedroomspurned womanfalling chandeliermephistophelesfisherybank check1760sbackhoebolt cutterwaffle1750swicked witchpatterned pantyhoseeighteenth centurymale stockinged feetbelief in ghostsreference to alice coopertransfusionred pantyhosetroll dollstar cameochanging one's namecannerycynical womandumping dead bodyfemale seductionimmortal manyear 1776 (See All) |