Please wait - finding best movies...
In the future, a spaceship called Serenity is harboring a passenger with a deadly secret. Six rebels on the run. An assassin in pursuit. When the renegade crew of Serenity agrees to hide a fugitive on their ship, they find themselves in an awesome action-packed battle between the relentless military … might of a totalitarian regime who will destroy anything - or anyone - to get the girl back and the bloodthirsty creatures who roam the uncharted areas of space. But, the greatest danger of all may be on their ship. (Read More)
| Subgenre: | space operapolitical satirepsycho thrillersuspensemartial arts |
| Themes: | future warspace travelfreedomcannibalismunrequited lovegriefsupernatural powerrobberymilitaryfuneralescapefriendshiprevengedeath |
| Locations: | space fightspace battleouter spacespacekitchen |
| Characters: | ex soldierwarriorthiefpriestbrother sister relationshipteenage girldoctorhusband wife relationship |
| Period: | future |
| Story: | starship captainstarship name in titlestarship crewmale physicianspacecraft cockpitmale captainsexual tensionpsychic powerfemale pilotspaceship crashspace westernspace colonyhuman in outer spaceearth viewed from spacespace exploration …female warriorkatana swordescape podhistory lessonmass deathbrain implant26th centuryclotheslinedone world governmentwind turbineoperativetelepathterraformingfirefightsubliminal messagewall safetinnitusgovernment coverupmandarineye injuryvacuumalliancesuper soldieroutnumberedbody armorincensebarefoot womanfireflystabbed in the footcompanionbickeringmegacorporationexploding shipshepherdstarshipcamouflageshot in the handmercy killinghandcuffedinterracial marriagewrathgoldfishsmugglerphysicianshot in the neckadvertisementwedding ceremonygatling gunatheistsinbroken armhologramdeceitkicked in the crotchattempted suicideresistanceinterracial romanceveterantrappedtensioneaten alivemechanicandroidpreachermind controlplanetspacecraftloss of friendheroinegrenadeloyaltycaptainchild murderpsychicdeath of childshot in the shoulderevil manfugitivepilotattempted murderon the runshot in the legfictional warspaceshipanti herostabbed in the chestsuicide attemptthroat slittingimpalementgood versus evilshot in the backshowdownswordcomputerface slapshot in the chestblood splattershot to deathcorpsedreamshootoutfirechaselesbian kissexplosionbare chested male (See All) |
In the distant future high school kids are encouraged to become citizens by joining the military. What they don't know is that they'll soon be engaged in a full scale war against a planet of alien insects. The fight is on to ensure the safety of humanity.
| Subgenre: | cult filmblack comedydystopia |
| Themes: | future warspace travelunrequited lovesupernatural powermilitaryfuneraldeathfriendshipmurderjealousypoliticsmonsterdeath of fatherdeath of motherrivalry …self sacrifice (See All) |
| Mood: | goresatirehigh school |
| Locations: | space battleouter spacecourtroomcavespace station |
| Characters: | father son relationshipmother son relationshipboyfriend girlfriend relationshipsoldieralienteacher student relationship |
| Period: | future23rd century |
| Story: | starship captainspacecraft cockpitsexual tensionfemale pilotspace westernhuman in outer spaceexploding shipstarshipmercy killingbroken armplanetspacecraftpsychicpilotfictional war …spaceshipstabbed in the chestimpalementgood versus evilshot in the backshot in the chestblood splattershot to deathcorpseexplosionbare chested malebased on novelbloodmale nudityviolencefemale frontal nuditymale frontal nuditymale rear nudityfemale rear nuditydancingpartyknifeshowerbeatingmachine gunshotgunrescuepunched in the facebattlebare buttfalling from heightvomitingcombatscientistreporterdecapitationmassacredeath of friendwomanarmystabbed to deathnonlinear timelinesevered headno opening creditsdrawingcreaturenews reportshot in the foreheadtrainingcharacter repeating someone else's dialoguestabbed in the backperson on firefirst of seriestenttragic eventhigh school studentsplit screenexploding bodypremarital sexcharacter says i love youfirst partmercenarysevered armwhippingdismembermentredheadbattlefieldmachismomissileburned alivekilling an animalpropagandamutilationamerican footballsergeantmediasevered handcovered in bloodviolinrocket launchercolonelcrushed to deathalien invasiontarget practiceinsectstabbed in the legexploding headaviationaccidental killingfascismknife throwinglieutenantsevered legdeath of loved onemedia coveragetelepathytorso cut in halffemale soldierblood on camera lensgraduationstabbed in the handhigh school teachercorporal punishmentamputeecameramanshot in the eyedisciplinemilitary basespace warasteroidpromstabbed in the shoulderextreme violencefilmed killingmeteorpart computer animationopen endeddeath sentencealien planetbutt slapmilitary trainingbuenos aires argentinainfantrymind readingnuclear explosioncolonynuclear weaponsfortwoman punching a mand dayboot camphuman versus alienfire breathinggiant insectair strikeprivatewoman in uniformbody torn apartgiant creatureconundrummass destructionoutrunning explosioncitizenshipdissectionoutpostgreen bloodmilitary lifevideo messagemale soldierdrill instructorfloating in spaceeating brainsexploding starshipdamaged starshipfederationhole in the headmath whizconcentrationleg bitten offheroine diesstarship bridgenumber gamelaser taginsectoid alienmilitary scientistfemale captaincrypto fascismrobot handunisex bathroom (See All) |
All looks lost for the Rebellion against the Empire as they learn of the existence of a new super weapon, the Death Star. Once a possible weakness in its construction is uncovered, the Rebel Alliance must set out on a desperate mission to steal the plans for the Death Star. The future of the entire …galaxy now rests upon its success. (Read More)
| Subgenre: | space operasuspensetragedyepicscience fantasy |
| Themes: | space travelsupernatural powerescapedeathrevengefriendshipmurderkidnappingbetrayalpoliticsprisonfeartorturedeceptionanger …death of fatherbrutalitydeath of motherparanoiaredemptionexecutionhopedeath of wifepanicblindnesscourageself sacrificeartificial intelligenceprison escape (See All) |
| Locations: | space battleouter spacespacebeachdesertelevatorfarmcavespace stationbattle station |
| Characters: | warriorhusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfemale protagonistsoldieralienhostagetough guyaction herolittle girlasiandirectorsniper …sniper rifleengineerrobot human relationship (See All) |
| Period: | future |
| Story: | spacecraft cockpitmale captainfemale pilotspaceship crashspace westernfemale warriorescape podstabbed in the footexploding shipstarshipbroken armhologramresistanceveterantension …planetspacecraftgrenadecaptainshot in the shoulderevil manpilotattempted murderon the runfictional warspaceshipanti herostabbed in the chestimpalementgood versus evilshot in the backswordshot in the chestshot to deathcorpseshootoutfirechaseexplosionnumber in titleviolenceflashbacktwo word titlefighttitle spoken by characterpistolmachine gunshot in the headrescuebattlearrestgunfightbrawlfalling from heightheld at gunpointbombinterrogationrobotcriminalcombatscientistsubjective cameraspysurvivalambushstrangulationmassacredisguisedeath of friendarmystabbed to deathprisonertied to a chairmapno opening creditschild in perildouble crosscreatureflash forwardone against manybinocularscharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionundercoverrace against timeknocked outtough girllightningfarmerstreet shootoutexploding bodyloss of fathermercenaryex convictloss of mothershot in the armgeneralsecret agentsubtitled scenebattlefieldpowermoonstylized violencestrong female charactercivil wartraitorsabotagedestructionassassination attemptheavy rainsociopathhelmetlifting someone into the airspin offjail cellcaptiveloss of loved onetemplesergeantexploding buildingloss of wifecaucasianblockbusterrebeljumping from heightrebellionstrong female leadlaseraction heroinemexican standoffsocial commentarybroken legpresumed deadgas maskcameohaunted by the pastbraverycrossbowhatredfemale leadmercilessnesspower outageevacuationfalling to deathescape attemptsenatorhit on the headdeath of protagonistassault rifleaerial shotundercover agentcapturedark pastblind manbody countwar veteranwilhelm screamtelekinesismoral dilemmaprequellaser gunheroismshot through a windowswordsmanminingreturning character killed offbag over headbureaucracyfemale fighterfake identitytoweralarmcomputer crackerworld dominationcomic reliefmegalomaniacplane crashyoung version of characterbunkergovernorstar warsfemale spybearded manmessagecrystalfilm starts with textcrash landingspace shuttlefighter pilotbehind enemy linesdamman kills a womanoffscreen killingspace warlightsaberdisembodied headguardianfight the systemfinal battlecapeempirefamous scoreopen endedtragic pasttragic endingfemale criminaldistrustfemale prisonerfiring squadjailbreakadmiraldogfightarchivecockney accentmind readingpsychotronic filmbo staffresistance fighterforce fieldlifting person in airanti heroinegogglesknocked out with a gun buttinnocent person killedalien creatureextreme close uptotalitarianismepic battlescottish accenthumanlong haired malecapmushroom cloudsagasuit of armordeath of parentescaped prisonermessengertransportair strikedark heroinecollapsing buildingprosthetic limbdefectorcollisiondisobeying ordersmass destructioncouncilthe forceblueprintsuicide missioninsubordinationoutpostweapon of mass destructionbazaarmining townfictional planetcargo shipsecret weaponlock pickgalactic warjedidroidnight vision binocularsagainst the oddsstrong female protagonistdeath sceneexploding planetexploding tankextremistrebel leaderrobot as pathosinformation leaksecret baseroninstormtrooperdestroyed citystorm trooperman with a ponytailsuper weaponwarp speedblasterdeath starwmdleather gloveshyperspacesecret messagealien languageprequel and sequelsecret planstarfightercommunicationsintelligence officersentient robotalien intelligencebad guys wingunshiptragic heroinefemale convictinbetwequelevil empireaerial battleblack maskdarth vaderextremist groupheroine diesopening creditsswitchboardcontrol towerenergy shieldfather killedhuman maleschematichuman femalemale pilotspace pilottie fighterastromech droidhandheld communicatorsith lordspaceship name in titlefemale senatorplanet viewed from outer spaceshuttleultimate weaponx wing starfighterprotocol droidrebel basestar destroyerstardustat at walkerdeep voicedestroyed planetrebel starshipshuttlecraftstarfighter pilotstolen planstransport starshipwarrior monkblaster pistoldefectdroid human relationshipforce chokegr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperrebel soldierred blade lightsaberrogue oneshared universestarfighter cockpit (See All) |
When the USS Enterprise crew is called back home, they find an unstoppable force of terror from within their own organization has detonated the fleet and everything it stands for, leaving our world in a state of crisis. With a personal score to settle, Captain Kirk leads a manhunt to a war-zone worl …d to capture a one-man weapon of mass destruction. As our space heroes are propelled into an epic chess game of life and death, love will be challenged, friendships will be torn apart, and sacrifices must be made for the only family Kirk has left: his crew. (Read More)
| Subgenre: | space operamartial artsconspiracyepicfuturistic |
| Themes: | space travelsupernatural powerfuneralfriendshipdeathrevengemurderlovesuicidebetrayalpoliticstorturedrunkennessmonsterdeception …death of fatherterrorismsurveillanceself sacrificeradiation (See All) |
| Mood: | darkness |
| Locations: | space battleouter spacespacehospitalbarnightclublondon englandelevatorsan francisco californiaspace stationwar zonerunning through the woods |
| Characters: | warriordoctorfather daughter relationshipboyfriend girlfriend relationshipalientough guyaction herovillainterrorengineerbabe scientistfemale scientistfirst officer |
| Period: | 23rd century |
| Story: | starship captainstarship crewmale physicianmale captainspaceship crashhuman in outer spacefemale warriorescape podsuper soldierbickeringexploding shipgatling gunbroken armholograminterracial romance …planetspacecraftcaptainfugitiveon the runfictional warspaceshipanti herostabbed in the chestgood versus evilshot in the backswordshot in the chestshot to deathshootoutfirechaseexplosionbare chested maleviolencesequelthreesomefightknifecell phonebeatingfistfightshot in the headpunched in the facebattlearrestgunfightbrawlfalling from heightheld at gunpointhand to hand combatsecond partinterrogationhandcuffscombatscientistfoot chaseassassinterroriststrangulationdeath of friendwomanfour word titlemixed martial artsweaponno opening creditsone man armychild in perildouble crossunderwater scenecreaturebased on tv seriesstabbed in the backprologueelectrocutionmini skirtmissionrace against timecover upknocked outkicked in the facetough girllightningopening action scenemanipulationbodyguardpursuitexploding bodyneck breakingsecret agentsubtitled scenemoonchessdisastertraitorgamesabotagedestructionspearassassination attemptsociopathexploding buildingblockbusterlaserhomefalse identityinterracial friendshipcrushed to deathback from the deadbroken legseriesreverse footagecameofanmanhuntpower outageresurrectiondeath of protagonistenglishvolcanocapturetribefemale doctorlens flarelieutenantterrorist plotteleportationlaser gunenglishman abroadtranslatorreturning character killed offstuffed animalstar trekmetaphorsuper strengthworld dominationmegalomaniaccommandercrash landingkiss on the lipswoman in bra and pantiesgenetic engineeringswimming underwatercrushed headmale protagonisttop secretterrorist attacksuperhuman strengthcurecorrupt officialwoman in a bikinialien planetsick childmemorialadmiralblues musicgolden gate bridgenight timewoman slaps a manmedical doctorpsychotronic filmsecret missionalien creaturespacesuittorpedowar criminalalien raceregenerationbudweiserscottish accentcryogenicsdeoxyribonucleic aciddutch anglesecret organizationhuman alienhuman versus alienrunning for your lifecriminal mastermindenglishwomanjumping off a cliffzero gravityflying carcollapsing buildingvolcanic eruptiongiant creaturedisobeying ordersmass destructionlife and deathholding cellblood samplespear throwingbased on cult favoritelogicalcatrazinterracial lovespacewalknew beginningterrorist bombingsuspended animationliquid nitrogenfan servicehalf humanwarrior racesecret government organizationtwelfth partbead curtainmisdirectionwarp speedcult favoritejupiter the planetphasermilitary dress uniformconference roomfearlessnessbody suitexperimental technologymale alienphoton torpedoesvolcano eruptionenterprise the starshiphuman alien relationshipchess gameshuttle craftactor reprises previous rolefalse flaghuman alien hybriddamaged starshipstarship interiormassive explosiondemotionjumping from a moving vehiclemedical scanneropening creditsstarship bridgefather killedhuman malejumping on a moving vehiclesequel to a rebootstarfleet captaincold fusionhuman femalemale doctorstarfleet admiralsubmergedhandheld communicatorlanding craftstar fleethuman vulcan manplanet viewed from outer spacepointy earsspace debrisaway teamchief medical officerhuman beingmysterious forceu.s.s. enterprise ncc 1701alcatraz islandbipedal alienextra vehicular activityfemale lieutenanthalf human half aliensexy alienspeaking klingontorn apartalien crew membercold shoulderfuture cityscapeklingon manlethal radiationmale klingonu.s.s. enterprise (See All) |
30 years after the defeat of Darth Vader and the Empire, Rey, a scavenger from the planet Jakku, finds a BB-8 droid that knows the whereabouts of the long lost Luke Skywalker. Rey, as well as a rogue stormtrooper and two smugglers, are thrown into the middle of a battle between the Resistance and th …e daunting legions of the First Order. (Read More)
| Subgenre: | space operamartial artscoming of ageepicfamily dramascience fantasy |
| Themes: | space travelsupernatural powerescapedeathrevengemurderkidnappingbetrayalfeartorturemonsterdeceptionangerdeath of fatherbrutality …redemptionhopecouragenear death experienceunlikely herodestruction of planet (See All) |
| Mood: | ambiguous ending |
| Locations: | space battleouter spacebarforestsnowdesertwaterelevatorvillagewoodsspace station |
| Characters: | warriorfather son relationshipmother daughter relationshipfemale protagonistsoldiernursealienhostagetough guyaction herodeath of hero |
| Period: | 2010swinter |
| Story: | spacecraft cockpitfemale pilotspaceship crashspace westernhuman in outer spacefemale warrioroutnumberedexploding shipstarshipsmugglerhologramresistanceeaten alivemind controlplanet …spacecraftcaptainshot in the shoulderfugitivepiloton the runfictional warspaceshipanti herostabbed in the chestgood versus evilshot in the backshowdownface slapshot in the chestshot to deathshootoutfirechaseexplosionf ratedbloodviolencesequelgunfightsurprise endingfistfightremakeshot in the headrescueslow motion scenepunched in the facewritten by directorbattlearrestgunfightbrawlfalling from heightshootingheld at gunpointhand to hand combatinterrogationrobotislandcombatsurvivalfoot chaseorphanassassinsword fightgangambushstrangulationmassacredeath of friendwomanarmymixed martial artsprisonermapno opening creditsone man armydouble crosscreaturebartenderfive word titleduelone against manybinocularscharacter repeating someone else's dialoguedangerkeyelectrocutionattackmissionrace against timemissing persontentknocked outtough girlopening action scenelong takeshot in the armgeneralsubtitled scenebattlefieldstylized violencestrong female characterhenchmandestinysabotagedestructionspearmass murderheavy rainquesthelmetragewalkie talkieroman numeral in titleexploding buildingcaucasianblockbustergiantproduced by directorskullstrong female leadlaseraction heroinemasked mancannonpresumed deaddamsel in distressvisionexplosivebraverycrossbowseven word titleobesityhatredmercilessnesspower outagechaossunaerial shotprisoner of warwisecrack humorbounty hunterlens flarelieutenantrescue missionsword duelcellarflamethrowerwilhelm screamtelekinesislaser guntelepathyfemale soldierreturning character killed offjunkyardfemale fightershipwreckworld dominationmajormegalomaniacstar warsfemale spyadventure herocommanderhearing voicesfilm starts with textcrash landingfighter pilotgenetic engineeringreluctant heroblizzardpatricidetentaclefemale heromacguffinwoman kills a manlightsaberhumorstabbed in the shouldercapefamous scoreopen endedwoman fights a manmasked villainroman numbered sequelcloningjailbreakadmiraldogfightmind readingone woman armyresistance fighterlifting person in airanti heroinegogglesman with no namebilingualismalien creaturethirstepic battlescottish accentseventh partdesertermagical powerdetonatorsagaflame throwerwoman punches a manbombardmentair strikeangryprosthetic limbrebootthe forcewoman hits a manjedi knightquicksandspit takefather and sonscavengerson murders fatherstrong womancrisis of conscienceoutpostweapon of mass destructionabandoned shiphumanoid alienfictional planetnumber in character's namestabbed through the chestadvanced technologyjediangry manco pilotdroidexploding planetfood shortagelaser cannonstormtroopertalking robotdesert planetrationingmale soldierhumanoid robotsnowy landscapesuper weaponwarp speedhyperspacestarfightermale female huglightsaber battleplasmawookieeactor reprises previous roleimax versionviolent outburstcharacter says i have a bad feeling about thisasteroid beltstarship bridgeturncoattie fighterastromech droidmillennium falconr2 d2remote detonatorx wing starfighterbattlecruisercharacter says may the force be with youprotocol droidstar destroyerworld destructionbipedal aliendesert landscapehandheld detonatorrobotic armspace fleetstarfighter pilottentacled alienbar scenebattlecruiser starshipblaster pistolcrashed starshipplanetary destructionred blade lightsaberscrap merchantstarfighter cockpit (See All) |
After stopping off at Starbase Yorktown, a remote outpost on the fringes of Federation space, the USS Enterprise, halfway into their five-year mission, is destroyed by an unstoppable wave of unknown aliens. With the crew stranded on an unknown planet and with no apparent means of rescue, they find t …hemselves fighting against a ruthless enemy with a well-earned hatred of the Federation and everything it stands for. Only a rebellious alien warrior can help them reunite and leave the planet to stop this deadly menace from beginning a possible galactic war. (Read More)
| Subgenre: | space operamartial artsfuturisticrevenge plot |
| Themes: | space travelescapefriendshiprevengedeathmurderkidnappingbetrayalfeardeceptionangerbrutalityparanoiahopepanic …vengeancecourageself sacrificenear death experiencealien abduction (See All) |
| Mood: | half alien |
| Locations: | space battleouter spacespacebarforestmotorcycleelevatorwoodscitycavespace stationalien ship |
| Characters: | ex soldierwarriordoctorafrican americanalienhostagetough guyaction herointerracial relationshiprussianengineerrevenge motiveformer soldierrevenge seeker …same sex kiss (See All) |
| Period: | 23rd century |
| Story: | starship captainstarship crewmale physicianspacecraft cockpitmale captainspaceship crashspace westernhuman in outer spacefemale warriorescape podoutnumberedexploding shipstarshiphologramplanet …spacecraftheroinespaceshipimpalementgood versus evilshot in the backshowdownshot in the chestshot to deathcorpseshootoutchaseexplosionbare chested maleviolencesequelfightphotographpartyknifethree word titlevoice over narrationfistfightshot in the headrescueslow motion scenepunched in the facebattlegunfightbrawlfalling from heightheld at gunpointhand to hand combatbirthdayrock musiccombatsurvivalfoot chaseorphanambushstrangulationdisguisedeath of friendmontagebridgemixed martial artsprisonerno opening creditsdisarming someonedouble crossbirthday partyunderwater scenecreaturesearchthird partnecklacetransformationcoffeeone against manybased on tv seriesdangerelectrocutionattackmini skirtmissionrace against timeknocked outkicked in the facetough girllong takethreatened with a knifesubtitled scenebattlefieldstylized violencestrong female characterhenchmanlgbtdestructiongay charactersurvivorcaptivewalkie talkiekicked in the stomachblockbusteraction heroineinterracial friendshipcrushed to deathbraverycynicisminventorhatredmercilessness3 dimensionalevacuationfalling to deathimmortalityescape attemptpunched in the chestjumping through a windowbooby trapaerial shotblack eyewisecrack humortitle at the endcapturedisfigurementdark pastlens flarewar veteranlieutenantmutationrescue missiondictatorwilhelm screamwritten by starteleportationlaser gunfast motion scenetracking devicevodkasatellitetranslatormale objectificationinvisibilitygay manfinal showdownreturning character killed offfemale fighterstar trekstrandedpromotionportaldronemegalomaniacno title at beginningcommandercrash landingartifactfemale martial artistmacguffinmale protagonistwoman kills a manhumorfamous scoreshape shiftertragic pastwoman fights a manalien planetsubterraneanwarlordadmiralnight timemedical doctorone woman armypsychotronic filmbo stafffamous linevillain not really dead clicheforce fieldanti heroinearmoryalien creaturegas explosionalien racescottish accenttragic villaindutch anglescotsmanhuman alienhuman versus alienbiological weaponalien technologyzero gravityfalse nameman fights a womanbrandylifted by the throatmotorcycle stuntvideo recordingfragments of glasssurprise attackafrican american manstar died before releaseloud musicscavengeroutrunning explosionbased on cult favoriteabandoned shipexplosive decompressionhumanoid alienwoundedswarmdirected by co starsearch and rescuesecret revealedancient astronautfemale alienrap songshape shiftingvideo messagetrue identity revealeddisintegrationhalf humanthirteenth partgreen skinwarp speedalien civilizationphaservulcandeep spacedistress signalfuturistic cityalien languagefloating in spacecommunicationsinvisibility cloakphoton torpedoesenterprise the starshipfemale humanoid alienalien artifactshapeshiftertragic heroinewhiskyhuman alien hybridspaceportvow of revengenebulaspaceship captainstarship interiorspace navyasteroid beltopening creditsstarship bridgesequel to a rebootstarfleet captainalien weaponfederation starshipmale doctorartificial gravityhandheld communicatorattempted revengehuman vulcan manplanet viewed from outer spacepointy earsshakespearean quotechief medical officerhuman beingrevenge beatingspace captainu.s.s. enterprise ncc 1701vulcan manbipedal alienfemale lieutenanthalf human half alienlife force sucked outlong haired womantricorderalien crew memberdisintegrating bodystaff weaponu.s.s. enterpriseu.s.s. enterprise ncc 1701 auniversal translator (See All) |
Set way in the future, Earth is no longer inhabitable, so humans have colonized in outer space. One colony receives two cryogenically frozen bodies, and when they defrost them, one of the bodies turns out to be.....who else? Jason Voorhees. No longer in the forest or Camp Crystal Lake, Jason stalks …the colonists in a whole new environment. (Read More)
| Subgenre: | suspensemartial artsindependent filmblack comedydark comedyb movieabsurdismfish out of waterteen horror |
| Themes: | space travelsupernatural powermilitaryescapedeathmurderfearmonsterpsychopathbrutalityparanoiaself sacrificeartificial intelligenceclaustrophobia |
| Mood: | goreslasherambiguous ending |
| Locations: | outer spacespacewoodslakelaboratoryspace stationresearch stationship explosion |
| Characters: | doctorteenagerboyfriend girlfriend relationshipteachersoldiertough guyvillainteacher student relationshipprofessorterrorengineerbabe scientist |
| Period: | future2000s |
| Story: | spaceship crashspace colonyhuman in outer spaceearth viewed from spacegatling gunhologramandroidspacecraftevil manpilotshot in the legspaceshipstabbed in the chestthroat slittingimpalement …shot in the backshowdowncomputerface slapshot in the chestblood splattershot to deathcorpsefirechaseexplosionbare chested malefemale nuditycharacter name in titlenumber in titlebloodviolencesequelfemale frontal nudityflashbacksex scenekissfightnipplesknifesurprise endingpistolbeatingfistfightmachine gunshot in the headshotgunrescuepunched in the facefalling from heightmaskrifleheld at gunpointhand to hand combatnumbered sequelrobotkung fuscientistdecapitationsurvivalflashlightambushstrangulationmassacrestabbed to deathmixed martial artssevered headdisarming someoneunderwater scenecreaturetransformationlatex glovesflash forwardstalkerbeaten to deathdangerstabbed in the backprologuekarateelectrocutionrace against timekicked in the facetough girlinjectionstalkingexploding bodyneck breakingthreatened with a knifemercenarysevered armlove interestkissing while having sexdismembermentundeadsurgerysabotageelectronic music scoremass murderhypodermic needlemachetecowboy hatmutilationroman numeral in titlestabbed in the stomachsergeantexploding buildingkicked in the stomachcovered in bloodvictimvirtual realityback from the deadmasked manpresumed deadcyborgrampagenew jerseydual wieldobesityresurrectionspecial forcesexploding headjumping through a windowautopsywisecrack humorblood on shirtslaughterdisfigurementknife throwingfemale doctorsevered legcharacters killed one by onetank topmasked killershot multiple timesgrenade launcherlaser guntorso cut in halftracking devicefemale soldierpsychopathic killermadmanface maskfemale fighterhuman monstersummer campslashingcameo appearanceknocked unconscioushead bashed incrash landingartifactsimulationoffscreen killingcrushed headmedical studentbody bagdeath of boyfrienddisembodied headstabbed in the shoulderextreme violencemicroscopewoman fights a manmasked villainroman numbered sequelman wearing glassesmorphinearm cut offfemale victimmurder of a nude womanarmy basemass murdererstupid victimvillain not really dead clichescience runs amokarmoryspacesuitwoman in dangerx rayed skeletonregenerationcryogenicsdeoxyribonucleic acidsleeping bagsliced in twoface ripped offpower drilltenth parttrapped in spacenanotechnologyhockey maskshooting starsequel to cult filmbroken backjet packexplosive decompressionbackflipstabbed through the chestfighting in the airjason voorheessuspended animationliquid nitrogenrobot as pathosmutilated bodyfriday the thirteenthleg ripped offman murders a womanleg blown offmachete mutilationwarp speeddistress signalsports braspaceship settingfemale mercenaryfembotspear through chestwessex county new jerseycrystal lake new jerseykilled by machete25th centurybody enhancementbody scanaltering futureshuttlecraft (See All) |
After stealing a mysterious orb in the far reaches of outer space, Peter Quill from Earth, is now the main target of a manhunt led by the villain known as Ronan the Accuser. To help fight Ronan and his team and save the galaxy from his power, Quill creates a team of space heroes known as the "Guardi …ans of the Galaxy" to save the world. (Read More)
| Subgenre: | space operamartial artscult filmblack comedysuperherodark comedyfuturisticurban fantasyscience fantasylive action and animationrevisionist westernscience fiction comedy |
| Themes: | space travelsupernatural powerescaperevengedeathfriendshipmurdersurrealismsuicidekidnappingmoneybetrayalprisontorturedrunkenness …herodeceptiontheftterrorismdeath of mothercancergamblingsurveillancetraumaself sacrificenear death experienceprison escapealien abductionescape from prison (See All) |
| Locations: | space battleouter spacespacehospitalbarcavestormearthprison fight |
| Characters: | warriorthieffamily relationshipsmother son relationshipfather daughter relationshipfriendboygirlsoldieralienhostagesister sister relationshiptough guyaction herolittle girl …interracial relationshiplittle boygrandfather grandson relationship (See All) |
| Period: | 1980s2010syear 1988year 2014 |
| Story: | human in outer spacefemale warriorescape podexploding shipstarshipsmugglerbroken armholograminterracial romanceandroidplanetspacecraftheroinecaptainfugitive …piloton the runfictional warspaceshipanti herostabbed in the chestimpalementgood versus evilshot in the backshowdownswordface slapshot in the chestshot to deathshootoutchaseexplosionbare chested maleviolenceflashbackdogfightdancingtitle spoken by characterknifesurprise endingcryingfistfightmachine gunrescueslow motion scenepunched in the facewritten by directorbattlearrestgunfightbrawlfalling from heightlettershootingbased on comicheld at gunpointhand to hand combatbombinterrogationjailhallucinationhandcuffscriminalcombatfoot chaseorphanassassinsword fightbased on comic bookterroriststrangulationmontagebridgearmyfour word titlestabbed to deathmixed martial artsprisonerpoliticianweaponsevered headunderwater scenecreatureracial slurgunshottreecharacter repeating someone else's dialoguestabbed in the backelectrocutiondollkicked in the facetough girllightningscreamscene during end creditsscargiftexploding bodyneck breakingdie hard scenariofirst partthreatened with a knifemercenaryex convictsevered armloss of motherprofanityobscene finger gesturebattlefieldpowerstylized violencestrong female charactersisterexperimentpirateheavy raintalking animallistening to musicscene during opening creditscatfighthelmethammerexploding buildingkicked in the stomachblockbustereccentricgiantcampbarefoot malerebelsevered handrebellionstrong female leadlaserrocket launchercrying manaction heroinegun fucrushed to deathchokingmasked manmale underwearcyborganthropomorphismadventurercameohaunted by the pastprison guardnicknameface paintdual wieldsmugglingmanhunt3 dimensionalanthropomorphic animalsexismsuper villainfalling to deathensemble castscene after end creditshit on the headmarvel comicsabsent fathersexual harassmentoutlawknife fightwisecrack humorsuperheroineracisttitle at the endbounty hunterconvictvoice over letterraised middle fingerminelens flaregadgetarrowlightdaggerholding handsarrogancelaser gunsurprise after end creditsfemale assassinman cryingmale objectificationpresentfinal showdownreturning character killed offfemale fightersuper strengthmini dressmale in underwearshot with an arrowmegalomaniacyoung version of characterbroken windowblack markethospital roomcrash landingbased on graphic novelgenetic engineeringfemale heromacguffinsuperhero teambreaking a windowmale protagonistfemale villainaudio cassettekicked in the headfinal battleevil womancollectoropen endedshape shifterplandance scenealien planetfemale criminaladopted daughterwarlordhit with a hammerarm cut offracial stereotypefemale bossaerial combatpsychotronic filmvillain not really dead clicheforce fieldraccoonanti heroinechild abductionwalkmanalien creaturex rayed skeletonpointing a gun at someonealien racecrying maleslow motion action sceneprison riotdecoywoman punching a mangadgetryreading a lettermissouricassette tapepassive aggressive behaviorsurprise during end creditswoman punches a manhuman aliensecretly observinghand cut offpassive aggressive womanzero gravityfall to deathhand kissinginterspecies sexoverheard conversationlifted by the throatflying carprosthetic limbsequel mentioned during end creditsorbdisembodied handtalking to an animalwoman hits a manhandcuffed womanpulp fictionmarvel entertainmentoutrunning explosionheroesprosthetic legmarvel cinematic universehumanoid alienone legged manfictional planetspace piratewanted manfemale politiciandisembodied voicefemale chauvinismboxer briefsdouble impalementbald womanfemale chauvinistobscene gesturestrong female protagonistracist remarkshape shiftingescape planhalf humanlistening to music on headphonesgreen skinill motherblue skinmale female fightbiting someonedragging someonerape jokeviolent mandance offinterspecies romancekissing someone's handpeace treatyaerial bombardmentfemale sexistlocked in jailsequel baitingbroken jawhead spinfemale humanoid alienkicked in the bellyviolent womankidnapped boythrowing something at someoneelectra complexshort dressbad guysbad reputationexploding starshipgetting dressedhuman alien hybridmistaken belief that someone is deadfemale sexismprison planetreference to bonnie and clydemale antagonistreference to kevin baconfather issuesholographic projectionsexist remarksuperiority complexarrogant womanemotionally unstable womanhandcuffed maninterspecies friendshipinterspecies relationshipreference to michael douglasthreatened with a swordtroll dollwet underwearartificial gravitysony walkmanlying on the floorreference to billy the kidblue skinned alienman's best friendbipedal alienfemale green skinned humanoid alienhammer as weaponpouring rainteam workanti gravityend tease for sequelscar on chestscreaming boyshared universe (See All) |
A soldier from Earth crash-lands on an alien world after sustaining battle damage. Eventually he encounters another survivor, but from the enemy species he was fighting; they band together to survive on this hostile world. In the end the human finds himself caring for his enemy in a completely unexp …ected way. (Read More)
| Subgenre: | cult filmblack comedyfuturistic |
| Themes: | space travelmilitaryfuneralescapefriendshipdeathrevengemurdersurrealismkidnappingbetrayalpregnancydrinkingfearmonster …deceptionangerracismbrutalityparanoiasadismpanicnear death experience (See All) |
| Locations: | space battleouter spaceforestsnowdesertwaterwoodscavecampfirelaboratoryspace station |
| Characters: | warriorfriendbrother brother relationshipsoldieralienbabyhostagetough guyaction herouncle nephew relationshipalien monsteralien baby |
| Period: | future21st century |
| Story: | female pilotspace westernspace explorationexploding shipshot in the neckeaten aliveplanetspacecraftloss of friendevil manpilotfictional warspaceshipanti herogood versus evil …shot in the backshowdownshot in the chestblood splattercorpsedreamshootoutfirechaseexplosionbare chested malebloodviolencetwo word titlefightsingingknifesurprise endingpistolvoice over narrationbeatingfistfightfoodmachine gunshotgunrescuepunched in the facedrinkbattlegunfightbrawlrifleheld at gunpointcombatsurvivalmountaindeath of friendmontagefootballfishfalse accusationdisarming someoneone man armychild in perildouble crossritualcreaturetrainingone against manybinocularscharacter repeating someone else's dialoguebeaten to deathdangermissiontentlightningopening action scenedeath of brotherchildbirthisolationthreatened with a knifewaterfallshot in the armmooncard gamespearelectronic music scoreheavy rainsociopathsurvivorslaverybeardamerican footballkicked in the stomachdesperationculture clashskullbirthlasertorchburialanimal attacksocial commentaryslavepresumed deadfight to the deathhatredmercilessnesspsychotroniccard playingpunched in the chestvolcanoaerial shotrainstormturtleminerescue missionburned to deathloss of brotherlaser guntracking devicegiving birthextraterrestrialmininganti warfinal showdownstrandedintoleranceflarelanguage barriercrash landingfighter pilotadopted sonmetamorphosisblizzardtentaclechainedmeteorminertoleranceorchestral music scorealien planetdeath of title characterdogfightpsychotronic filmflare gunanimal killingfade to blackbilingualismcompassalien creaturealien racesevered earhuman alienhuman versus alienalien technologydesolationrescue attempthermaphroditereference to mickey mousepepsishellhumanoidcouncilinfirmaryquicksandreptilepickaxefoster parentscavengerbased on novellabondingtailtroubled productionslave laborcolonizationgreen bloodhumanoid aliencrateradoptive fathermeteor showerwarrior raceman eating monsterman with a ponytailmale pregnancyblue bloodalien languagefamily legacyreptilianman versus natureasexualityspace colonizationalien slavealien spacecraftaccelerated growth (See All) |
Jupiter Jones was born under a night sky, with signs predicting that she was destined for great things. Now grown, Jupiter dreams of the stars but wakes up to the cold reality of a job cleaning other people's houses and an endless run of bad breaks. Only when Caine Wise, a genetically engineered ex- …military hunter, arrives on Earth to track her down does Jupiter begin to glimpse the fate that has been waiting for her all along - her genetic signature marks her as next in line for an extraordinary inheritance that could alter the balance of the cosmos. (Read More)
| Subgenre: | space operamartial artscult filmepicchrist allegoryscience fantasy |
| Themes: | space travelsupernatural powermilitaryescapefriendshiprevengedeathmurdersurrealismkidnappingmarriagebetrayalpregnancytorturewedding …monsterdeceptionredemptionhome invasioncouragenear death experienceunlikely heroalien abduction (See All) |
| Locations: | space battleouter spacechurchcastlerooftopchicago illinoisearth |
| Characters: | ex soldierwarriorfamily relationshipsmother daughter relationshiptattooalienhostagetough guyaction herohitmansingle mothermaidaustralianrussiancousin cousin relationship …uncle niece relationshipaunt niece relationshipship captainself healingrussian american (See All) |
| Story: | human in outer spaceearth viewed from spacefemale warriorexploding shipstarshipgatling gunhologramandroidplanetspacecraftcaptainevil manattempted murderon the runfictional war …spaceshipanti herogood versus evilshowdownface slapshot in the chestshootoutfirechaseexplosionbare chested malef ratedcharacter name in titleviolencetwo word titlegunkissfemale rear nudityfightknifesurprise endingvoice over narrationcell phonefistfightshot in the headrescueslow motion scenewritten by directorbattlearrestgunfightbrawlbare buttfalling from heightheld at gunpointhand to hand combatinterrogationrobotcombatassassinambushdisguisemontagebridgearmymixed martial artsimmigrantdinnerexploding carno opening creditsone man armydouble crosscreaturemarriage proposalone against manyprologuescreamingelectrocutionmissionproduct placementmistaken identitydragonrace against timestatueknocked outlightningopening action scenemanipulationchildbirthdeath of husbandmercenarylove interestsubtitled scenebattlefieldstylized violencesingle parenteavesdroppingdestinydestructionflyingassassination attemptlooking at oneself in a mirrortalking animalroyaltyexploding buildinghonormexican standoffgun fupresumed deadcyborgguarddamsel in distressshieldcameohaunted by the pastreincarnationtelescopebraverydual wieldmercilessness3 dimensionalchaosdeath threatimmortalitysibling rivalrydark herojumping through a windowbounty hunterdark pasttragic herogadgetcapitalismalarm clockblack bra and pantieslaser guninvisibilitylevitationfinal showdownhiding in a closetmoney problemsfireballportalworld dominationdronefarmhousecornfieldcrash landingwoman in bra and pantiesgenetic engineeringreluctant heroheiressconsumerismfinal battleheircathedralalien contactgeneticstragic pastwoman fights a mancamera phonedogfightfingerprintchosen oneforce fieldpitspacesuitalien raceregenerationwingsimperialismdeoxyribonucleic acidgadgetrywormholebrandinghuman alienrescue attemptel trainplanet earthcollapsing buildingpulp fictiongoogletailst. petersburg russiafighting in the airancient astronautebayplanet in titlefertility clinicdynastyalien civilizationexploding bridgejupiter the planetsaturn the planetfloating in spacebeesharvestingshuttle craftspaceportswarm of beesbeam of lightcleaning toiletspace navycleaning a toilethousehold cleaning glovesanti gravityelephant mantoilet cleaning (See All) |
When his brother is killed in a robbery, paraplegic Marine Jake Sully decides to take his place in a mission on the distant world of Pandora. There he learns of greedy corporate figurehead Parker Selfridge's intentions of driving off the native humanoid "Na'vi" in order to mine for the precious mate …rial scattered throughout their rich woodland. In exchange for the spinal surgery that will fix his legs, Jake gathers intel for the cooperating military unit spearheaded by gung-ho Colonel Quaritch, while simultaneously attempting to infiltrate the Na'vi people with the use of an "avatar" identity. While Jake begins to bond with the native tribe and quickly falls in love with the beautiful alien Neytiri, the restless Colonel moves forward with his ruthless extermination tactics, forcing the soldier to take a stand - and fight back in an epic battle for the fate of Pandora. (Read More)
| Subgenre: | suspensemartial artsepiccyberpunkallegoryforeign language |
| Themes: | space travelsupernatural powerrobberymilitaryfriendshiprevengedeathmurderbetrayalfearmonsternatureracismpsychopathdeath of father …terrorismredemptioninsanitysadismexploitationgreedcrueltypanicenvironmentself sacrificehuntingdance ritual (See All) |
| Locations: | outer spacespaceforesthelicoptervillagewheelchairjunglecampfirelaboratory |
| Characters: | warriorsoldieralienkillervillainterrorself discoverymilitary officerbiologist |
| Period: | future22nd century |
| Story: | female pilotspace westernhuman in outer spacefemale warriormass deathmegacorporationexploding shipstarshipgatling gunhologramresistanceinterracial romanceveteranmind controlplanet …heroinegrenadeloyaltycaptainshot in the shoulderfictional warspaceshipstabbed in the chestimpalementgood versus evilshot in the chestshot to deathcorpseshootoutchaseexplosionbare chested malefemale nuditybloodviolenceone word titlekisstitle spoken by charactersurprise endingpistolvoice over narrationbeatingmachine gunrescueslow motion scenepunched in the facebattlegunfightfalling from heightrifleheld at gunpointhand to hand combatrobotprayerscientistswimmingsurvivalfoot chaseambushmassacrearmystabbed to deathweaponfishno opening creditschild in perilritualkingcreaturecoffeetrainingtreebusinessmanperson on fireattackscardeath of brotherpremarital sexmurderertied upunderwaterthreatened with a knifemercenarywaterfallgeneraltwinqueensubtitled scenetrustbattlefieldmoonstrong female charactermissiledestructionbow and arrowkilling an animalflyingspearmacheteshot in the stomachsociopathlifting someone into the airgroup of friendscaptivehunterassaultblockbusterlosspsychojumping from heightculture clashrebellionstrong female leadforbidden loveblack humorgenocidehonortorchanimal attackcolonelbreakfastcrushed to deathsocial commentaryhomicidegas maskanthropomorphismbarefootwoman in jeopardybraveryinvasionfight to the deathecologyimpostormercilessness3 dimensionalinsectescape attemptenvironmental issue3dmurder of a childsoultitle at the endtribeknife throwingenvironmentalismarrowwilhelm screamexploding helicopterloss of brotherpsychoticsmokehorseback ridingshot through a windowfemale soldiertranslatornude swimmingsuffocationenergyextraterrestrialoutcastmysticismcremationhuman monstergolf clubmechashot with an arrowmarinearcheryweightliftingemperorno title at beginningdegradationsleeptwin brotherhuntanimal abusehelicopter crashlanguage barriernativegenetic engineeringheritageshamancolonialismuniversednamushroomgoddessleaderconsciencesole black character dies clicheparaplegicorchestral music scorealien contactrepeated linerighteous rageanimal experimentationalien planetpatriothandicappedfemale victimindigenous peoplemiserybulldozernew agevillain not really dead clichebody swapalien creaturerainforestinfanticideepic battlespiritualismcryogenicsenvironmental destructiondeeply disturbed personimperialismcorporate crimevideo diarysagacorporate executiveflame throwerhuman versus alientranslationenginejumping off a cliff3 dinterspecies sexchild killerfamily in dangerlogginghybridinter culturalenglish subtitles in originalethnic conflictdeityclanoutpostcorporate greedhumanoid alienvirtual setavatarfictional planetforest protectionancestrybotanistinitiation ritepower suitmurderer duosoul transferencethreatening telephone calllieutenant colonelsaviordivine interventionmotion capturewar paintfemale aliennature conservationsuspended animationarrow in chestair battleclosing credits sequencehunting knifeinvented languageenvironmental crimehired gunwarrior racealien life formindigenous rightsmale soldierweightlessnessblue skincryonicsattacked with a knifedishonormineralinterspecies romanceburning villagemale alienturmoilfemale humanoid alienshirtless maledeath of twinscore employs electronic instrumentsstasis podgaiagoing nativeforced perspectivedivine retributionearthlingexo suitforest conservationalien sexbioluminescencetalltribal warfaretree of lifealien predatorbrain in a vatgiant treepoisoned arrowextreme carnagenoble savageprospectingblue skinned alienjungle wardelegationenvironmental preservationintercutvideo log (See All) |
The year is 2071. Following a terrorist bombing, a deadly virus is released on the populace of Mars and the government has issued a 300 million woo-long reward, the largest bounty in history, for the capture of whoever is behind it. The bounty hunter crew of the spaceship Bebop; Spike, Faye, Jet and … Ed, take the case with hopes of cashing in the bounty. However, the mystery surrounding the man responsible, Vincent, goes deeper than they ever imagined, and they aren't the only ones hunting him. The original creators of the virus have dispatched Electra to deal with Vincent and take out anyone who may stumble on the truth behind him. As the hunt for the man with no past and no future continues to escalate, they begin to question what about the world is reality and what is a dream as the line between sanity and insanity becomes more apparent. (Read More)
| Subgenre: | space operamartial artscult filmblack comedyconspiracypost moderncyberpunk |
| Themes: | space travelmilitaryescaperevengedeathmurdersurrealismkidnappingbetrayalheroinvestigationdeceptionterrorismillnessamnesia …huntingnear death experience (See All) |
| Mood: | gorerainneo noiranime |
| Locations: | outer spaceairplanewatertaxielevatorcitytaxi drivercampfirelaboratory |
| Characters: | ex soldierwarriordoctorpolicetattoosoldierhostagetough guyaction herosecurity guardmysterious villainself healing |
| Period: | future |
| Story: | starship name in titlespace westernhuman in outer spacefemale warriorterraformingmegacorporationshot in the handhologramveteranspacecraftheroinegrenadecaptainshot in the shoulderevil man …spaceshipanti herogood versus evilshowdownshot in the chestblood splattercorpsedreamshootoutchaseexplosionbare chested malebloodviolenceflashbackdoggunfightcigarette smokingpartysurprise endingpistolshowerarcade gamefistfightmachine gunshot in the headshotgunslow motion scenepunched in the facearrestgunfightbrawlfalling from heightheld at gunpointhand to hand combatbombhallucinationhandcuffsrevolvercombatscientistsubjective camerahalloweenfoot chaseflashlightterroristdisguisemontagebridgearmystabbed to deathmixed martial artssubwayexploding cardisarming someonedrawingnews reportshot in the foreheadbased on tv seriesstabbed in the backcharacter's point of view camera shotmissionproduct placementmistaken identityrace against timecover upkicked in the facetough girlopening action scenehalloween costumegovernmentmercenaryshot in the armfireworksmoonstylized violencejazzmissilehand grenadecard gamewarehousemass murdersociopathhatdiseaseviruscowboy hatjail cellwalkie talkiehunterswat teamjumping from heightvirtual realitytv showrailway stationparadeaction heroinemexican standoffcolonelgun fuindiangas maskvisionbombingpower outagepunched in the stomachconvenience storeshopping mallscene after end creditsexploding headbutterflyjumping through a windowairplane crashparachutewisecrack humorbounty huntercapturepolice raidexistentialismterrorist plotgovernment agentpipe smokingsurprise after end creditsbullet timetracking devicememory lossdesert eaglefemale soldiermadmanterrorist grouphackerfinal showdownex coprobberscene before opening creditsarmored cartowercomputer crackerlost lovestandoffmegalomaniacplane crashtomboysleepasthmacomputer hackercrash landingfighter jetexploding truckgenetic engineeringshamanplaying a video gameexperiment gone wrongmicroscopeterrorist attackairfielddogfightcockney accentcriminal investigationbiplaneexploding airplaneneo westernkicking in a dooranti heroinemars the planetscience runs amokwiretappinginnocent person killedattempted robberyjack o'lanterntragic villainantidotecorporate crimedetonatorvasejeet kune doel trainhuman experimentationjumping off a bridgehot dog standvaccinevideo arcadecamaraderieex special forceshazmat suitpneumoniasneezingnanotechnologyhand through chestexploding planehands tied behind backelectromagnetic pulseabandoned shipbiohazardmarbledrive in theaterterrorist bombingcontagionconvenience store robberynoodlesknife in backpharmaceuticalsabandoned apartmentfatalismpirate broadcastingjumping onto a trainmonorailshockwavefoiled robberyretro futureterrorist cellfuturistic trainstate terrorismbioterrorismcrop dusterbio terrorismhuman test subject2070sdeadly virushalloween paradepathogendomed cityweather controlhay fever (See All) |
VALERIAN AND THE CITY OF A THOUSAND PLANETS is the new adventure film from Luc Besson, the director of The Professional, The Fifth Element and Lucy, based on the comic book series which inspired a generation of artists, writers and filmmakers. In the 28th century, Valerian (Dane DeHaan) and Laurelin …e (Cara Delevingne) are a team of special operatives charged with maintaining order throughout the human territories. Under assignment from the Minister of Defense, the two embark on a mission to the astonishing city of Alpha-an ever-expanding metropolis where species from all over the universe have converged over centuries to share knowledge, intelligence and cultures with each other. There is a mystery at the center of Alpha, a dark force which threatens the peaceful existence of the City of a Thousand Planets, and Valerian and Laureline must race to identify the marauding menace and safeguard not just Alpha, but the future of the universe. (Read More)
| Subgenre: | space operamartial artsindependent filmconspiracyfuturisticscience fantasy |
| Themes: | space travelunrequited lovesupernatural powerrobberymilitaryescaperevengedeathmurdersurrealismkidnappingbetrayalpoliticstorturemonster …investigationdeceptionmemorycorruptionbrutalityredemptionsurveillanceapocalypseself sacrificedeath of daughterartificial intelligencedestruction of planet (See All) |
| Locations: | space battleouter spacebeachbusdesertwaterseacaveoceanstrip clubsubmarinespace stationu boatsea monsterairplane chase |
| Characters: | warriorfather daughter relationshiptattooprostitutesoldieraliendancerhostagetough guyaction herosecurity guardchinesepimpalien monster |
| Period: | future1970syear 19752020s |
| Story: | female pilotspace explorationfemale warriorterraformingexploding shipgatling gunhologrammind controlplanetspacecraftcaptainshot in the shoulderfictional warspaceshipanti hero …stabbed in the chestimpalementshot in the backshowdownswordface slapshot in the chestblood splattercorpsedreamshootoutfirechaseexplosionbare chested malecharacter name in titlenumber in titlebloodviolenceflashbackgunkissfightdancingtitle spoken by charactersurprise endingpistolbeatingfistfightmachine gunrescueslow motion scenepunched in the facewritten by directorbattlearrestgunfightbrawlfalling from heightbased on comicrifleheld at gunpointhand to hand combatbombrunninginterrogationrobothandcuffscombatstripperspyfoot chasesword fightbased on comic bookambushmassacredisguisemontagearmystabbed to deathmixed martial artstied to a chairmapdisarming someonedouble crossritualunderwater scenekingcreatureprincessmarriage proposaltransformationflash forwardone against manybinocularscharacter repeating someone else's dialoguebeaten to deathstabbed in the backprologueelectrocutionmissionundercoverrace against timecover upknocked outtough girlscarbodyguardpresidentpursuitexploding bodyglassessuspicionmercenarygeneralsecret agentlove interestsubtitled scenebattlefieldstylized violencestrong female charactermissilepiratesabotagedestructionburned aliverevelationspearscene during opening creditshelmetsurvivorloss of loved onesergeanteccentricvirtual realitylaserwomanizergenocidehonoraction heroineanimal attackmexican standoffcrushed to deathsocial commentaryguardexplosiveministerdual wieldobesitymercilessnessevacuationspecial forcespunched in the chestjumping through a windowassault rifleastronautaerial shotwisecrack humorsoulundercover agenttribekingdomtourgadgetdeath of loved onegovernment agentwar crimemoral dilemmalaser gunpalacetelepathytracking devicefemale soldierbriberyinvisibilityextraterrestrialfinal showdowntimebombexotic dancerloss of daughterportalstreet marketdronemajorcomic reliefblack marketfemale spycommandergreenhousecrash landingbased on graphic novelspace shuttlemetamorphosiscrashing through a windowmacguffinbody bagtour guidefight the systemfinal battlepart computer animationshape shifteralien planetdogfightpole dancertrapdoormind readingalternate dimensionforce fieldthronealien creaturespacesuitwar criminalalien raceparadisefalling through the floordeoxyribonucleic acidjellyfishgadgetryparallel worldendangered specieswoman punches a manwormholehuman alienred light districtalien technologyzero gravitysquidpearlhumanoidhangarhidden truthsuper computerpacifistdisobeying orderscouncilwoman hits a manpulp fictioninsubordinationalternate worldgreen bloodseashellhumanoid alienbazaarspace pirateinside the mindsea creatureexploding planetalien speciesshape shiftingshape shifting aliensummitrobot armywarp speeddargaudhyperspacemagnetismmachine pistolshockwavevideoconferencingchain of commandinvisibility cloakparallel dimensionrogue soldierfemale humanoid aliengeofictionalien creature as petannihilationdereliction of dutywoman hitting manaugmented realitynarrow escapespaceship pilotfacial woundrobot soldieryear 2020bomb timer counting downbreaking through wallspace pilotparadise lostromance subplot28th century (See All) |
After saving Xandar from Ronan's wrath, the Guardians are now recognized as heroes. Now the team must help their leader Star Lord (Chris Pratt) uncover the truth behind his true heritage. Along the way, old foes turn to allies and betrayal is blooming. And the Guardians find that they are up against … a devastating new menace who is out to rule the galaxy. (Read More)
| Subgenre: | space operamartial artsblack comedysuperheroslapstick comedyswashbucklerurban fantasyscience fantasylive action and animationscience fiction comedy |
| Themes: | space travelsupernatural powerfuneralescapefriendshipdeathrevengemurderlovesurrealismsuicidekidnappingbetrayaljealousypregnancy …dancemonsterherodeceptionangertheftpsychopathredemptionsurveillanceself sacrificenear death experience (See All) |
| Locations: | space battleouter spacespaceforestcarsnowsmall townwoodscastlecavestrip clubcampfirebrotheltunnelsinging in a car |
| Characters: | warriorthieffather son relationshipfriendtattooprostitutealienhostagesister sister relationshiptough guyaction heroreference to godinterracial relationshippregnant womanalien monster |
| Period: | 1980s2010syear 1980year 2014 |
| Story: | spacecraft cockpitspaceship crashhuman in outer spacefemale warriorescape podterraformingexploding shipstarshipwrathgatling gunholograminterracial romanceeaten aliveandroidmind control …planetspacecraftheroinecaptainfugitivepilotattempted murderon the runfictional warspaceshipanti heroimpalementgood versus evilshowdownswordshot in the chestshot to deathshootoutchaseexplosionbare chested malenumber in titleviolencesequelflashbackbondagegunkissfightdancingphotographsingingpartyknifesurprise endingpistoldigit in titlefistfightmachine gunurinationrescueslow motion scenepunched in the facewritten by directorbattlegunfightbrawlfalling from heightbased on comicheld at gunpointbeertearshand to hand combatsunglassesbombsecond partinterrogationnumbered sequelrobothandcuffscombatstripperorphanflashlightassassinbased on comic bookgangambushold manmontagemixed martial artsdinertied to a chairjokedinnerdouble crosscreaturetransformationracial slurtrainingflash forwardconfessioncharacter repeating someone else's dialogueprologueelectrocutionproduct placementrace against timestatueknocked outtough girlopening action sceneskeletonscene during end creditslong takemanipulationscarexploding bodydie hard scenariomercenarysevered armshot in the armsacrificebattlefieldfreeze framemoonstylized violencestrong female charactercoupleriotpiratedestructionflyingassassination attemptlooking at oneself in a mirrorslow motiontalking animalcagelistening to musicscene during opening creditscatfighthelmetsecurity camerajail cellstealingbeardspiderblockbustergiantjumping from heightclubskulllaserrocket launchercrying manaction heroinemexican standofffemale killergun fucrushed to deathmasked manfull mooncyborganthropomorphismguardrampageremote controlcameohaunted by the pastexplosiveconstruction sitefight to the deathdual wieldhatredanthropomorphic animalshot in the faceimmortalityensemble castfather figuretime lapse photographyexilescene after end creditsmarvel comicspunched in the chestsafeastronautbooby trapaerial shotwisecrack humorsuperheroinebounty hunterdisfigurementsnowingdark pastducktragic herogadgetlaughingarrowlightwilhelm screamclonetelekinesismoral dilemmabraingeniusshot multiple timeslaser gunsurprise after end creditspalaceparking lotsouthern accenttelepathyimprisonmenttorso cut in halftracking deviceleather jacketfemale assassinpractical jokeshot through a windowmale objectificationsaving a lifeenergyface masklevitationfinal showdownreturning character killed offtimebombscene before opening creditssuper strengthgiant monsterblonde womansarcasmportalworld dominationdronecomic reliefshot with an arrowmegalomaniacyoung version of characteratomic bombsuper powersadventure herocrashhired killermisfitjacketcrash landingelectric shockfallinggenetic engineeringwhistlingpatricideheld captivetaking off shirtsuperhero teamhypnotismeyeballasteroidmale protagonistaudio cassettefinal battlecapeteamworkfilmed killingmeteorpart computer animationcountdownmurder attemptrepeated lineawkward situationshape shiftermanipulative behaviortragic pastdance scenegalaxyimmortalfather son reunionsubterraneanjailbreakman on firegodneck braceracial stereotypemind readingpsychotronic filmdeath by gunshotfather son conflictshot through a doorcaverndreadlocksforce fieldraccoonanti heroinewalkmanthronealien creaturespacesuitx rayed skeletonpointing a gun at someonescreaming womanalien racephotowoman woman relationshipestranged fatherregenerationscottish accentlong haired maleslow motion action scenetime bombgadgetrysexual innuendobubblehands tiedmissouripenis jokepassive aggressive behaviorsurprise during end creditsmascotwormholeblond manhuman alienmutinyinvulnerabilityfireworkpassive aggressive womanpsychological manipulationzero gravitybatteryvintagemanipulative womancharacter says i'm sorryone eyed mansquidsocially awkwarddeath by shootingfuneral pyreipodsequel mentioned during end creditstrackertrampland minegiant creatureneon signorbemotional abusetalking to an animalhybridseedhandcuffed womanpulp fictionmarvel entertainmentmockeryspeakertime lapsejet packmarvel cinematic universesibling relationshippac maneternityexplosive decompressionyear 2017freeze to deathbomb explosionfictional planetspace piratevintage carwatching someone sleepblobevil godchoke holdcomplaintfighting in the airfemale chauvinismfemale bullyfemale alienfemale chauvinistlocked in a cageexploding planetfoster fatherracist remarkshape shiftingsleeping on the floorcassette playersideburnshalf humanpurple hairwarrior raceblastgiant squiddistortiongreen skindemi godethnic stereotypewarp speedalien spaceshipjealous womansocial awkwardnessblue skinfemale robotsleeping shirtlessstealbiting someonebubblesviolent manfloating in spaceinterspecies romancecultural differencesgadgetsmisfitsfemale sexistsequel baitingbody suitcountry roadends with funeralfemale mercenarymale alienshirtless malesquadgenetic experimenthuman alien relationshipsevered toeblack suitcoretalking treecosmicfemale bounty hunteractor reprises previous rolegun for hirehuman alien hybridmale bondagefemale sexismchildish behaviormale antagonistsister sister conflictalien organismasteroid beltestranged sistermuscular mansexist remarksister sister fightstarship bridgeanthropomorphic duckarrogant womaneating an insectinterspecies friendshipman tied to a chairreference to mary poppinssitting on the floorskeletal remainswoman fights a womanbad teethbomb timer counting downdrunkenessmechanical handshooting into the airspaceship explosionstan lee cameotelekinetictroll dollalien supervillainectogenfather son fightgenetic modificationhypnotizelaunch codemixtapereference to david hasselhoffsex with objectsony walkmanartificial wombco worker co worker relationshipectogenesisfemale bondagegeodehigh priestessinsigniasister sister hugsmelling clothesthrowing a stonedairy queenfather son talkfather versus sonprotective suitreference to pac manbipedal aliendesintegrationempathfemale green skinned humanoid alienforced landinghalf human half aliennarcissistic womanpassive aggressive manreference to sexsex with an objectsleeping fully clothedspace fleetteam workanti gravitybattle suitcelestialeaten by a monsterend tease for sequelfighter craftreference to heather locklearseedlingshackleshared universe (See All) |
In the year 3028 A.D., Earth is being attacked by the Drej, which are aliens made of pure energy! The Drej mother-ship destroys Earth with an energy beam just as hundreds of space vehicles manage to escape with the last of mankind aboard! One of the escapees is Sam's young son Cale, who carries with … him a ring given to him by his father. Fifteen years later, Cale works on a salvage station, eking out a rough life and hating his father for having disappeared aboard the Titan so long ago. Without a home planet, surviving humans have been reduced to outer space drifters and are constantly bullied and looked down on by other space-faring races. A human captain named Joseph Korso and his pilot Akima seek out Cale and explain that he must help them find the Titan which contains a mechanism that will create a new Earth and therefore unite all of humanity. Meanwhile, the Drej wants to find the Titan so that they can destroy it. With Korso's help, Cale discovers that the ring his father gave to him contains a genetically encoded map to the Titan, and thus begins his race across the universe with Korso and his ship and crew, including Preed, a wisecracking rat-like humanoid, Gune, an eccentric, green-skinned scientist, and Stith, a tough, hard-as-nails weapons expert who resembles something of a kangaroo. Before long, Cale and Akima finds out that Korso is searching for the Titan in order to hand it over to the Drej. (Read More)
| Subgenre: | space operacult film |
| Themes: | space travelescapemurderlovekidnappingbetrayalprisondeceptiondeath of fatherhopegreedapocalypsecourageself sacrificeprison escape …destruction of planet (See All) |
| Mood: | rainnightmare |
| Locations: | space battleouter spacespacehelicopterspace station |
| Characters: | father son relationshipalienhostageprofessor |
| Period: | future |
| Story: | starship captainfemale pilotspace colonyhuman in outer spacefemale warriorescape podterraformingexploding shiphologrammechanicplanetspacecraftcaptainpilotfictional war …spaceshipanti heroshootoutchaseexplosionbare chested malebloodviolencemale rear nudityfightbeatingfistfightrescuebattlebrawlbare buttfalling from heightheld at gunpointbombscientistorphanmapno opening creditsacronym in titledouble crossunderwater scenecreaturedangerelectrocutionmissionringexploding bodyneck breakingloss of fatherlove interestmoonperiod in titleicequestlifting someone into the aircooktoyamerican footballhidingassaultbuttgenocideevacuationlaser gunreflectiontitle ends with periodenergycafeteriafemale fightersarcasmworld dominationbugmegalomaniaccoloradogenetic engineeringreluctant herohandpart computer animationrainbowgalaxyegospacesuitalien racedeoxyribonucleic aciddiasporazero gravityhostilityinfirmaryexodusobstacle coursecolonizationrepairexploding planetpartial nuditywarrior racegreen skinspace adventurehydrogenspaceportearthlingdisplaced personspace junk31st centuryearth destroyedstar mapdestruction of earth (See All) |
In a futuristic society, some people are selected at birth to become soldiers, and trained in such a manner that they become inhuman killing machines. One of the most succesfull and older of these soldiers (Russell) is pitted against a new breed of soldiers, and after the confrontation is believed t …o be dead. His body is left behind in a semi-abandoned colonial planet, where everything is peaceful, and he is taught about the other aspects of life. But eventually he has to fight the new breed of soldiers again, this time to defend his new home... (Read More)
| Subgenre: | martial artscult filmdystopia |
| Themes: | future warspace travelmilitaryescapedeathrevengemurderchristmasherobrutalityredemptioncourage |
| Mood: | rainpoetic justice |
| Locations: | outer spacekitchenhospitalsnowfire and water |
| Characters: | ex soldierwarriortattoosoldierhostagetough guyaction hero |
| Period: | futurechristmas partyyear 1996 |
| Story: | space westernsuper soldiercamouflagegatling gunbroken armveteranplanetspacecraftfictional warspaceshipanti herothroat slittingimpalementshowdownshot in the chest …blood splattershot to deathshootoutexplosionbloodviolenceone word titleflashbackfightdancingtitle spoken by characterknifepistolcryingfistfightmachine gunrescueslow motion scenebattlegunfightbrawlfalling from heightheld at gunpointhand to hand combatcompetitioncombatarmyboxingsnakeexploding carone man armychild in perilgraveyardtrainingone against manyperson on firetankscarneck breakingdie hard scenariobattlefieldmachismomissileuzicard gameburned aliveheavy rainsurvivorsanta claussergeantnosebleedjumping from heightrebellionrocket launchercolonelcrushed to deathpresumed deadgas maskface painttarget practicebraverymercilessnessevacuationpeacecommandomurder of a childeye gougingdisfigurementstabbed in the eyelonerwar veteranflamethrowerburned to deathfemale soldierfinal showdowntimebombwar heroarmored carsuper strengthstrandedalarmweightliftingunconsciousnesswetting pantsgenetic engineeringpunching bagfinal battlefisticuffssuperhuman strengthfacial scaralien planetmilitary trainingshooting rangecolonyhummerextreme close uptear on cheekburning manbitetime bombflame throwersanta claus suitfire fightleft for deadwasteexploding busarmed forcesspace marineexploding planetdust stormfoot racemale soldiermilitary academychild executionhogclimbwet pantspoisonous snakereference to blade runnerhand signalhiding underwatercrash survivorkilling civiliansabandoned airplane (See All) |
In the year 2154, two classes of people exist: the very wealthy, who live on a pristine man-made space station called Elysium, and the rest, who live on an overpopulated, ruined Earth. Secretary Delacourt, a government official, will stop at nothing to enforce anti-immigration laws and preserve the …luxurious lifestyle of the citizens of Elysium. That doesn't stop the people of Earth from trying to get in by any means they can. When unlucky Max is backed into a corner, he agrees to take on a daunting mission that, if successful, will not only save his life but could bring equality to these polarized worlds. (Read More)
| Subgenre: | martial artsheistdystopiacyberpunkallegorychrist allegory |
| Themes: | robberydeathfriendshipmurderkidnappingrapebetrayalpoliticsdrinkingtorturesadismsurveillancehome invasionchildhoodself sacrifice …police brutalityartificial intelligenceunlikely heroradiationutopiafear of deathman versus robot (See All) |
| Mood: | gore |
| Locations: | outer spacespacehospitalswimming poolhelicopterlos angeles californiabuselevatorcityrooftopearthslumspace station |
| Characters: | thiefdoctormother daughter relationshipfriendtattoosingergirlpolice officernursehostagetough guyinterracial relationshipvillainsecretaryemployer employee relationship …daughteryounger version of characterdeath of herohuman versus robotmother and daughter (See All) |
| Period: | future22nd century |
| Story: | spaceship crashhuman in outer spaceearth viewed from spacebody armormegacorporationexploding shipsmugglerbroken armhologramtrappedandroidspacecraftgrenadeloyaltydeath of child …fugitivepiloton the runfictional warspaceshipanti herostabbed in the chestimpalementshot in the backswordface slapshot in the chestblood splattershot to deathshootoutchaseexplosionbare chested malebloodviolenceone word titleflashbackgunfightcigarette smokingphotographtitle spoken by charactersingingknifesurprise endingpistolcryingsongfistfightmachine gunmirrorshot in the headshotgunslow motion scenepunched in the facewritten by directordrinkbrawlfalling from heightrifletearsplace name in titlerunningrobotf wordsubjective cameraorphanassassinbound and gaggedmansionstabbingdeath of friendstabbed to deathweaponexploding carnunno opening creditschildchild in perilimmigrationflash forwardcharacter repeating someone else's dialoguemicrophonelocker roomfactorychampagnemissionrace against timebodyguardpresidentpursuitgovernmentexploding bodypiglaptopmercenaryex convictsecret agentclass differencesgraffitisubtitled scenehenchmanterminal illnessak 47pickup trucksurgerymachismomissilehand grenadelooking at oneself in a mirrormachetesociopathlifting someone into the aircomasecurity cameracaptivestabbed in the stomachagentvillainessblockbusterteddy bearorphanagestreet lifesocial commentarybald mangun battleexplosivespanishstabbed in the neckevacuationtitle appears in writingmedicationdeath of protagonistexploding headdark heroassault rifleheartknife fightmurder of a childhealingcapturecanelens flaretragic heroillegal immigrantgrenade launcherlaptop computertracking devicesatellitemarijuana jointstabbed in the handtaserhead blown offarmored carcrutchessarcasmdeportationdronebillionairebroken mirrorhospital bedbearded manhelicopter crashcomputer hackercrash landingspace shuttlefactory workerleukemiadnasense of smellmale protagonistmonitorfight the systemex conparolecorrupt officialsick childhoodiedragging a bodyforce fieldbreaking a mirrorlocketarmorybilingualismhead ripped offregenerationlong haired malemessiahshackrearview mirroroverpopulationbrain surgeryshaky camflash driveman punches a womancoupdark futureparole officerbeer bottlestabbed with a swordhitting a womanstabbed in the bellymissile launchercitizenshipshort haired femaleimplantsouth africanhomeland securityhand gunmale with long hairchildhood flashbackadvanced technologydroidtanning bedclass conflictglass shardshantytownoverturned carair pollutiontalking robotchrist figurehumanoid robotman murders a womansecretary of defensecar fliphooded sweatshirtstabbed with glassprojectile vomitingfuturistic aircrafthuman versus machinepower toolradiation poisoninglong haired manpotted planttattooed manimplanted memoryburkadeath by explosionpower armorecological disasterpost punkindustrial accidentshuttle craftthrowing a bottle2100sdevastated landscapeexo suitset in futuresleeper agentdistorted soundarmouryblurred visionopening creditsoriginal storymissile attackone percenterstabbed with a glass shardstrapped downdownloadmale doctorthreatened suicideearth orbitface blown offjammed doorverticle take off and landing aircraftbloody bandagesitting on a swingchild with leukemiaex criminallong haired womanpointing a gun at someone's headsurveillance dronewoman with long hairbrain machine interfacedefense secretaryexoframefriend killedsaviourscrewdriver the toolsideview mirrorsmelling someone (See All) |
This film is set in 2093 and takes place in the same universe as the 'Alien' movies. A group of explorers, including some archaeologists, are on an "undisclosed" mission. They arrive at a moon trillions of miles away from Earth. The team spot what they believe to be signs of civilization. They go to … investigate and find more than just signs, they find conclusive evidence. But some of them have an ulterior motive for being there, including the Weyland Corporation. They believe that this is where the human race actually came from. Things soon turn from excitement to survival once inside their discovery. (Read More)
| Subgenre: | suspensecult filmmedicalfuturisticsurvival horror |
| Themes: | space travelescapemurdersuicidechristmasbetrayaldrunkennessmonsterfaithself sacrificetechnology |
| Mood: | gorepoetic justice |
| Locations: | outer spacesnowwheelchaircavestormlaboratory |
| Characters: | father daughter relationshipboyfriend girlfriend relationshiptattooself mutilationbiologistself surgery |
| Period: | future |
| Story: | starship captainstarship crewspaceship crashhuman in outer spaceescape podterraformingmegacorporationexploding shipstarshipmercy killingbroken armhologramandroidplanetcaptain …shot in the shoulderpilotspaceshipimpalementshowdownshot in the chestblood splattershot to deathcorpsechaseexplosionbare chested malebloodviolenceflashbackdogpistolshot in the headshotguncamerarobotpianosciencescientistdecapitationsurvivalflashlightold manstrangulationaxemountainbasketballsevered headman with glassesdream sequencecreaturenecklaceperson on fireattackmissionrace against timestatueknocked outchristmas treelightningskeletoninjectioncrossneck breakingpremarital sexmercenarywaterfalldismembermentmoonsurgeryshavingburned aliverevelationhypodermic needlelooking at oneself in a mirrormutilationeccentricskullanimal attackcrushed to deathback from the deadpresumed deadbarefootgash in the facepool tableexploding headinfectionlens flaremutationdeath of loved oneflamethrowerburned to deathprequellaser gundrugged drinktracking devicetombexpeditionsuper strengthgiant monsterstrandedacidmegalomaniacbillionairehead bashed incrash landinggenetic engineeringtentacledeath of boyfrienddisembodied headexplorermicroscopecountdownopen endedalien contactparasitegeneticsalien planetman on firesole survivorimmolationliquidslimespacesuithead ripped offalien racecryogenicsdeoxyribonucleic acidarchaeologistmeaning of lifeflame throwerhuman alienhuman versus alienmedicbiological weaponrunning for your lifealien technologytrapped in spacelifted by the throatmayhemtalking headsandstormgiant creaturetrailer trashred rosegeologistreligion versus sciencegreen bloodlifeboatimpregnationarcheological digbotanistalien possessionkamikazestomach ripped openancient astronautdune buggyxenomorphalien space craftcave paintingsuspended animationshared dreamdust stormplanetariumcrucifix pendantlovecraftianalien parasiteanestheticgod complexcave drawingprobewinchfire axemaintenance manstasisstasis podvideo screenspaceship pilotsterilecaesarean sectioncommandeered vehiclespaceship captainemergency surgeryholographic projectionmedical scannerdecontaminationcross necklacespaceship explosionfinger ringpush upspace voyagehuman body as an alien hoststar mapalien intrusioninternal view of bodyspace expeditionspace helmet (See All) |
Ellen Ripley sacrificed herself to destroy the Company's desires to use the alien queen as a biological weapon. 200 years and seven horrible experiments later, she is resurrected on the USM Auriga using blood samples from Fiorina 161, for the purpose of extracting the alien queen inside her. However …, Ripley's DNA gets mixed up with the Queen's DNA and she begins to develop enhanced strength and reflexes. After a band of smugglers, hired by the government, bring the crew of a hijacked transport to the Auriga, all hell breaks loose when the aliens breed from the hijacked crew escape. When the Auriga is set on automatic pilot back to Earth, it's up to Ripley and the smugglers to stop the Auriga and escape with their lives. And when the Queen's secret was revealed, it exposed a bizarre DNA mix-up that left both Ripley and the queen's genetics intertwined; giving light to an alien that could spell doom for Earth. (Read More)
| Subgenre: | cult filmchrist allegory |
| Themes: | space travelescapebetrayalself sacrifice |
| Mood: | gorepoetic justice |
| Locations: | outer spacespacespace monster |
| Characters: | warriorfemale protagonistaliengay kissalien love |
| Period: | future24th century |
| Story: | female pilotspaceship crashhuman in outer spaceearth viewed from spaceescape podvacuummercy killingeaten alivemechanicandroidspacecraftgrenadepsychicshot in the shoulderpilot …shot in the legspaceshipanti heroimpalementcomputershot in the chestblood splattershot to deathshootoutchaseexplosionf ratedbloodviolencesequelfemale frontal nuditytwo word titlecigarette smokingtitle spoken by characterarcade gameshot in the headpunched in the facefalling from heightrobotscientistf wordbasketballdeath of friendcolon in titleunderwater scenedrowningshot in the foreheadcharacter repeating someone else's dialogueexploding bodyunderwatermercenarygeneralstrong female charactersurgeryhand grenadeburned aliveeggfourth partnosebleedblockbustersevered handstrong female leadbirthblack humoraction heroineinterracial friendshipbloody nosehit in the crotchstabbed in the headexploding headdisembowelmentknife throwingraised middle fingermutationcharacters killed one by onesequel to cult favoriteflamethrowerclonegrenade launcheractress playing multiple rolesstabbed in the handspit in the facetelling someone to shut upselfishnessburnt facegenetic engineeringfemale heroswimming underwaterfriends who live togetherwheelchair boundshot through the mouthsole black character dies clicheparaplegicpart computer animationcountdownmatricidecloninglesbian subtextdreadlocksslimemad doctorregenerationman in a wheelchaircryogenicscaged animalfalling through the floorfloodinghidden gunwoman punching a manreference to santa claushuman alienhuman versus alienstun gunfoot massagenesthuman experimentationtrapped in spaceopening narrationscarred faceskull crushingentrailsexplosive decompressionbreedingimpregnationunderwater photographygiving the fingerlong tonguewoman wearing a thonggene manipulationtalking computerxenomorphrobot as pathosfrozen alivecritique of capitalismcamera shot from inside human bodylaser cutterman kissing manchimerafembotpunch into the cameraknife in the thighbullet dodgingfem bothuman alien hybridspaceship pilotalien dnasleeve gunstarship interiorbreathalyzerfiring two guns simultaneouslyacid burnelongated cry of noalien eggbullet ricochetmasculine character with female nameshooting basketsalien queenfisheye lens (See All) |
Douglas Quaid is haunted by a recurring dream about a journey to Mars. He hopes to find out more about this dream and buys a holiday at Rekall Inc. where they sell implanted memories. But something goes wrong with the memory implantation and he remembers being a secret agent fighting against the evi …l Mars administrator Cohaagen. Now the story really begins and it's a rollercoaster ride until the massive end of the movie. (Read More)
| Subgenre: | cult filmblack comedyconspiracydystopiacyberpunk |
| Themes: | space travelmurdersurrealismbetrayalmemorycorruptionparanoiaredemptionamnesiautopia |
| Mood: | gorenightmarecar chaseambiguous endingpoetic justice |
| Locations: | outer spacebarhoteltaxielevatortaxi driverbrothel |
| Characters: | prostitutealientough guyaction herointerracial relationshipsecurity guardpolice shootout |
| Period: | future21st century |
| Story: | space colonyterraformingmegacorporationhologramkicked in the crotchresistanceandroidpsychicshot in the shoulderon the runfictional warspaceshipanti herostabbed in the chestimpalement …good versus evilshot in the backshowdownface slapshot in the chestblood splattershot to deathcorpsedreamshootoutchaseexplosionbare chested malefemale nudityviolencefemale frontal nuditytwo word titletitle spoken by characterknifesurprise endingpistolfistfightmachine gunpunched in the faceheld at gunpointhand to hand combatrobothandcuffsfoot chasewomanstabbed to deathsubwayexploding cardream sequenceone man armyhit by a carbreast fondlingnews reportshot in the foreheadcharacter repeating someone else's dialoguebased on short storypay phoneproduct placementvacationsuitcasekicked in the facetough girlneck breakingratsevered armshot in the armsecret agentmachismouzicatfightmutantvillainessblockbusterrebelrebellioncommercialtowelsocial commentarybar fightblack womandwarfremote controlreverse footageconstruction sitestabbed in the throatfalling to deathaquariumexploding headjumping through a windowraised middle fingermineaxe murdermutationgadgetlyingtelepathypilltracking devicehappy endingoppressionlatinaminingbrainwashingconstruction workerspit in the faceblack maninterracial kissone linerman punching a womanmale protagonistcrotch grabstabbed in the facedeformitywoman slaps a manmind readingcolonyfamous linehusband murders wifemars the planetspacesuitx rayed skeletonasphyxiationman dressed as womandecoywoman punching a manalien technologytaxi ridewoman shot in the foreheadmartial lawpunched in the crotchsafe deposit boxsweatingoxygengeneratorreference to george washingtonfalse memorycold blooded murderexplosive decompressionhuman shielderased memoryvirtualityman disguised as a womancatacombsevered limbvideo telephoneimplanted memorydrilling machinesimulated realityfuturistic trainlack of oxygenmutant human2080scredits as currencyfemale mutantself driving carholographic decoythree breasted womantotal recalltunnel boring machinemutant woman (See All) |
This theatrical movie based on the television series (which was also based on a popular multiform robot toyline) did not go over very well at the box office. The movie takes place in 2005, twenty years after the television series, and chronicles the efforts of the heroic Autobots to defend their hom …eworld Cybertron from the evil Decepticons. Both factions are seething with anger, and that hatred has blinded them to a hideous menace headed their way. That hideous menace is the colossal planet known as Unicron, who has been ready to consume anything that stands in its way. The only thing that can stop Unicron is the Autobot Matrix of Leadership, which is possessed by the Autobots and which the Decepticons, through Unicron's orders, plan to take away from them. (Read More)
| Subgenre: | martial artsindependent filmcult filmtragedy2d animationchrist allegory |
| Themes: | future warspace travelescapedeathfriendshipmurderkidnappingbetrayaltortureherodeceptionredemptionsadismfaithexecution …hopecrueltycourageself sacrificetechnologynear death experiencedestruction of planet (See All) |
| Mood: | animedarkness |
| Locations: | space fightspace battleouter spacetraincarhelicoptermotorcyclecityshiptrucklaboratoryspace station |
| Characters: | warriorfather son relationshipsoldieralienvillainself destruct |
| Period: | future2000s21st centuryyear 2005 |
| Story: | human in outer spacefemale warriorescape podexploding shipstarshipeaten aliveandroidmind controlplanetspacecraftheroinefictional warspaceshipgood versus evilshowdown …swordcomputershot in the chestshot to deathcorpseshootoutchaseexplosionviolencesequelgunfightsurprise endingsongfistfightrescuebattlegunfightbrawlhand to hand combatrobotcombatscientistdecapitationspysurvivalsword fightbased on comic bookambushaxedisguisedeath of friendmixed martial artsweaponsevered headchild in perilhit by a cardouble crossunderwater scenecreaturetransformationbased on tv serieselectrocutionrace against timetankmanipulationexploding bodydarkufobattlefieldmoonpickup truckmissileropedestinydestructionflyingelectronic music scorejail cellfaked deathlasergenocidehonorend of the worldcrushed to deathback from the deaddinosaurpresumed deadalien invasionfloodtelescopebraveryfight to the deathdual wieldhatredresurrectionshopping mallprophecypsychotronicfather figurecapturesports carlaser gunbased on toytracking deviceheroismunderdogfemale soldiergiant robotreturning character killed offkendojunkyardfemale fightergiant monsteracidcrownbased on cartooncrash landingfighter jetspace shuttleresponsibilityspace warlightsabersword fightingslingshothigh techalien contactoctopusalien planetshapeshiftingchosen onefamous linethronekiller robotleadershipmessiahbombardmentalien technologyplanet earthsquidcircular sawcoronationexploding planeswordplayoutrunning explosiontransforming robotmissile launcherrobot as menacerobot as pathosrobot versus robotcassette playertalking robotwarrior raceevil robotalien robotrobot suitalien civilizationfuturistic aircraftactor voicing multiple charactersalien worldsentient robotmoon baseautobotfuturistic caroptimus prime the characterdecepticonexo suittransformer robotbumblebee the charactermegatron the charactermock trialspeaking in rhymemechanical lifeformalien spacecraftautobot versus decepticonhuman allypsychadelic imagerobot dinosaurfemale autobotfemale transformerironhide the charactertentacled alienarcee the charactercybertron the planetdinobotliving planetmatrix of leadershipultra magnus the character (See All) |
The Imperial Forces, under orders from cruel Darth Vader, hold Princess Leia hostage in their efforts to quell the rebellion against the Galactic Empire. Luke Skywalker and Han Solo, captain of the Millennium Falcon, work together with the companionable droid duo R2-D2 and C-3PO to rescue the beauti …ful princess, help the Rebel Alliance and restore freedom and justice to the Galaxy. (Read More)
| Subgenre: | space operamartial artscult filmsword and sorceryepicstop motion animationdisneyscience fantasycult classic |
| Themes: | space travelfreedomescapemurdersuicideprisonmonsterheroangertheftevildisabilityjusticecourageself sacrifice …prison escapedestruction of planet (See All) |
| Mood: | poetic justice |
| Locations: | space battleouter spacespacebardesertelevatorfarmshipspace stationcanyonspace ship |
| Characters: | brother sister relationshiphusband wife relationshipfamily relationshipssoldieralienhostagetough guyaction herohitmansniperuncle nephew relationshipaunt nephew relationshipmysterious villainrobot human relationship |
| Period: | future1970s |
| Story: | spacecraft cockpitspace westernhuman in outer spaceescape podexploding shipstarshipsmugglerhologramandroidmind controlplanetspacecraftheroinecaptainpilot …fictional warspaceshipanti herogood versus evilswordcomputershootoutchasenumber in titleviolencesequeltwo word titlegunkissfightrescueslow motion scenebattlegunfightmaskhand to hand combatinterrogationnumbered sequelrobotcombatsubjective camerafoot chasebandsword fightambushstrangulationdisguisedeath of friendcolon in titlemixed martial artsprisonerweapondinnerno opening creditsdisarming someonecontroversycreatureprincessduelbinocularsattackcharacter's point of view camera shotmissiontough girlskeletonfarmerneck breakingsevered armgeneraltwinhyphen in titledestinysabotagespiritmass murderhelmetlifting someone into the airjail cellroman numeral in titlestealingbeardfourth parttwinscaucasianassaultblockbusterimpersonationrebelpart of trilogyrebellionknightlaserhomegenocidehonorbar fightreverse footagesandteamsuper villainpeacehypnosisbounty hunterinsultfamily dinnerrescue missionsword duelwilhelm screamtelekinesissmokeunclelaser guntelepathyunderdogtranslatorextraterrestrialswordsmansunsetfemale fightergovernoremperormedalgunslingerfilm starts with textreluctant herospace warmale protagonistfriends who live togetherlightsaberburnt bodyempirefamous scoreorchestral music scoregalaxyloss of familyvictoryaerial combatpsychotronic filmhermitfamous linealien creaturealien racetotalitarianismrewardhumannomadalternate versionsagacult figurehooded figurejet fightersword and planetangrylifted by the throathangarheld hostagesand dunelifting an adult into the airthe forcedistractionscavengertroubled productioncastle thundersupervillainweapon of mass destructioncloakpleadingwuxia fictionincestuous kissgun fightfictional planetcantinanumber in character's namegalactic warjedilifting a male into the airancient astronautangry mandroidexploding planetinvented languageabysslaser cannonstormtroopertalking robotdesert planetfraternal twinsstorm trooperhumanoid robotlaser weaponfamous opening themehuman android relationshipsuper weaponwarp speedblastercult favoritedeath starmultiple versionswmdleather glovesremake of japanese filmhyperspacestarfightermale aliensymphonic music scorelightsaber battleshot with a laser gunfarmboytractor beamwookieedeath rayevil empiresingle shotspaceportcrash sitestarship interiorcharacter says i have a bad feeling about thiscomputer systemdarth vadermale antagonistflying shipholographic projectionleitmotifopening creditsstarship bridgehuman malenon humanhuman femaleinterspecies relationshipmedal ceremonyspace pilottie fighterastromech droidgun under a tablehandheld communicatorjedi mind trickmillennium falconprincess heroinecruiserplanet viewed from outer spacer2 d2x wing starfightercharacter says may the force be with youhuman beingprotocol droidrebel basestar destroyerstarship battleworld destructiondeep voicedesert landscapegold robothovercarlong time agorebel starshipscanimatestarfighter pilottrash compactorx wingblaster pistoldroid human relationshipforce chokeimperial star destroyerimperial starshipimperial stormtrooperinnocent deaths avengedred blade lightsabershared universestarfighter cockpitwarrior culture (See All) |
Almost eleven years after the futile and disastrous expedition on the distant moon LV-223, the deep-space colonisation vessel Covenant equipped with more than 2,000 colonists in cryogenic hibernation, sets a course for the remote planet Origae-6 with the intention to build a new world. Instead, a ro …gue transmission will entice the crew to a nearby habitable small planet which resembles The Earth. The unsuspecting members of Covenant will have to cope with biological foes, beyond human comprehension. Ultimately, what was intended as a peaceful exploratory mission, will soon turn into a desperate rescue operation deep into the cold infinite space. (Read More)
| Subgenre: | suspensetragedycreature featurefuturisticsurvival horrorbody horror |
| Themes: | space travelfuneralescapedeathmurderbetrayalfearmonsterdeceptionangerbrutalityparanoiainsanitysadismfaith …surveillancedeath of wifepanicnear death experienceartificial intelligenceunlikely hero (See All) |
| Mood: | gore |
| Locations: | outer spacespaceforestwoodscavelaboratorysex in shower |
| Characters: | doctorhusband wife relationshiphomosexualsoldieralienhostagegay kissinterracial relationshipsnipersniper rifleengineerbabe scientistship captainbiologist |
| Period: | future |
| Story: | space westernspace explorationfemale warriorterraforminginterracial marriagehologrameaten alivemechanicandroidplanetspacecraftloss of friendcaptainpilotspaceship …stabbed in the chestimpalementshot in the backshowdownshot in the chestblood splattershot to deathcorpsefirechaseexplosionbare chested malefemale nuditybloodmale nudityviolencebare breastssequelflashbackmale rear nuditytwo word titlegunsex scenefemale rear nudityfightcigarette smokingphotographknifesurprise endingpistolshowertopless female nuditybeatingfistfightmachine gunurinationshot in the headshotgunrescueslow motion scenepunched in the facecamerabrawlbare buttfalling from heightpaintingheld at gunpointsecond partrobotpianoriverscientistf wordsubjective cameradecapitationsurvivalflashlightstrangulationaxemassacremountaindeath of friendwidowsevered headradiodisarming someonedouble crosscreaturecigar smokinglatex glovestraininggravebeaten to deathdangerstabbed in the backprologuescreamingwidowerperson on firecharacter's point of view camera shotmissionactor playing multiple rolesrace against timestatuetough girllightningskeletonscartragic eventexploding bodydeath of husbandlaptopneck breakingsuspicionmercenarywaterfallobscene finger gesturecult directorshavingbulletburned aliveheavy rainegglooking at oneself in a mirrorsociopathscene during opening creditshelmetviruscowboy hatsecurity cameramad scientistloss of loved onebeardsergeantloss of wifebarefoot malesevered handlasergenocidecrushed to deathmexicanpresumed deadrampagefight to the deathmercilessnessstabbed in the neckevacuationexploding headpunched in the chestassault rifledisembowelmentinfectionaerial shotrainstormraised middle fingerhomoeroticismfemale doctormale male kissloss of husbandcharacters killed one by onelasersightsequel to cult favoritekilling spreedeath of loved onetank topburned to deathmoral dilemmaprequelgrenade launchertracking deviceclose up of eyesinterrupted sexfemale soldiersuffocationextraterrestrialexpeditionfinal showdownfire extinguisherreturning character killed offvomithead blown offarmored carsuper strengthtwist endingacidburnt facehurricanepartial female nuditycrash landingreluctant herooffscreen killingaltered version of studio logoquarantineparasitewoman fights a mandistrustsubterraneansole survivormass graveflare gunbulldozerceocreationismstupid victimvillain not really dead clichearmoryalien creaturespacesuitsecret roomcryogenicsscrollkilled during sexarchaeologisthuman alienbiological weaponbritish actor playing american characteralien technologytrapped in spacehumanoidsuper computervideo recordinggay subtexthomoeroticdisobeying ordersinfirmarycolonizationbiohazardsecret laboratoryblood vomitingexplosive decompressionembryospacewalkrobot as menacexenomorphalien space craftsuspended animationrobot as pathosreference to richard wagnerhole in chestsignallovecraftianalien parasitewheatcamera shot from inside human bodyface burnfemale mechanicprequel and sequelreference to lord byronshockwavewoman wearing a tank topecologistfemale mercenaryrecorderhelmet camerastasisreference to john miltoncutting own hairdereliction of dutyhomosexual couple2100spathogenspace colonizationsuffocated to deathreference to john denverneutrinoreference to michaelangeloreference to percy bysshe shelleychest ripped open (See All) |
Luke Skywalker, Han Solo, Princess Leia and Chewbacca face attack by the Imperial forces and its AT-AT walkers on the ice planet Hoth. While Han and Leia escape in the Millennium Falcon, Luke travels to Dagobah in search of Yoda. Only with the Jedi master's help will Luke survive when the dark side …of the Force beckons him into the ultimate duel with Darth Vader. (Read More)
| Subgenre: | space operacult filmtragedyepicstop motion animationfamily sagacult classic |
| Themes: | space travelescapefriendshipbetrayalghosttorturemonsterheroanger |
| Locations: | space battleouter spacespacesnowcave |
| Characters: | warriorbrother sister relationshipfamily relationshipsfather son relationshipafrican americansoldieralienaction herovillainteacher student relationship |
| Period: | future |
| Story: | starship captainspacecraft cockpithuman in outer spacefemale warriorstarshipsmugglerhologrameaten aliveandroidplanetspacecraftpilotfictional warspaceshipgood versus evil …showdowncomputershootoutfireexplosionnumber in titlebloodviolencesequelkissfightsurprise endingpistolpunctuation in titlerescuebattlegunfightfalling from heighthand to hand combatsecond partnumbered sequelrobotfightingcombatsubjective cameradecapitationsword fightambushstrangulationbridgeweaponno opening creditsdisarming someonecreaturevoice overprincesstrainingdueltreepuppetspiritualityattackcharacter's point of view camera shotgeneraltwindismembermentbattlefieldpowercivil warclaim in titledestinyslow motionroman numeral in titletwinscaucasianblockbusterrebelsevered handpart of trilogyrebellionlasergun fucannonvisionblood on faceconfrontationevacuationmentorswampprisoner of warfogbounty huntercapturerescue missionsword duelbruisefifth partsecret identitywilhelm screamtelekinesislaser gunfemale soldiergroupswordsmankendofemale fighterwar heroquick drawemperorgunslingerhanging upside downcameo appearanceknocked unconsciouscrash landingfallingspace shuttlefighter pilotreluctant heropremonitionspace warasteroidfriends who live togetherlightsaberempirefamous scoreflameopen endedorchestral music scoreroman numbered sequeladmiralarm cut offglaciertrapdooraerial combatresistance fightergogglesalien creaturealien racehumantragic villainhung upside downsagacult figurecustodyhand cut offfrozen bodytransportangrylaser beamfire fightprosthetic limbsteamstudent teacher relationshipfrozenthe forcejedi knightsearch partysupervillainbountypleadingentrailssunken shipfictional planetblood on mouthgalactic warjedipsychokinesisangry mandroidpaternity revealedflamessecret baseabyssfree fallstormtroopertalking robotfraternal twinsupside downstorm troopergreen skinhumanoid robotsnowy landscapecooperationgiant wormleather glovesbad guy winshyperspacemandalorianstarfighterimagerymale aliensymphonic music scorebad guys winprobe droidsparkswookieecommand centerevil empirefloating citymausercharacter says i have a bad feeling about thiscounter attackleitmotifmedical carestarship bridgehuman maleat st walkerhuman femalemauser c96 pistoltie fighterastromech droidfar far awayfather son fightmauser pistolmillennium falconplanet viewed from outer spacer2 d2x wing starfighterbounty huntersfamous twistprotocol droidrebel basestar destroyerat at walkerdeep voicegold robotlong time agoloss of handrebel starshipsnowy planetstarfighter pilottransport starshipx wingblaster pistolgr 75 medium transportimperial star destroyerimperial starshipimperial stormtrooperred blade lightsaberstarfighter cockpit (See All) |
On the day of James Kirk's birth, his father dies on his damaged starship in a last stand against a Romulan mining vessel looking for Ambassador Spock, who in this time, has grown on Vulcan disdained by his neighbors for his half-human heritage. 25 years later, James T. Kirk has grown into a young r …ebellious troublemaker. Challenged by Captain Christopher Pike to realize his potential in Starfleet, he comes to annoy academy instructors like Commander Spock. Suddenly, there is an emergency on Vulcan and the newly-commissioned USS Enterprise is crewed with promising cadets like Nyota Uhura, Hikaru Sulu, Pavel Chekov and even Kirk himself, thanks to Leonard McCoy's medical trickery. Together, this crew will have an adventure in the final frontier where the old legend is altered forever as a new version of the legend begins. (Read More)
| Subgenre: | space operaalternate history |
| Themes: | space travelunrequited loverevengekidnappingpregnancytorturedrunkennessdeath of fatherdeath of mothertime travelredemptiondeath of wifevengeancecheatingself sacrifice …unlikely friendshipdestruction of planet (See All) |
| Locations: | space battleouter spacespacebarcarsnowmotorcycleelevatorwheelchaircavesan francisco californiabar brawlcar motorcycle chasedrinking at bar |
| Characters: | warriordoctorhusband wife relationshipfather son relationshipmother son relationshipteenagertattooalienhostagetough guyaction herobullyinterracial relationshiprussianpolice chase …engineerpregnant wifealien lovefirst officeralien villain (See All) |
| Period: | future23rd century24th century |
| Story: | starship captainmale captainhuman in outer spaceescape podexploding shipstarshiphologramplanetspacecraftcaptainfictional warspaceshipanti heroimpalementgood versus evil …computershot in the chestshot to deathshootoutexplosionflashbacktwo word titlekissfightpantiesbeatingfistfightpunched in the facefalling from heighthand to hand combatbrawomanwhite pantiesdrivingno opening creditspart of seriescreaturetrainingargumentcharacter repeating someone else's dialoguebased on tv seriesstabbed in the backproduct placementconvertibleinjectionchildbirthexploding bodyautomobilesadnessloss of fatherpremarital sexloss of motherkissing while having sexredheadicedestinyburned alivemass murderhidingloss of wifeblockbusterdriving a carbirthlasergenocideend of the worldcrushed to deathbar fightapplealien invasionbra and pantiesnicknamebloody noseministerchaospunched in the stomachevacuationfalling to deathparachutelens flarelieutenantloss of husbandprequelteleportationinterrupted sexgiving birthgirl in bra and pantiesstar trekbully comeuppancemegalomaniacyoung version of characterno title at beginningcommandermedalwoman in bra and pantiesblizzardquarrelsimulationwheelchair boundfamous scorehiding under a beddrillfully clothed sexmotorcycle copgolden gate bridgeiowawhite bramind readingbreaking a bottle over someone's headfinger gungiant animalalien creatureman in a wheelchairscottish accentskydivinghumanscotalternate timelinecourt trialexpectant fatherwormholehuman alienchevroletblack holeorigin of herointerspecies sexlifted by the throatvaccinered carsedativeanti villainalternate universebased on cult favoriteoutpostgreen bloodfear of flyinginterracial loveklingonchild driving a carhumanoid aliensex with alienvintage carchevrolet corvettecadetstabbed through the chestcar falling off a cliffchoke holdseat beltfake illnessfemale alieneleventh parttime paradoxbaby bornwishing someone good luckgreen skinlaser weaponsupernovasuper weaponwarp speedalien civilizationattempted strangulationcult favoriteeating an applefaking illnessphaserreboot of seriesvulcangroundedmaroonedjoyridephoton torpedoescopped feelenterprise the starshipfemale humanoid alienre bootromulanimplosionchoking someoneice cavemeeting future selfdereliction of dutyshuttle crafthuman alien hybridnew borntransamerica pyramiddamaged starshipearthlingstarship interiorcar over a cliffpreludesex with an alien womanbloody lipstarship bridgehuman malealien predatorhuman femaleoral examterraneating applefailed parachuteolder version of selfhuman vulcan manvaporizationvulcan womanhuman alien sexual relationshuman beinginjection into one's neckmalcontentvulcan manfemale green skinned humanoid alienhalf human half aliensnowy planetchicken racehandheld phaserhelmsmanimitating the firing of a gunwarp engine (See All) |
In the 24th century, the crew of the Enterprise-E has been ordered to patrol the Romulan Neutral Zone by the Federation to avoid interference with their battle against the insidious Borg. Witnessing the loss of the battle, Captain Jean-Luc Picard ignores orders and takes command of the fleet engagin …g the Borg. But the Borg plan to travel back into the 21st century through a vortex with the intention to stop Earth's first contact with an alien race (the Vulcans). Following the Borg sphere, Picard and his crew realize that they have taken over the Enterprise in order to carry out their mission. Their only chance to do away with the Borg and their seductive queen is to make sure that Zefram Cochrane makes his famous faster-than-light travel to the stars. (Read More)
| Subgenre: | space operacult filmpost apocalypsealternate history |
| Themes: | escaperevengekidnappingdrunkennessdeceptionobsessiontime travelvengeanceradiation |
| Mood: | nightmare |
| Locations: | space battleouter spacebarforestnightclub |
| Characters: | doctoralienhostagealcoholicengineerself destruct |
| Period: | 21st century24th century |
| Story: | starship captainmale captainhuman in outer spaceescape podexploding shipmercy killingphysicianhologramandroidmind controlspacecraftcaptainshot in the shoulderfictional warspaceship …good versus evilshot in the backshot in the chestshot to deathexplosionbloodsequelflashbackdogcigarette smokingtitle spoken by charactersurprise endingmachine gunheld at gunpointrock musicrobotscientistdisguisefour word titlecolon in titletransformationbased on tv serieselectrocutionattackrace against timestatuedirected by starneck breakingsevered armfaintingvirtual realitylaserend of the worldcyborgwhiskeyalien invasiontelescopeinvasioninventorpool tablestabbed in the neckshot in the faceeye gougingfemale doctorlieutenantmutationlasersightsequel to cult favoritewilhelm screamteleportationlaser gunstar trekjukeboxdronecommanderspace shuttlegenetic engineeringspace wardisembodied headbladealien contactadmiralcommuneretributiontommy gunmontanaspacesuitalien racealternate timelinesagainvulnerabilitybased on cult tv serieseighth partnuclear missileplanet earthstowawayworld war threeray gunvortexparadoxcubecounsellordrunk womanbackwards time travelsphereklingonassimilationradiation sicknessspacewalkrobot as menaceback in timereference to moby dickrobot as pathosunderground bunkergenetic mutationdisintegrationcyberneticswarp speedphaservulcanweightlessnessfirst contacttakeoverchanging the futurepost thermonuclear wararm amputationexperimental technologyinfrared visionmale alienphoton torpedoesenterprise the starshipdereliction of dutyexploding starshipmoby dick2060sborglieutenant commandergenetic manipulationstarfleet captainfederation starshipartificial lifeformfemale medical doctorfemale physicianearth orbitchief medical officerholodeckkiller cyborgsickbayu.s.s. enterprise ncc 1701 ehandheld phaserklingon manklingon starfleet officermale klingonsovereign class starship (See All) |
A young boy learns that he has extraordinary powers and is not of this Earth. As a young man, he journeys to discover where he came from and what he was sent here to do. But the hero in him must emerge if he is to save the world from annihilation and become the symbol of hope for all mankind.
| Subgenre: | martial artscoming of agesuperheroepicchrist allegory |
| Themes: | space travelsupernatural powermilitaryescaperevengedeathmurderkidnappingtorturedeath of fatherhopeadoptionapocalypseself sacrificeartificial intelligence …alien abductiondestruction of planet (See All) |
| Locations: | space battleouter spacebarrestaurantschoolchurchhotelhelicoptersnowcemeterysmall townairplanedesertfarmcanada …truckgas stationlaboratoryschool busschool teacherfishing boatspace shiphumvee (See All) |
| Characters: | warriorpriesthusband wife relationshipfather son relationshipmother son relationshipsoldieralienhostagetough guyaction herobullywaitressprofessoremployer employee relationshipfisherman …engineeru.s. soldieralien superhero (See All) |
| Period: | 2010s |
| Story: | earth viewed from spacespace explorationescape podterraformingexploding shipmercy killinggatling gunhologramplanetspacecraftcaptainfictional warspaceshipstabbed in the chestimpalement …good versus evilshowdownshot in the chestshot to deathshootoutfirechaseexplosionbare chested maleviolencesequelinterviewflashbackdogfightphotographknifethree word titlesurprise endingpistolcell phonebeatingfistfightmachine gunshot in the headrescueslow motion scenepunched in the facebattlearrestgunfightbrawlfalling from heightbased on comichand to hand combatcar crashinterrogationrobothandcuffscriminalcombatscientistreporternewspaperorphanjournalistbased on comic bookbridgearmystabbed to deathmixed martial artsdinernonlinear timelineexploding carman with glassesno opening creditsone man armyassassinationchild in perilunderwater scenecreaturenews reportone against manybinocularscharacter repeating someone else's dialoguecostumefbiperson on firecharacter's point of view camera shotproduct placementrace against timetentkicked in the facetankskeletonbankfarmeramerican flaginjectionchildbirthexploding bodydeath of husbandlaptopneck breakingfirst partgeneralufobattlefieldmooncivil waricemissilewaiterflyinghead butthelmetbarnfbi agentexploding buildingkicked in the stomachvillainessblockbusterjumping from heightskulllaserend of the worldhitchhikerfalse identitycolonelcrushed to deathhitchhikinggas maskalien invasiondamsel in distressu.s. armyconstruction sitefight to the deathmercilessnesspower outage3 dimensionalchaosfalling to deathpunched in the chestjumping through a windowthrown through a windowassault rifletitle at the endlonerlens flarefemale reportersecret identitydc comicsferrywilhelm screamexploding helicoptertelekinesislaser gunmedia coveragetelepathyimprisonmentsatelliteheroismfemale soldieryellingdrifterhiding in a closetassumed identitysuper strengthfake identityworld dominationbully comeuppancefarmhousemegalomaniacyoung version of characterno title at beginningtornadohelicopter crashcornfieldcrash landingfighter jetexploding truckfighter pilotgenetic engineeringreluctant heroadopted soncrashing through a windowman punching a womanspace warmale protagonistaltered version of studio logofinal battlecapetwo way mirroralien contactalien planetkansasbutt slappolar bearspitting bloodcoup d'etatmind readingu.s. air forceexploding airplanefetuslifting person in airnewspaper reporterspacesuitwar criminalx rayed skeletonalien racefictional citybudweisertruckerfemale journalistcryogenicsdeoxyribonucleic acidinvestigative reportermoney falling through the airwoman punching a maninfantnewspaper editorbank vaultsuit of armorhuman alienhuman versus aliensuper speedblack holeinvulnerabilityorigin of herorestraintbritish actor playing american characterclothes lineair strikelifted by the throatsuperhumancollapsing buildinghumanoidexploding planedrink thrown into someone's facerebootwoman in laboroil rigcouncilhuman skulluh 1 huey helicopteranti villainflying manfoster parentsupervillainoutpostsuper villainessfamily farmsurrogate familyadoptive fatherthrown through a wallfighting in the airancient astronautinside the mindamerican midwestexploding gasoline stationexploding planetnewspaper officeuh 60 blackhawk helicopteradoptive mothercostumed herohumanity in perilch 47 chinook helicopterdestroyed cityred capedc extended universepirate broadcastingalien civilizationreboot of seriescaped superherosaturn the planetflying superherox ray visionoil platformexploding traineditor in chiefre bootfalling objectimplosiontree swingpopulation controlextraterrestrial humanrocket launch33 year oldextraterrestrial manspace capsulestarship interioralien starshipfemale supervillainm1 abrams tankguided missilecodexblow outmetropolis the cityalien supervillaincatching someone who fallsectogenplane crashing into a buildingsikorsky sh 3 sea king helicopterartificial wombectogenesisoh 6 cayuse helicopterc 17 globemasterfairchild republic a 10 thunderbolt iiflying supervillainlockheed martin boeing f 22 raptorextraterrestrial womanfalling debris (See All) |
After young Katniss Everdeen agrees to be the symbol of rebellion, the Mockingjay, she tries to return Peeta to his normal state, tries to get to the Capitol, and tries to deal with the battles coming her way...but all for her main goal: assassinating President Snow and returning peace to the Distri …cts of Panem. As her squad starts to get smaller and smaller, will she make it to the Capitol? Will she get revenge on Snow or will her target change? Will she be with her "Star-Crossed Lover," Peeta, or her long-time friend, Gale? Deaths, bombs, bow and arrows, a love triangle, hope... What will happen? (Read More)
| Subgenre: | suspensecoming of agepost apocalypsedystopiaepiccyberpunkchrist allegorydystopian future |
| Themes: | future warmilitaryescapedeathrevengemurderlovebetrayalpoliticsfearweddingdeceptionbrutalityparanoiasurveillance …executionhopepaniccouragerevolutionself sacrificenear death experience (See All) |
| Locations: | hospitaltrainforestsnowairplanewaterwoodswheelchairmuseumtunnelsewerwar zone |
| Characters: | warriordoctorteenagermother daughter relationshiptattoofemale protagonistsoldiernursehostagesister sister relationshiptough guyaction herofilmmakerengineer |
| Period: | future |
| Story: | female warriormass deathalliancemercy killinghologramresistancetensionmind controlchild murderdeath of childfugitiveon the runfictional waranti herostabbed in the chest …suicide attemptimpalementgood versus evilshowdownshot in the chestshot to deathcorpseshootoutfirechaseexplosionf ratedbased on novelviolencesequelkissfightdancingphotographknifepistolfistfightmachine gunshot in the headrescueslow motion scenecatbattlegunfightbrawlfalling from heightletterrifleheld at gunpointbombcombatscientistsurvivalfoot chaseflashlightambushstrangulationmountaindisguisemansionarmystabbed to deathsubwaymapexploding carfalse accusationno opening creditschild in perildouble crosscreaturefemme fatalenews reportflash forwarddangerstabbed in the backperson on fireattackmissionknocked outtough girltanklong takemanipulationpresidentexploding bodymercenaryshot in the armrefugeeclass differencesbattlefieldstrong female characterriotcivil wardestinydestructionbow and arrowrevelationspearwarehouseheavy rainpropagandamutantloss of loved oneexploding buildingfourth partrebelrebellionstrong female leadgenociderocket launcheraction heroineanimal attackmexican standoffsocial commentarypresumed deadguardfloodexplosivebraverycrossbowchaosmuteevacuationpost traumatic stress disorderstabbed in the headoilassault riflebooby trapdeath of sisteraerial shotparachutecommandotitle at the endeye gougingcapturefemale doctorlieutenantdeath of loved oneflamethrowerdictatorsign languagewar crimemoral dilemmashaved headmedia coveragepalacedrugged drinkrockettracking devicememory lossfemale soldierabandoned buildingoppressionanti warreturning character killed offbrainwashingfemale fighterwar violencearmored carfilm crewabandoned houseshot with an arrowbunkercameramancommandercommando unitanarchygreenhousecommando missioncoughingmilitary basereluctant herobehind enemy linesarenaoffscreen killingepiloguebullet woundfight the systemsole black character dies clichefilmed killingcamcordertwo way mirrorarcherairfieldaircraftdistrustsubterraneansymbolcoup d'etatone woman armyuprisingfreedom fighterresistance fighterwanted posteranimal killingchosen onefade to blackanti heroineassassination plotsocial decayarmoryinnocent person killedsurveillance footagetotalitarianismfictional countryscreenplay adapted by authormedicbombardmentman fights a womanrepressed memorycorporalguerilla warfarecollapsing buildingemaciationshaky camblockadedark futuredisobeying orderslast of seriesbased on young adult novelcaught in a netanti villainstar died before releaseinsubordinationpublic executionminefieldrebel leadercargo planepoisoned drinksobbingwhite rosepirate broadcastingabandoned citycasualty of warbookshelfteenage heroinedeath of cast membersuicide pillself destruct mechanismfuturistic traintragic heroineaid workerfemale archerstrapped to a beddisintegrating body (See All) |
The space transport vessel "Hunter-Gratzner" carrying 40 people on-board crashes on a desert planet when the ship is struck in a meteor storm. There are only 11 survivors, among them are pilot Carolyn Fry (Who has assumed command after the ship's captain is killed), bounty hunter William J. Johns, r …eligious man Abu Al-Walid, Antiques dealer Paris P. Ogilvie, runaway teenager Jack, settlers John 'Zeke' Ezekiel and his lover Sharon 'Shazza' Montgomery, and Richard B. Riddick, a dangerous escaped convict. Marooned, the survivors discover the barren and hot desert-scape has sunlight from three suns. Not only must they find food and water and worry about Riddick, the survivors find themselves being hunted by the planet's flesh-eating alien inhabitants when the planet is engulfed in darkness, which happens every 22 years, as they emerge from underground to hunt and eat all signs of life. Fry and the survivors find Riddick is their best chance of survival, as Riddick has surgically-enhanced eyes that allow him to see in the dark as they set out to find a way of escaping from the planet and getting to a escape shuttle, before they all get eaten by the creatures on the surface. (Read More)
| Subgenre: | martial artsindependent filmcult film |
| Themes: | space travelescapemurdermonsterheroguilt |
| Mood: | goreraindarkness |
| Locations: | outer spacespace |
| Characters: | warriorpriestalientough guyaction hero |
| Period: | future |
| Story: | human in outer spacebroken armeaten aliveplanetspacecraftcaptaindeath of childpilotspaceshipanti herostabbed in the chestimpalementshot in the backshowdownblood splatter …shot to deathcorpseshootoutfirechasebloodviolenceflashbackfightkniferescuepunched in the facebattlegunfightheld at gunpointhand to hand combatalcoholfightingcriminalcombatsubjective cameradecapitationsurvivalfoot chaseflashlightstrangulationstabbed to deathmixed martial artsprisonerno opening creditsone man armychild in perilone against manydrug addictstabbed in the backkicked in the faceskeletonneck breakingfirst partthreatened with a knifeburned alivereverse footagedark herobounty hunterlens flaretragic herolightmain character diestorso cut in halfmolotov cocktailnight visionflaskcrash landingalien planetmorphinemass murderercometgogglesalien creaturebloody body of a childeclipsefire breathingtrapped in spacetied to a postbody torn apartshaving headlock of hairimamxenomorphdesert planethibernationchild eatencopycatwoman dressed as a mandislocated shoulderhead bitten offhuman baitstasis podneedle in eyeplanetary alignmentdamaged starshipshanknocturnal27th centuryalien predatorskiffchild killed by an animalcult male charactercrashed starship (See All) |
The mercenary Royce; the military Isabelle; the Russian soldier Nikolai; the San Quentin criminal Stans; the Sierra Leone militia Mombasa; the drug lord Cuchillo; the Yakuza Hanzo; and the Doctor Edwin awake in free fall but they succeed to open their parachutes landing in a jungle. Soon they find t …hat they are on another planet and they are prey of aliens in a deadly hunting game, and they need to join forces to destroy their predators and survive. (Read More)
| Subgenre: | suspensemartial artssurvival horror |
| Themes: | militaryescapedeathrevengemurdersuicidekidnappingbetrayalfearmonsterdeceptionpsychopathbrutalityparanoiaredemption …insanitypanicself sacrificehuntingalien abduction (See All) |
| Mood: | gore |
| Locations: | outer spaceforestwoodsjunglespace ship |
| Characters: | ex soldierwarriordoctortattoosoldierserial killeralienhostagetough guyaction herohitmankillerjapanesesniperrussian …sniper rifleevil doctoralien monster (See All) |
| Story: | female warriorbody armorexploding shipgatling gunplanetspacecraftshot in the shoulderevil manspaceshipanti heroimpalementshot in the backswordshot in the chestblood splatter …shot to deathcorpseshootoutfirechaseexplosionbare chested malebloodviolenceone word titlesequelphotographtitle spoken by characterknifesurprise endingpistolmachine gunshot in the headshotgunrescueslow motion scenepunched in the facebattlegunfightfalling from heightvomitingheld at gunpointcriminalcombatf wordsubjective cameradecapitationsurvivalfoot chaseassassinsword fightambushstabbed to deathsevered headman with glassesno opening creditsone man armydouble crosscreaturethird partcharacter repeating someone else's dialoguedangerelectrocutionpoisoncharacter's point of view camera shotkicked in the facetough girlskeletonexploding bodytrapthreatened with a knifemercenarywaterfallsevered armsubtitled scenetrustbattlefieldstrong female characterak 47africanuzihand grenadekilling an animalhead buttmachetecagesurvivorlifting someone into the airhunternosebleedskulllaseraction heroineanimal attackswitchbladesevered fingerfight to the deathdual wieldstabbed in the throatmercilessnesspunched in the stomachshot in the facefalling to deathensemble castspecial forcesdark herobooby trapparachuteconvictyakuzaminedark pastfieldtragic herosevered legcharacters killed one by onelasersightmoral dilemmaprequeltorso cut in halffemale assassinfemale soldierinvisibilityextraterrestrialkatanaparalysiswhistlefalling into waterimaginary friendflarehanging upside downhuntscalpelcrash landingpredatorstabbed in the shoulderteamworkopen endedtragic pastalien planetmasked villainone woman armyflare gundragging a bodydreadlocksanti heroinealien creaturehead ripped offmad doctoralien racetalking to oneselfbear trapwoman punching a manfalling off a cliffhuman versus alienmost dangerous gamereference to ernest hemingwayhand through chestblack opsbaitgame of deathskinned aliveenforcerjungle warfaregreen bloodhuman preycontemplating suicideinfra redstabbed through the chestfalling down a hillminigunstabbed through the chinfilm with ambiguous titlecovered in mudelectro magnetic pulsefree fallhole in chestwarrior racemonster versus monstertoxinvoice imitationgrabbed by the throatleg blown offalien hunterinfrared visioninvisibility cloakshivfemale sniperdeath row inmateinvisible monsterstabbed through backhunting peopletied to a stakealien predatoralien weaponalien versus alienpoisonous plantprequel to sequelspine rippingfalling into a pithuman hunted down for sporthunted peoplesnare trapaircraft explosion (See All) |
One of the few remaining drone repairmen assigned to Earth, its surface devastated after decades of war with the alien Scavs, discovers a crashed spacecraft with contents that bring into question everything he believed about the war, and may even put the fate of mankind in his hands.
| Subgenre: | suspensemartial artspost apocalypsemelodramadystopiacyberpunk |
| Themes: | space traveldeathmurdersurrealismdeceptionmemorysurveillanceamnesiaself sacrificeartificial intelligence |
| Mood: | nightmare |
| Locations: | outer spacenew york cityswimming poolforestmotorcycledesertwoodsspace stationsex in a pool |
| Characters: | ex soldierwarriorhusband wife relationshipboyfriend girlfriend relationshipsoldieralienlove trianglesnipersniper rifle |
| Period: | future |
| Story: | spaceship crashterraformingexploding shiphologramresistanceveteranspacecraftfictional warspaceshipshot in the backshot in the chestshot to deathdreamshootoutexplosion …bare chested malefemale nudityviolenceone word titleflashbackdogkissfightknifesurprise endingpistolshowervoice over narrationfistfightmachine gunshot in the headwritten by directorbattlegunfightbrawlpaintinghand to hand combatrobotcombatbased on comic bookambushno opening creditsdrawingcigar smokingskinny dippingbinocularskarateelectrocutionlightningopening action sceneexploding bodypremarital sexthreatened with a knifewaterfallkissing while having sexredheadwashington d.c.strong female characterrevelationelectronic music scorelasermexican standoffwhite housesocial commentaryalien invasiontelescopeblack and white sceneastronautbooby trapknife fightstadiumlasersightcloneengagement ringnasanarrated by characterbrooklyn bridgedroneskyscraperhanging upside downcrash landingspace shuttlegenetic engineeringcabin in the woodsswimming underwaterchewing gumaltered version of studio logofight the systemnuclear bombaircraftcloningnuclear explosionresistance fighterpentagonspacesuittear on cheekvinylstarts with narrationone last jobmushroom cloudhuman versus alienempire state building manhattan new york citystray dogmotorcycle ridingfriendly firewashington monumenttwo in a showererased memoryrappellingshot in the bellyair battlefemale astronautcryonicsjet aircraftromantic rejectionfighting with selfhuman cloneneo 80s2070smemory gamesunderwater kissmaintenancemid air collisionmemory erasureyankees baseball capabandoned librarygoalpostwhitehouse (See All) |
The second "Highlander" movie, again with Christopher Lambert and Sean Connery. It's the year 2024 and all the ozone above Earth has gone. To protect people from dying, MacLeod helped in the construction of a giant "shield", several years ago. But, since there isn't left anyone Immortal after MacLeo …d's victory in the previous film, he has stopped being an Immortal himself. Now he is just an old man, until one day some other Immortals arrive on our planet. You see, the Immortals come from another planet... (Read More)
| Subgenre: | martial artsindependent filmcult filmblack comedyconspiracydark comedyb moviesword and sorcerydystopiafish out of watercyberpunkswashbucklersword and fantasycorporate conspiracy |
| Themes: | future warsupernatural powerdeathrevengemurderdrunkennessherodeceptionpsychopathterrorismsurveillanceself sacrifice |
| Mood: | gorerain |
| Locations: | outer spacenew york citybartrainchurchairplanedeserttaxielevatorapartmentpolice carcavetaxi drivertrain accident |
| Characters: | warriordoctoralienactortough guyaction herosecurity guardengineersamurai swordself healing |
| Period: | future1990snear future2020s |
| Story: | female warriorkatana swordmegacorporationresistanceplanetevil manfugitivefictional waranti herogood versus evilshowdownswordshot in the chestblood splattershot to death …corpseshootoutfirechaseexplosionnumber in titlebloodviolencesequelflashbackkisscigarette smokingphotographsurprise endingpistolpunctuation in titlefistfightmachine gunblondepunched in the facebattlegunfightfalling from heightsecond partrevolvercombatscientistdecapitationoperaassassinsword fightambushterroristdeath of friendmontagemixed martial artssubwaysnakeexploding carsevered headdisarming someoneone man armypolice officer killednews reportbartendertrainingflash forwardtheaterlimousineone against manyprologueelectrocutionstatuecover uptough girlbodyguardexploding bodyneck breakingmercenarygenerallove interestbattlefieldfreeze framehenchmanflyinghead buttassassination attemptsociopathfaintingsecurity cameraroman numeral in titleexploding buildingfaked deathsocial commentaryback from the deadold ageresurrectionfalling to deathimmortalitymentordark herobooby trapsword duelsequel to cult favoriteteleportationlaser gunsatellitebeheadingextraterrestrialyellingswordsmanterrorist groupkatanareturning character killed offkendofemale fighterspiral staircasejournalcomputer crackerworld dominationurban decayfencingexploding truckhead cut offfight the systemexperiment gone wrongcrotch grabreference to shakespeare's hamletimmortalwarlordtailorfreedom fighterresistance fightersocial decayevil corporationalien raceregenerationmentor protege relationshipglobescotbanishmentcorporate crimehuman aliencorrupt businessmanopera houseamazing grace hymntroubled productiondehydrationfighting in the airancient astronautnight vision binocularsdiving suitastral projectionboardroomlong swordbeheadedhoverboardinsurrectionsolar flareelevator crashozone layerhighlandershot with a laser gunamazing grace the hymn (See All) |
A massive alien spacecraft of enormous power destroys three powerful Klingon cruisers, entering Federation space. Admiral James T. Kirk is ordered to take command of the USS Enterprise for the first time since her historic five-year mission. The Epsilon IX space station alerts the Federation, but th …ey are also destroyed by the alien spacecraft. The only starship in range is the Enterprise--after undergoing a major overhaul at Spacedock on Earth. Kirk rounds up the rest of his crew, and acquires some new members, and sets off to intercept the alien spacecraft. However, it has been there years since Kirk last commanded the Enterprise... is he up to the task of saving Earth? (Read More)
| Subgenre: | space operaepicbiblical allegory |
| Themes: | space travelartificial intelligence |
| Locations: | outer spacespacesan francisco californiaspace station |
| Characters: | doctorfamily relationshipsalienengineer |
| Period: | 23rd century |
| Story: | starship captainmale physicianmale captainhuman in outer spacespace explorationstarshipphysicianandroidplanetspacecraftcaptainsequelcolon in titlefive word titlebased on tv series …first of serieslong takereunionfirst partslow motionblockbusterend of the worldmedical examinationdisfigurementteleportationtelepathystar trekold flamecloudfamous scoreorchestral music scoreadmiralgolden gate bridgespacesuitwormholetrapped in spaceenglish subtitles in originaltroubled productioncastle thunderbased on cult favoritehumanoid alienman versus machinespacewalkhalf breedbald womaninvented languagespace probewarp speedcult favoritephaserreboot of seriesstoicismphoton torpedoesenterprise the starshipfemale humanoid alienscore employs electronic instrumentsshuttle crafthuman alien hybridearthlingstarship interiorleitmotifmedical scannermechanical lifeformpsychedelic imagestarfleet captainfederation starshipmale doctorstarfleet admiralterranartificial lifeformhandheld communicatoroverturespacecraft officerhuman vulcan manconstitution class starshiphuman beingu.s.s. enterprise ncc 1701communicatorhalf human half alienvulcan starfleet officerrelieved of commandu.s.s. enterprisevoyager golden record (See All) |
When the newly-christened starship Enterprise's shakedown cruise goes poorly, Captain Kirk and crew put her into Spacedock for repairs. But an urgent mission interrupts their Earth-bound shore leave. A renegade Vulcan named Sybok has taken three ambassadors hostage on Nimbus III, the Planet of Galac …tic Peace. This event also attracts the attention of a Klingon captain who wants to make a name for himself and sets out to pursue the Enterprise. Sybok's ragtag army captures the Enterprise and takes her on a journey to the center of the galaxy in search of the Supreme Being. (Read More)
| Subgenre: | space operacult film |
| Themes: | space travelsupernatural powerself sacrificecamping |
| Locations: | outer spacedesertcampfiresinging around campfire |
| Characters: | doctorfamily relationshipsbrother brother relationshipdancerreference to godinterracial relationshipengineer |
| Period: | 23rd century |
| Story: | starship captainmale physicianmale captainhuman in outer spacetelepathstarshipphysiciangatling gunmind controlplanetspacecraftcaptainshootoutnumber in titlesequel …flashbackstripperdisguisecolon in titlebased on tv serieselectrocutionwritten and directed by cast memberdirected by starsix word titleroman numeral in titleclubescape attemptlieutenantrescue missionfifth partsequel to cult favoriteteleportationinvisibilitystar trekexotic dancermegalomaniaccommanderclimbinghijackingroman numbered sequeljailbreakadmiralhalf brothersaganational parkfemale bodybuilderbased on cult tv seriesenglish subtitles in originalholding cellmorse codeklingonwarp speedphaservulcanmale alienenglish subtitlesenterprise the starshipromulanshuttle crafthuman alien hybridbrigearthlingstarship interiorlieutenant commanderyosemite national parkstarship bridgestarfleet captainfederation starshipstarfleet admiralterranhandheld communicatorspacecraft officerhuman vulcan manshore leavevulcan womanchief engineerchief medical officerconstitution class starshipklingon bird of preyklingon starshipnational forestvulcan manbodiless entityhalf human half alienreference to the garden of edenshuttlecraftspeaking klingonvulcan starfleet officercloaked starshipklingon manmale klingonthird breastu.s.s. enterprise ncc 1701 a (See All) |
While on a mission to observe the peaceful Ba'ku race, Lt. Commander Data suddenly behaves as if having to fear for his existence. The immortal Ba'ku, whose planet offers regenerative radiation and therefore incredible lifespans, live in harmony with nature and reject advanced technology. Their plan …et and their culture is secretly researched by the Federation associated with an alien race called the Son'a. But the Son'a intend to abduct the Ba'ku in order to take the planet for themselves and for the Starfleet officials who all would like to regenerate their bodies. But they did not think of the loyalty of Captain Jean-Luc Picard and the crew of the Enterprise-E to the Prime Directive. (Read More)
| Subgenre: | space operamartial artscult filmconspiracy |
| Themes: | space travelrevengemurderkidnappingbetrayalvengeance |
| Locations: | space battleouter spacecavesex in a hot tub |
| Characters: | alienhostagealien villain |
| Period: | 24th century |
| Story: | human in outer spaceallianceexploding shiphologramandroidplanetspacecraftloyaltycaptainfictional warspaceshipshootoutchaseexplosionviolence …sequelthree word titlefistfightbattlerobotcombatmountaincolon in titlepart of serieschild in periltransformationbased on tv seriesperson on fireopening action scenekissing while having sexhonorconfrontationimmortalityhot tubdisfigurementfemale doctorsequel to cult favoriteburned to deathpatriotismteleportationlaser guninvisibilitystar trekcommandercorrupt officialadmiralretributionregenerationsagahuman alienbrief nuditybased on cult tv seriesninth partcounsellorinsubordinationklingonhumanoid alienfictional planeteternal youthwarp speedphaserfountain of youthfighting the systeminsurrectionmale alienphoton torpedoesenterprise the starshipfemale humanoid aliendereliction of dutyshuttle craftexploding starshipmemory cardlieutenant commanderfederation starshipstarfleet admiralartificial lifeformfemale medical doctorspacecraft officeru.s.s. enterprise ncc 1701 eklingon starfleet officersovereign class starship (See All) |
Two decades after the freak alien invasion that nearly destroyed mankind a new threat emerges. This Alien mothership is more than twice the size as the last one and once again, the world's armies must band together to save the world. Do they have enough firepower or will this battle change and will …aliens take over? (Read More)
| Subgenre: | suspensefuturisticalternate historydisaster filmscience fantasyforeign language |
| Themes: | space travelmilitaryescapefriendshiprevengedeathmurderprisonfearmonsterdeceptionangerdeath of fatherdeath of motherparanoia …surveillancerivalryhopedeath of wifepanicapocalypsecourageself sacrificetechnologynear death experienceartificial intelligence (See All) |
| Mood: | nightmare |
| Locations: | space battleouter spacehospitalcarhelicopterparis franceboatdesertlondon englandtaxiafricashipchinataxi driverlaboratory …school busearthfishing boat (See All) |
| Characters: | warriorteenage girldoctorfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipteenagerboyfriend girlfriend relationshiptattoosoldieralienbabylittle girllittle boy …japanesepsychiatristchineseamerican abroaduncle niece relationshipship captainjewish american (See All) |
| Period: | 2010s |
| Story: | female pilotearth viewed from spacefemale warriorbody armorexploding shiphologramplanetspacecraftcaptainpsychicpilotfictional warspaceshipgood versus evilshowdown …computershot in the chestshot to deathshootoutfirechaseexplosionviolencesequeldogkissphotographthree word titlesurprise endingpistolcryingcell phoneurinationshot in the headrescuepunched in the facewatching tvwritten by directorbattlegunfightfalling from heightbookbombsecond partcombatscientistsubjective cameradecapitationsurvivalorphanflashlightambushstrangulationarmywidowprisonerweaponmapexploding cardrivingsevered headno opening creditsradiodisarming someoneunderwater scenecreaturenews reportauthorbinocularscharacter repeating someone else's dialoguedangerstabbed in the backscreaminglocker roomwidowerattackuniformcharacter's point of view camera shotmissionrace against timetentu.s. presidentactor shares first name with characteramerican flagbodyguardpresidentexploding bodyglassesloss of fathercharacter says i love youloss of mothergenerallas vegas nevadasubtitled sceneufobattlefieldwashington d.c.moondisasterdestructionflyingwarehousemachetehelmetcomawalkie talkieloss of loved onebeardexploding buildingblockbusterwristwatchgiantpress conferenceirishskulllaserparadeend of the worldmonkwhite housemilkcannonpresumed deadrampagealien invasionreverse footageshieldfloodvisionbraveryhatredchaosevacuationplanepost traumatic stress disorderensemble castswampamerican presidentaerial shotparachuteraised middle fingerlens flarelieutenantdead motherdeath of loved onelaser gunplanttelepathytracking devicesatelliteheroismshot through a windowtranslatorfighterreturning character killed offunited nationscafeteriaeiffel tower parisarmored cargiant monsterdrunken manshipwreckworld dominationdronecomic reliefmegalomaniacplane crashbunkerretirement homewhisperingflarecrash landingfighter jetmilitary basefighter pilotbehind enemy linestentaclecolonialismunsubtitled foreign languagephysicshumorfinal battlenuclear bombvideo footagehigh techopen endedalien contactnevadasubterraneanfourth of julywarlordsymboldogfightflying saucerminnesotaaerial combatmind readingdiplomatvillain not really dead clicheforce fieldradararmorynuclear weaponsberetbilingualismspacesuitalien racereference to ludwig van beethovendecoyenglishwoman abroaddog tagoathwormholewyomingatlantic oceanbook signingbuddhist monkhuman versus aliensecret service agentbombardmentalien technologyrescue attemptconvoydevastationwalking stickcollapsing buildingcircular sawgiant creatureexploding planeorbdefensedisobeying orderscouncilham radioshipping containerphone conversationsuicide missionmothershipoutrunning explosionelectromagnetic pulseclicheabandoned shiparea 51green bloodbridge collapsespherefemale psychiatristchild driving a carcratercargo shipindependence dayexploding planetuh 60 blackhawk helicoptercirclecontainerhumanity in perillaser cannonwaking up from a comasalvagetower bridge londongiant wavealien civilizationamateur radiodistress signalgroundedmagnetismsaturn the planetplane shot downvideoconferencingejection seatfemale presidentalien intelligenceex presidentexterminationcoreharvestingmoon baseair force oneear piecemagnetic fielddeath of stepfatherspaceporthiveoath of officeaerial battlecollapsing bridgehiding underwaterexoskeletonhumbleflyoverspace debrisabandoned boatcapsizing shipex pilotgearing uppilot ejectsalien queenanti gravityfighter craft (See All) |
| Subgenre: | martial artscoming of ageblack comedysupernaturalsword and sorcerydark fantasysword and fantasychrist allegoryrevisionist history |
| Themes: | supernatural powerrobberyfuneralescaperevengedeathfriendshipmurdersurrealismkidnappingmoneybetrayaljealousyprisonfear …monsterdeceptionmagicangerdeath of fatherbrutalitydeath of motherparanoiaredemptionexecutionhopedeath of wifepaniccourageself sacrificemythology (See All) |
| Mood: | rainnightmaredarkness |
| Locations: | forestboatlondon englandwatervillagewoodsenglandlakeshipcastlecavebrothelsewer |
| Characters: | warriorthiefbrother sister relationshiphusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattoobrother brother relationshipprostitutesoldierhostagetough guyaction herolittle boy …maidwitchuncle nephew relationshipmermaidself doubt (See All) |
| Story: | resistanceeaten alivemind controlcaptainshot in the shoulderevil manfugitiveon the runshot in the legfictional waranti herostabbed in the chestthroat slittingimpalementgood versus evil …shot in the backshowdownswordshot in the chestblood splattershot to deathcorpsefirechaseexplosionbare chested malecharacter name in titlebloodviolenceflashbackdogfighttitle spoken by characterknifesurprise endingbased on bookbeatingfistfighthorseshot in the headrescueslow motion scenepunched in the facewritten by directorbattlebrawlfalling from heighthand to hand combatinterrogationdemonprostitutionbritishislandriverfightingcombatsubjective cameradecapitationspyfoot chaseorphancandlegangambushstrangulationaxemassacredisguisemontagebridgearmystabbed to deathmixed martial artsprisonermapsnakenonlinear timelinesevered headdisarming someoneone man armychild in perilritualunderwater scenekingcreaturefemme fataletransformationtrainingone against manylegendcharacter repeating someone else's dialoguebeaten to deathdangerstabbed in the backscreamingattackpoisoncharacter's point of view camera shotknocked outopening action scenemanipulationscarexploding bodyloss of fatherratthreatened with a knifewaterfallsevered armloss of motherprofanityshot in the armgeneralqueenarsonbattlefieldpowerfreeze framestylized violencehenchmanriottraitorfalling down stairssabotagewolfdestructionbow and arrowburned alivehead buttspearassassination attemptfaintingscene during opening creditshelmetslaveryroyaltyelephantjail cellmagicianbeardsergeantkicked in the stomachloss of wifenosebleedblockbustergiantpoolrebeljumping from heightrebellionknightcgifollowing someonetorchanimal attackinterracial friendshipcrushed to deathscammasked manslaveguarddwarfreverse footageshieldcameohaunted by the pastnicknamevisiontarget practiceexplosivebraveryblood on facedual wieldhatredimpostormercilessnesschaosshot in the facedeath threatprophecyrowboatstabbed in the headmentorstabbed in the legpunched in the chestcon artistdark heromedieval timesoutlawaerial shotdungeonwisecrack humordisfigurementknife throwingraiddark pastdemonic possessionkingdomtragic heroblack magicburned to deathcoinpatriotismfast motion scenepalacebullet timebatdoppelgangeroppressionswordsmandirector cameoface maskhistorical fictionfighterfinal showdownfolklorebag over headmusclemanstrongmanscene before opening creditssuper strengthtowerfireballhuman sacrificevikingshot with an arrowyoung version of characterarcherycrownidealismfemale spycommanderfortresshanging upside downsorcerertavernbellfilm starts with textreluctant heroman kills a womantyrantaltered version of studio logofight the systemheirburnt bodyshot in the throatpart computer animationarcherrighteous ragetragic pastmiddle agessubterraneanjailbreaksorceresscoup d'etatcockney accentbo staffflashback within a flashbackresistance fighteralternate dimensionscytheanimal killingchosen onekicking in a doorassassination plotgiant animalglowing eyeshawkthronefratricideburning buildingtotalitarianismslow motion action scenechild swearingjumping from a rooftophands tiedsevered earsuper speedorigin of heroflaming arrowbaronstabbed in the sidetyrannybrandysnorricamsquidcollapsing buildingwarlockdefectorfuneral pyrecoronationcatapultturned to stonebare knuckle fightinggunpowdergiant snakeking arthurbattering ramslave laborspear throwingmartial arts schoolpublic executionevil sorcerervenompyrokinesisstabbed through the chestcamelotcovered in mudevil kingexcaliburwrecking ballarthurian legendmagehanged bodygiant squidashman with a ponytailtunicround tableflaming swordburning villagegiant ratsnake venomchild slaverylancelotcollapsing bridgeknights of the round tablegiant batgrafittiheir to thronemartial arts instructormagic sword (See All) |
The Earth was ravaged by the Formics, an alien race seemingly determined to destroy humanity. Fifty years later, the people of Earth remain banded together to prevent their own annihilation from this technologically superior alien species. Ender Wiggin, a quiet but brilliant boy, may become the savi …or of the human race. He is separated from his beloved sister and his terrifying brother and brought to battle school in orbit around earth. He will be tested and honed into an empathetic killer who begins to despise what he does as he learns to fight in hopes of saving Earth and his family. (Read More)
| Subgenre: | space operamartial artsindependent filmcoming of age |
| Themes: | space travelmilitarydeathrevengefriendshipdeceptiondysfunctional familyredemptionbullyingself sacrificeregret |
| Locations: | space battleouter spacebaseballcavelaboratoryspace stationmilitary school |
| Characters: | warriorbrother sister relationshipteenage girlfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipchildrentattoobrother brother relationshipboyteenage boyteacher …soldieralienbullyfacial tattoo (See All) |
| Period: | future |
| Story: | human in outer spaceearth viewed from spaceexploding shiphologramplanetspacecraftshot in the legfictional warspaceshipshot in the backshot in the chestdreamexplosionbare chested malecharacter name in title …based on novelviolencetwo word titlefightsurprise endingshowervoice over narrationbeatingfistfightwritten by directorbattlebrawlmaskletterhand to hand combathallucinationfightingsubjective camerastrangulationmontagearmysnakeno opening creditschild in periltrainingcharacter repeating someone else's dialoguecharacter's point of view camera shotcover upmanipulationstrong female charactericegamedestructioneggpropagandahelmetcomasergeantenemykicked in the stomachfaked deathstrong female leadteenage protagonistgenocidecolonelpresumed deadalien invasionchild's point of viewinvasionanimated sequencechild protagonistpunched in the stomachmentorsibling rivalryparachutee mailtitle at the endlens flarelieutenantlaser guntelepathyclose up of eyesfemale soldieranti warcafeteriawar heroremorsedronemajorbully comeuppancecommanderpush upsquitting a jobfighter jetmilitary basespace shuttlefighter pilotsimulationmonitoralien planetadmiraldogfightmind readingvideo gameclose up of eyeteenage herospacesuitchild prodigycryogenicssimulation gameleadershiphuman versus alienbombardmentzero gravitymaoriexploding planestudent teacher relationshipbased on young adult novelreference to napoleoninfirmaryoutpostsleep deprivationfilm starts with quotenew zealanderkamikazewar gamebasic trainingexploding planetreference to julius caesarreflection in eyetwisted anklemilitary academyejection seatchild geniusbrother against brotherdysfunctional societyspace navyalien egginsectoid alienpre adolescent (See All) |
After a joyous wedding between William Riker and Deanna Troi, Captain Picard and the Enterprise crew stumble upon a mysterious signal which results in it being a prototype android who is the twin to Data. Then the Enterprise is invited to Romulus to negotiate peace with the Romulans by their new Pra …etor named Shinzon. However, Shinzon is revealed to be a clone of Picard who was raised on Remus, a slave planet to the Romulans. Later on, Picard discovers that this peace treaty was nothing more than a set-up due to the fact that Shinzon needs Picard in order to survive. But little do the Enterprise crew know that Shinzon also plans to do away with the Federation by unleashing a weapon that could destroy a whole planet. (Read More)
| Subgenre: | space opera |
| Themes: | future wargriefescapedeathkidnappingweddingself sacrificeradiation |
| Locations: | space battleouter spacespacedesertearth |
| Characters: | doctoralienlittle boydeath of hero |
| Period: | future24th century |
| Story: | human in outer spacehologramandroidmind controlplanetspacecraftcaptainfictional warspaceshipimpalementcomputershootoutexplosionsexblood …violencesequelflashbackdancingphotographsingingknifethree word titlecryingrescuegunfightfalling from heighthand to hand combatcandlecolon in titleweaponsevered headno opening creditsassassinationgunshotmicrophoneuniformmissionpursuitsevered armdestinyhypodermic needleimpersonationlossrebellionbridetorchslavecelebrationguardremote controlshieldstarsenatorfemale doctorminegadgetclonewedding receptionteleportationmusic bandtelepathyinvisibilityreturning character killed offseries finalestar trekalarmhoneymoonmegalomaniaccommandersecuritymaking outcameo appearancetoastambassadoruniversednaspace wargroommonitorskymicroscopegalaxycloningadmiralforce fieldpet cattorpedosagametropolissolar systemsenatetenth parthumanoidgeneratorblood testcounsellorbased on cult favoriteklingonexplosive decompressionspacewalkmachineryoff roadtrombonespeciescult favoritephaserchartlinguistpsychic linkmale alienphoton torpedoesromulanspear through chestshuttle craftpartingviceroydamaged starshipfederationlieutenant commanderholographic projectionreference to irving berlintorsocloaked shipfederation starshipstarfleet admiralartificial lifeformfemale commanderfemale medical doctortransporterhuman alien teamvelocitystarship battlematerializationpsychic rapestarship versus starshipu.s.s. enterprise ncc 1701 eklingon starfleet officerlethal radiationsovereign class starship (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
| Subgenre: | suspenseindependent filmcult filmblack comedyb moviecreature featuresurvival horrormonster movie |
| Themes: | space travelsupernatural powerescapedeathmurderlovesurrealismkidnappingfeardrunkennessmonsterdeceptionparanoiahome invasionpanic …couragenear death experience (See All) |
| Mood: | satirenight |
| Locations: | outer spacekitchenbarchurchhelicoptersmall townbicyclepolice stationfarmpolice carrooftopbicycle accident |
| Characters: | priestbrother sister relationshipteenage girlhusband wife relationshipfamily relationshipsfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshippolice officeralienhostagelittle boy …alcoholicsheriffalien monster (See All) |
| Period: | 1980s |
| Story: | earth viewed from spaceexploding shipbroken armhologrameaten alivemechanicspacecraftfugitivespaceshipimpalementshot in the chestblood splattershot to deathcorpsefire …explosionbloodviolenceone word titlecigarette smokingphotographtitle spoken by characterknifesurprise endingcar accidentshotgunrescueslow motion scenewatching tvcatrifleheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomflashlightambushaxetoiletradiochild in perilcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batlightningprankexploding bodyfirst partfireworkscowsubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail celleccentricphone boothlasersocial commentarybroken legredneckwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterone daybounty huntersiegebowlingdead boymutationlaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding housekansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverchild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All) |
200 years in the future a Martian police unit is dispatched to transport a dangerous prisoner from a mining outpost back to justice. But when the team arrives they find the town deserted and some of the inhabitants possessed by the former inhabitants of the planet.
| Subgenre: | martial arts |
| Themes: | robberydeathmurdersuicidedrugsghostdrunkennessdeceptionseductioninsanityghost town |
| Mood: | gore |
| Locations: | outer spacetrainpolice station |
| Characters: | policebrother brother relationshipzombieself mutilation |
| Period: | future22nd century |
| Story: | space westernterraformingoutnumberedplanetgrenadeanti herostabbed in the chestthroat slittingimpalementshot in the backshowdownshot in the chestblood splattershot to deathcorpse …shootoutexplosionbloodviolenceflashbackgunfightknifepistolfistfightmachine gunblondeshot in the headshotgunpunched in the facegunfightbrawlheld at gunpointhand to hand combatjailhallucinationdecapitationsurvivalgangmassacremountainstabbingdeath of friendwomanstabbed to deathmixed martial artssevered headkingpolice officer killedbeaten to deathperson on fireuniformpossessionknocked outexploding bodydie hard scenariosevered armcult directordismembermentnipples visible through clothingelectronic music scoretold in flashbacksevered fingerfight to the deathgash in the faceslaughterloss of brotherminingblonde womanatomic bombfinger cut offnuclearminerarcheologisthot air balloonmarsbreaking through a doorflashback within a flashbackcavernmars the planetleg woundpolicewoman killinghung upside downcut armhuman versus alienmartianmusic score composed by directorsevered facehandcuffed womanbattering ramdumb criminalhit with a rifle buttnuclear reactorlocked in a closetalien possessionclimbing up a wallhead on a stakethrown from a trainpolice station attackfuturistic trainpunch into the camerabody possessionalien organismmatriarchal societyfemale dominated societyrock music score (See All) |
A young girl (Baby Doll) is locked away in a mental asylum by her abusive stepfather where she will undergo a lobotomy in five days' time. Faced with unimaginable odds, she retreats to a fantastical world in her imagination where she and four other female inmates at the asylum, plot to escape the fa …cility. The lines between reality and fantasy blur as Baby Doll and her four companions, as well as a mysterious guide, fight to retrieve the five items they need that will allow them to break free from their captors before it's too late... (Read More)
| Subgenre: | martial artscult filmtragedysteampunkcaper |
| Themes: | funeralescapedeathmurdersurrealismbetrayaldancegangstersurveillanceself sacrificesamurai |
| Mood: | satire |
| Locations: | kitchentrainhelicoptersnowbuscastlestrip clubbrothelbus driverbus stationtrain explosion |
| Characters: | warriorpriestdoctorpoliceprostitutefemale protagonistzombiesoldierpolice officerdancerhostagesister sister relationshipsecurity guardteacher student relationship …snipermayorsniper riflepimp (See All) |
| Story: | female pilotfemale warriorkatana swordgatling gunhologramplanetshot in the shoulderevil manshot in the legstabbed in the chestthroat slittingshot in the backswordface slapshot in the chest …blood splattershot to deathcorpsedreamshootoutfirechaseexplosionf ratedbloodviolenceflashbacktwo word titlegundancingknifesurprise endingpistolvoice over narrationmachine gunshot in the headshotgunrescueslow motion scenepunched in the facebattlearrestfalling from heightrifleheld at gunpointhand to hand combatbombbathroomrobotdemonprostitutionhallucinationhandcuffscombatdecapitationfoot chaseflashlightcandlesword fightdeath of friendstabbed to deathmapnonlinear timelinechild abusesevered headno opening creditsradiocoffincreaturecigar smokingshot in the foreheadstabbed in the backprologuekeymini skirtmissiondragonrace against timekicked in the faceattempted rapeexploding bodyworld war onethreatened with a knifesilencerbattlefieldmissilebow and arrowkilling an animalheavy rainsexual abusecooksecurity cameratemplekicked in the stomachtherapistgiantlaserrocket launcherrapistanimal attackback from the deadgas maskcyborgmental institutiondiamondimaginationexplosivecrossbowgash in the facestabbed in the neckresurrectionshot in the facemental hospitalstabbed in the headthunderstormstabbed in the legpunched in the chestschool uniformsexploitationdynamiteaccidental killingdeath of sisterblack eyealternate realityschoolgirl uniformstabbed in the eyedressing roomsevered leglaser gunbullet timecrowtorso cut in halfclose up of eyesfemale assassingiant robotkatanafire extinguisherswastikamolotov cocktailtimebombspit in the facefemale bondingpistol whipsuper strengthalarmmini dresslighterstepfatherplane crashflareinsane asylumshot in the eyeblackboardshort skirtshot point blankguardiantop secretbomberforgeryfighter planebiplaneexploding airplaneclimbing out a windowknocked out with a gun buttalice in wonderlandtrenchstarts with narrationdojosexual predatorvermontcovert operationdark heroinebody torn apartfemale empowermentminiskirtpunched in the crotchextreme closeupexploding planefire breathing dragonlobotomyeye candylooking through a keyholeblimpkicked in the ballsstomach ripped openinside the mindescapeegirl gangescape plantelescopic rifleexploding trainflying dragonaerial bombardmentdream sequence within a dream sequenceknocked out with gun buttdesk bellhit with a gun butthit on the head with a riflehuman versus dragonbody landing on carmaster keythigh high sockstriplanesliding down a drain pipe (See All) |
John Carter, a Civil War veteran, who in 1868 was trying to live a normal life, is "asked" by the Army to join, but he refuses so he is locked up. He escapes, and is pursued. Eventually they run into some Indians, and there's a gunfight. Carter seeks refuge in a cave. While there, he encounters some …one who is holding some kind of medallion. When Carter touches it, he finds himself in a place where he can leap incredible heights, among other things. He later encounters beings he has never seen before. He meets a woman who helps him to discover that he is on Mars, and he learns there's some kind of unrest going on. (Read More)
| Subgenre: | space operamartial artssword and sorcerysteampunkswashbucklersword and fantasychrist allegoryscience fantasy |
| Themes: | space travelsupernatural powerescapedeathkidnappingmarriageweddingmonsterherodeception |
| Locations: | space battleouter spacenew york citybardesertcavewedding party |
| Characters: | ex soldierwarriorfather daughter relationshipsoldieralienhostagelawyertough guyaction heronative americanalien love |
| Period: | 19th century1860s1870s |
| Story: | space westernfemale warriorexploding shipveteranmind controlspacecraftcaptainfictional warspaceshipgood versus evilshot in the backshowdownswordshootoutchase …explosionbare chested malecharacter name in titlebased on novelviolenceflashbacktwo word titlefighttitle spoken by characterknifesurprise endingpistolvoice over narrationfistfighthorseurinationrescuebattlearrestgunfightbrawlrifleheld at gunpointhand to hand combatrevolvercombatscientistsword fightmassacredisguisemansionarmymixed martial artsnonlinear timelineno opening creditsone man armykingcreatureprincessbartendertough girlopening action sceneskeletondiarybare chested male bondagesubtitled scenebattlefieldprincecivil wargoldsabotagebow and arrowspearheavy rainquesttold in flashbackjail cellgiantimpersonationsevered handfaked deathlasercolonelbar fightindianu.s. armydual wield3 dimensionalescape attemptbutlerjumping through a windowarizonatitle at the endlens flarewar veterantelekinesisteleportationchallengelaser gunpalacetelepathytombfemale fighterworld dominationmegalomaniacplane crashraftamerican civil warleadervirginiachainedtelegramsuperhuman strengthgladiatorjumpingshapeshiftingmarsdigging a gravereturning homeaerial combatforced marriagechosen oneforce fieldpitalien raceloinclothhorse chasemedallionjail breaksolar systembrandinghuman alienhuman versus aliensuper speedsword and planetsandstormmartianmorphingminionpulp fictionwalking in the raingreen bloodbare chested male fightingbegins with narrationgold barfighting in the airspyglassu.s. civil warchained to a wallair battleshape shifting alienchest hairwarrior racearizona territorycivil war veteranescape from jailfighting womenblue bloodarmy captainu.s. cavalrylocked in jailpaddle boattwo on a horsehatching eggbranding ironarmy colonelcease fireapache tribebased on pulp magazineearthlingurinating on the groundsilver dollarhuman malemale nipplefighting arenacity statesmack upside the headstealing a horsesword held to throatyear 1881egg hatchingurinating on the floorex army officerlow gravitytroop transportcaged maleyear 1868 (See All) |
King Roland of the planet Druidia is trying to marry his daughter Princess Vespa to Prince Valium, but Vespa is kidnapped by the evil race of the Spaceballs. The Spaceballs ask Roland a tremendous ransom: all the air of Druidia (you see, the air of Spaceball had serious pollution problems...). The K …ing decides to offer a generous amount of money to a space rogue, Lone Starr, to persuade him to save Vespa. What follows is the parody of a _LOT_ of famous SF movies. (Read More)
| Subgenre: | space operacult filmsci fi spoofparody of cult film |
| Themes: | space travelkidnappingmarriageweddingherocouragetechnologyunlikely hero |
| Mood: | satirespoofparodybreaking the fourth wallstar wars spoof |
| Locations: | space battleouter spacespacedesertshipexplosion in space |
| Characters: | alienhostagevillainteacher student relationshipself referentialself destructself cannibalism |
| Story: | human in outer spacespace explorationescape podsmugglerandroidplanetspacecraftspaceshipgood versus evilshootoutchaseone word titlekisstitle spoken by character …surprise endingurinationblonderescuebattleshootingrobotsubjective cameracleavagesword fightweaponbrunetteman with glasseskingcreatureprincessduelwritten and directed by cast membercharacter's point of view camera shotactor playing multiple rolespresidentfilm within a filmobscene finger gesturecult directorufolifting someone into the airred dresscowboy hatalien invasiondamsel in distressbraverypsychotronicsexy womanflamethrowerwilhelm screamteleportationextraterrestrialcowboy bootsstatue of liberty new york cityspace warrole reversalfriends who live togethersword fightinghigh techalien contactshapeshiftingshot in the crotchcanceled weddinglifting female in airalien technologylifting an adult into the airswordplayrich snobtransforming robotmotor homeinfra reddeliberate crueltyxenomorphalien space crafttalking robotdesert planetwarp speedalien civilizationwinnebagofemale robottransformerfembotpantingfem botwedding ceremony gone awrymedium breastsbreasts bouncingspace cowboygold robotneuschwanstein castle (See All) |
Nick Fury is the director of S.H.I.E.L.D., an international peace-keeping agency. The agency is a who's who of Marvel Super Heroes, with Iron Man, The Incredible Hulk, Thor, Captain America, Hawkeye and Black Widow. When global security is threatened by Loki and his cohorts, Nick Fury and his team w …ill need all their powers to save the world from disaster. (Read More)
| Subgenre: | martial artssuperherofish out of water |
| Themes: | space travelsupernatural powerescaperevengebetrayalmonsterdeceptionredemptionrivalrytechnologyartificial intelligence |
| Locations: | outer spacenew york cityforesthelicopterairplaneelevatorlaboratory |
| Characters: | ex soldierwarriorbrother brother relationshipsoldierpolice officeralienhostagetough guyaction heroreference to godrussiangermanamerican abroadalien superhero |
| Period: | 2010s |
| Story: | female warriorsuper soldierexploding shiphandcuffedgatling gunhologramveteranmind controlspacecraftcaptainfictional warspaceshipanti heroimpalementgood versus evil …shot in the backshot in the chestshootoutchaseexplosionbare chested malesequelflashbacktwo word titlefighttitle spoken by characterknifepistolcell phonebeatingfistfightmachine guncar accidentshot in the headrescuepunched in the facebattlearrestgunfightbrawlfalling from heightmaskbased on comicheld at gunpointhand to hand combatbombcar crashinterrogationrobotmanhattan new york citycombatscientistspyassassinbased on comic bookdisguisedeath of friendarmystabbed to deathmixed martial artsprisonertied to a chairexploding carno opening creditshit by a carnews reporttransformationcharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumeelectrocutionattackcharacter's point of view camera shotmissiontough girllightningbankscene during end creditsstreet shootoutlong takemanipulationgymbodyguardexploding bodyfirst partmercenarysevered armsecret agentsubtitled scenebattlefieldstrong female charactermissilehand grenadesabotagebow and arrowhead buttspearhelmetsecurity camerawalkie talkiehammerexploding buildingblockbustergiantlaserrocket launcheraction heroineorchestramasked manalien invasionshieldcameothunderdual wieldinventor3 dimensionalshot in the faceensemble castscene after end creditsmarvel comicsjumping through a windowthrown through a windowassault rifleknife fightparachutesuperheroineeye gougingbody landing on a cartuxedotied feeteye patchlens flarerescue missionlasersightgovernment agentteleportationgeniuslaser gunrocketfemale assassinimaxinvisibilityreturning character killed offwar herosuper strengthportalworld dominationbrooklyn bridgeplane crasharcherybillionairehelicopter crashsorcererfighter jetexploding truckfighter pilotcrashing through a windowman punching a womanmacguffinsuperhero teampunching bagfinal battleshot in the throathigh techarchertied up while barefootaircraftimmortalmasked heroshapeshiftingaircraft carrierhit with a hammeraerial combatnuclear explosionbanquetforce fieldvillain arrestedworld war two veteranchrysler building manhattan new york cityalien racereturning character with different actorgroup name in titleshot with a bow and arrowcamera focus on female buttbattleshipnuclear threatkneelinghit with a chairsurprise during end creditswormholehuman alienhuman versus aliensuper speedcrushed by a carnuclear missileone eyed mansuper computerexploding planecubehitting a womannational guardflying manmothershipmarvel entertainmentelectromagnetic pulsesupervillainbell 206 jet ranger helicopterexploding busmarvel cinematic universegrand central station manhattan new york cityevil sorcererhumanoid alienlittle black dresscnn reporterpower suitthrown through a walljumping from an airplanefighting in the airalien attackcostumed heroreference to stephen hawkingshape shifting alienhumanity in perilfictional government agencywarrior racered capetitle appears in textsecret government organizationradical transformationrobot suitphilanthropistcaped superherofuturistic aircraftscepterflying superheroadopted brotherejector seatfighting brothersjet aircraftinvisibility cloakmale alienhydratunnel chase scenedisaster in new yorkmuscle growthextraterrestrial humanextraterrestrial manman wearing an eyepatchmarvel comicstuttgart germanyaerial battles.h.i.e.l.d.retina scan fakedflying fortresskolkata indiasuperhero versus superheroalien supervillaincharacter turns greenblack widow the characterhuman alien teambeam of energyalien allyeye scanninghammer as weapontesseracthawkeye the characterhelicarrier (See All) |
After the earth-shattering revelations of INSURGENT, Tris must escape with Four and go beyond the wall enclosing Chicago. For the first time ever, they will leave the only city and family they have ever known. Once outside, old discoveries are quickly rendered meaningless with the revelation of shoc …king new truths. Tris and Four must quickly decide who they can trust as a ruthless battle ignites beyond the walls of Chicago which threatens all of humanity. In order to survive, Tris will be forced to make impossible choices about courage, allegiance, sacrifice and love. (Read More)
| Subgenre: | suspensemartial artsconspiracypost apocalypsedystopiafish out of watercyberpunkfuturisticscience fantasy |
| Themes: | future warmilitaryescaperevengedeathmurderlovesurrealismkidnappingbetrayalpoliticsprisonfeardeceptionmemory …corruptiondeath of fatherterrorismparanoiasurveillanceexecutionexploitationhopepanicamnesiacouragetechnologynear death experienceprison escapeutopiaradioactivitynuclear holocaust (See All) |
| Mood: | rain |
| Locations: | trainforestairplanedesertairportelevatorvillagewoodsrooftopcavechicago illinoistunnelairshipwalled cityairplane chase |
| Characters: | warriorbrother sister relationshipteenage girlfamily relationshipsmother son relationshipteenagerboyfriend girlfriend relationshiptattoofemale protagonistsoldierhostagelawyertough guyaction herosecurity guard |
| Period: | futurenear future |
| Story: | female warriorcamouflagehologramevil manfugitivepilotattempted murderon the runfictional waranti herostabbed in the chestthroat slittingimpalementgood versus evilshot in the back …showdownshot in the chestshot to deathcorpseshootoutchaseexplosionbare chested malefemale nuditybased on novelbloodviolenceone word titlesequelfemale rear nudityfighttitle spoken by characterknifesurprise endingpistolshowerbeatingfistfightmachine guncar accidentshot in the headrescueslow motion scenepunched in the facebattlearrestundressinggunfightbrawlfalling from heightheld at gunpointhand to hand combatbombhallucinationhandcuffsrevolverfightingcombatscientistsubjective camerasurvivalfoot chaseorphanambusharmystabbed to deathmixed martial artsprisonerexploding cartrialno opening creditsdisarming someoneone man armypart of serieschild in perildouble crossthird partshot in the foreheadtrainingone against manycharacter repeating someone else's dialoguebeaten to deathdangerelectrocutionattackfantasy sequencecharacter's point of view camera shotmissionrace against timetentcover upknocked outkicked in the facetough girlmanipulationscarinjectionfemale removes her clothesloss of fatherbrothersuspicioncharacter says i love youbattlefieldstrong female characterhenchmancivil warexperimenteavesdroppingmissiletraitordestinyfalling down stairssabotagerevelationhead buttelectronic music scoreheavy rainsecurity camerajail cellkicked in the stomachvirtual realitystrong female leadlasercgigenocideaction heroinemexican standoffsocial commentarybroken leggas maskreverse footageshieldprison guardtarget practiceexplosivebraverycynicismblood on facestabbed in the throatchaosgash in the facestabbed in the neckescape attemptpunched in the chestassault rifleaerial shotcommandobulletproof vestdisfigurementrescue missionlasersightdictatormoral dilemmalaser gunmemory lossshot through a windowfemale soldierabandoned buildingvideo surveillancebad guyinvisibilityfinal showdownreturning character killed offbrainwashingbag over headbureaucracycafeteriafemale fighterspiral staircasearmored carcomputer crackerdronecomic reliefplane crashwallknocked unconsciousanarchycommando missioncrash landingman kills a womanoffscreen killingvolunteerwoman kills a manaltered version of studio logostabbed in the shoulderfight the systemgasexperiment gone wronghigh techpart computer animationcommando raidnuclear waropen endedoverturning carroofgeneticsvaultaircraftsubterraneanjailbreakdogfightone woman armytargetchosen onedreadlocksforce fieldanti heroineknocked out with a gun buttsocial decayarmoryteenage heropower struggletotalitarianismwastelandleaving homeloss of memorycityscapedeoxyribonucleic acidleadershipbubbledetonatorbiological weapontyrannyshot through a wallserumblockadeorbpoison gascouncilbased on young adult novelheadsetpulp fictioneugenicsindividualityscience experimentstrong womanpolitical unrestelectromagnetic pulsegrappling hookclichedeus ex machinasphereexplosive decompressionlovers reunitedelectric fencehovercrafterased memoryescalationclimbing up a wallvideo messagechemical weaponssocial differencestoxintruth serumcalling parent by first namefuturistic cityteenage heroinelawlessnessnerve gasbody suitgenetic experimentationbarcodepower generatorshuttle crafturban warfareagainst the systemabseilingdevastated landscapemock executionkey cardbarcode tattoogas attackgenetic manipulationglass elevatordecontaminationmass surveillanceshow trialwire cuttersprovidencecity stategenetic modificationriver of blooddestroyed buildingallegiance (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
| Subgenre: | martial artsconspiracypost apocalypsedystopiacyberpunksurvival horrorzombie apocalypsepost apocalypticcorporate conspiracy |
| Themes: | escaperevengedeathmurderkidnappingbetrayalfearmonsterdeceptionangerbrutalityparanoiaredemptioninsanityillness …surveillancehopepanicself sacrificeartificial intelligence (See All) |
| Mood: | gore |
| Locations: | motorcyclewheelchairrooftoplaboratorytunnelsewerhumveecable car |
| Characters: | doctorfather daughter relationshipboyfriend girlfriend relationshipfemale protagonistzombiesoldierhostagesecurity guardbibleprofessorengineer |
| Period: | zip lineseeing the future |
| Story: | female warriorstabbed in the footmegacorporationgatling gunhologramresistanceeaten alivemechanicheroineshot in the shoulderevil manshot in the legfictional warstabbed in the chestthroat slitting …impalementgood versus evilshot in the backshowdownswordshot in the chestblood splattershot to deathcorpseshootoutfirechaseexplosionbloodviolencesequelflashbackdogfightknifesurprise endingpistolvoice over narrationbeatingfistfightmachine guncar accidentshot in the headrescueslow motion scenepunched in the facewritten by directorbattlegunfightbrawlfalling from heightheld at gunpointhand to hand combatsunglassesbombrunningcar crashinterrogationcombatkung fuscientistsubjective cameradecapitationsurvivalflashlightambushstrangulationmassacrearmystabbed to deathmixed martial artsexploding carsevered headno opening creditsdisarming someonedouble crossunderwater scenecreaturevoice overnecklaceshot in the foreheadone against manybinocularsbeaten to deathdangerstabbed in the backprologuelocker roomfired from the jobperson on fireelectrocutioncharacter's point of view camera shotmissionactor playing multiple rolesrace against timecover upknocked outkicked in the facetough girltankopening action scenescarexploding bodythreatened with a knifemercenarywaterfallsevered armshot in the armobscene finger gestureundeadbattlefieldwashington d.c.stylized violencehenchmanak 47missileropetraitoruzihand grenadesabotagefireplacedestructionburned aliverevelationhead buttelectronic music scorehypodermic needlemachetesociopathdiseasevirussecurity camerawalkie talkiecrucifixmad scientistkicked in the stomachwristwatchdesperationjumping from heightsevered handstrong female leadlasergenociderocket launchertorchend of the worldaction heroineanimal attackmexican standoffwhite housegun fusocial commentarycyborgstealing a carsevered fingerfight to the deathdual wieldstabbed in the throathatredbased on video gamehit in the crotchmercilessnesspower outagechaosshot in the facebroken glassevacuationcigarette lighterstabbed in the legpunched in the chestairplane crashinfectionbooby trapaerial shotbody landing on a carknife throwingraised middle fingergasolinestabbed in the eyesevered legburned to deathsirenclonefast motion scenebullet timerockettorso cut in halfenglishman abroadsatellitedesert eaglefemale soldierabandoned buildingbarbed wireliving deadfinal showdownreturning character killed offfemale fighterarmored carsuper strengthgiant monsterworld dominationmegalomaniacyoung version of characterbunkerinformantstabbed in the armcommanderflarehanging upside downhelicopter crashsawed off shotgungenetic engineeringfemale herobitten in the neckwoman kills a manfight the systemfinal battleshot through the mouthsole black character dies clicheshot in the footcountdownopen endedcurejumping into watersixth partwoman fights a mandistrustsubterraneancloningcut into piecesone woman armyresistance fighterspray paintchainsanimal killingsevered footanti heroinearmoryhummerfirecrackersurveillance footageevil corporationoutbreakmad doctorlandminelast standslow motion action scenechild with a gundeoxyribonucleic acidantidotecorporate crimedetonatornail gunchild soldierbarricadereference to noah's arkflash drivegiant creaturepandemicsuper computerbusiness partnerlast of seriescubespikehockey stickcontact lensimplantsecret laboratorycraterbackflipice picknight vision binocularshanged bodykilled by a propellersiren the alarmhorderesident evilabandoned citylaser cutterfemale mechanicreference to genesishivewinged creaturecomputer controlraccoon cityunderground complexfemale engineer (See All) |
Groups of people - colonies - are forced underground due to another ice age. Colony 7 goes to check on Colony 5, which they lost contact with. When they get there they find that the colony has fallen and there is a whole new enemy that they have to face on their way back.
| Subgenre: | suspensemartial artsindependent filmpost apocalypsedystopiacreature featuresurvival horror |
| Themes: | cannibalismescapedeathmurdersuicidebetrayalfeardeceptionnaturebrutalitysadismsurveillanceexecutionpaniccourage …self sacrificenear death experiencestarvation (See All) |
| Mood: | gorenightmaredarknesssavage |
| Locations: | helicoptersnowwaterfarmtunnel |
| Characters: | ex soldierwarriorhusband wife relationshipboyfriend girlfriend relationshipteenage boyzombiehostagetough guyaction herointerracial relationshiplittle boysecurity guardengineer |
| Period: | futurewinternear future |
| Story: | female warriortensioneaten aliveshot in the shoulderattempted murdershot in the leganti herostabbed in the chestthroat slittingimpalementgood versus evilshot in the backshowdownshot in the chestblood splatter …shot to deathcorpsedreamshootoutfirechaseexplosionbloodviolenceflashbacktwo word titlegunkissfighttitle spoken by characterknifesurprise endingpistolvoice over narrationbeatingfistfightfoodshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorbattlegunfightbrawlfalling from heightshootingrifleheld at gunpointhand to hand combatdead bodyhandcuffsrevolvercombatf worddecapitationsurvivalfoot chaseorphanflashlightambushaxebridgestabbed to deathmixed martial artssevered headdream sequencedisarming someonecreaturesearchshot in the foreheadbeaten to deathdangerstabbed in the backscreamingkeyfactorymissionrace against timerabbittough girlpursuitexploding bodydeath of sonthreatlaptopthreatened with a knifechickenprofanitydismembermentblood spatterchessiceundergroundhead buttspearmachetesurvivormutantdiseasevirussecurity camerabeardmagazineexploding buildingkicked in the stomachladderbald manculturereverse footagehaunted by the pastexplosivebraveryfight to the deathstabbed in the throatcannibalmanhuntmercilessnesspower outagestabbed in the neckmutehungerbutcherenvironmentalstabbed in the headcigarette lighterenvironmental issuestabbed in the legdynamiteinfectionknife fightdark pastlens flareaxe murderrescue missionglobal warmingweathermoral dilemmaclimate changeblood on camera lensporn magazinefinal showdownfemale fighterepidemicstrandedblood stainflaresicknesshead bashed incoughingman kills a womanoffscreen killingmeat cleaverleaderski maskmonitorstabbed in the shoulderbullet woundsole black character dies clichequarantinetragic pastintergenerational friendshippsychotronic filmbreaking through a doorcolonybutcherygogglestrenchcoatattempted robberygas explosionpower strugglehands tiedaxe fightcar wreckcloudsfrozen bodycollapsing buildingclimatebonesdark futuredisobeying ordersboiler roombeehivewater bottlecold the temperatureenvironmental disasterice agespear throwingoutpostbridge collapsehuman preyhead cut in halfair ventcorpse with eyes openhandcuffed to a bedshot in the eardismembered bodyfleshsearch and rescueweather manipulationunderground bunkersignalaxe in the chestsurviveabandoned cityexploding bridgetransmissionclimbing a ladderdistress signalhit with a metal pipecanadian science fictionseedscannibal cultpower generatoraxe in the backcollapsing bridgefrozen corpsegas tankopening creditscontrol towerice planetbarricading doordestroyed bridgefemale security guardliving undergroundsharpened teethventweather controldowned helicoptergenetic research (See All) |
In modern day Japan, Wolverine is out of his depth in an unknown world as he faces his ultimate nemesis in a life-or-death battle that will leave him forever changed. Vulnerable for the first time and pushed to his physical and emotional limits, he confronts not only lethal samurai steel but also hi …s inner struggle against his own near-immortality, emerging more powerful than we have ever seen him before. (Read More)
| Subgenre: | suspensemartial artsconspiracysuperherofish out of water |
| Themes: | supernatural powerfuneralescapedeathrevengemurdersuicidekidnappingbetrayalghostdrunkennessgangstermafiaguiltgreed …self sacrificesamurainear death experience (See All) |
| Mood: | rainnightmare |
| Locations: | bartrainswimming poolforesthotelhelicoptersnowmotorcycleairplaneairportelevatorwoodsjapancanadacave …laboratorytunnellove hotel (See All) |
| Characters: | ex soldierwarriorfather son relationshipfather daughter relationshipfriendtattoojapanese womanprostitutesoldierhostagesister sister relationshiptough guylove triangleaction herohitman …interracial relationshipjapanesecanadianself mutilationgrandfather granddaughter relationshipyounger version of characterbabe scientistsamurai swordjapanese soldierformer friendself healingmurder of friendcanadian abroad (See All) |
| Period: | world war two2010syear 1945seeing the future |
| Story: | female warriorkatana swordmercy killinginterracial romanceveteranshot in the shoulderfugitiveon the runshot in the leganti herostabbed in the chestsuicide attemptimpalementgood versus evilshot in the back …showdownswordshot in the chestshot to deathdreamchaseexplosionbare chested malecharacter name in titlebloodviolencesequelflashbacktwo word titlekissfighttitle spoken by characterknifesurprise endingpistolfistfightmachine gunshotgunrescuecatbrawlfalling from heightbased on comicriflehand to hand combatsecond partrobothallucinationscientistfoot chaseorphanassassinsword fightbased on comic bookambushstrangulationaxemountaindrug dealerstabbed to deathmixed martial artssubwayno opening creditsone man armyfemme fatalenews reportlimousineorganized crimecharacter repeating someone else's dialoguestabbed in the backelectrocutionpoisonninjatough girlopening action scenescene during end creditsscarbodyguardhairy chestneck breakingpremarital sexthreatened with a knifeshot in the armbearpubsubtitled scenestylized violencestrong female characterak 47crime bossuzishavingbow and arrowburned alivekilling an animalhead buttassassination attempthypodermic needlelooking at oneself in a mirrorcatfightmutantspin offstabbed in the stomachhunterloss of loved onetemplemediavillainessasian womanculture clashfaked deathrailway stationhonormonkaction heroinefemale killergoatcrushed to deathbar fightbroken legapplethugcameohaunted by the pasttokyo japanthunderarranged marriagecrossbowstabbed in the throat3 dimensionalgash in the facestabbed in the neckbusinesswomansuper villainfalling to deathimmortalitystabbed in the legmarvel comicsdark herothrown through a windowinfectionheartprisoner of warseasidewisecrack humorhealingrainstormyakuzaarmorfemale doctorlonerdark pastcorporationlens flarechainarrowburned to deathmedia coveragedrugged drinkfemale assassinfianceestabbed in the handkendodrifterveterinarianspit in the facefemale fighterlast will and testamentsubtitlesex boyfriendbugmecharestroomshot with an arrowvillaatomic bombstabbed in the armx raybillionaireno title at beginningburnt faceinterracial kissreluctant heroblizzardkidnapperheiresskimonoparasiteclawcorrupt officialprivate jetmain character shotnuclear explosionceofighter planebreaking a bottle over someone's headbilingualismolder man younger womanred hairworld war two veteranx rayed skeletonman slaps a womanregenerationchopping woodhit with a chairsurprise during end creditsx menhand through chesthanged womanphone conversationwashroomclangrizzly bearfalling into a swimming poolprisoner of war campkettlevenomhealing powerjumping off a roofbabechildhood loveroninpoison dartfountain penninja armyseppukutoxinnagasaki japanresearch facilitychopstickrobot suitatom bombthrown from a trainengaged couplefalse friendtree cuttingclaw fightpower armoregomaniacthrown off a balconycheating fianceoncologistfight on train roofkiss of deathstabbed in chestwolverine the characteradopted sisterfight on a train roof1945bullet trainatomic explosionbody scannersnake womanb 29poisoned arrowspin off sequelasian with coloured hairfemale mutantscannumber 13shaving beardatomic bomb victimatomic bombingdefense secretary (See All) |
Luke Skywalker battles horrible Jabba the Hut and cruel Darth Vader to save his comrades in the Rebel Alliance and triumph over the Galactic Empire. Han Solo and Princess Leia reaffirm their love and team with Chewbacca, Lando Calrissian, the Ewoks and the androids C-3PO and R2-D2 to aid in the disr …uption of the Dark Side and the defeat of the evil emperor. (Read More)
| Subgenre: | space operamartial artscult filmtragedyepicslapstick comedystop motion animationchrist allegorycult classic |
| Themes: | space travelghostdancemonstergangsterheroangerredemptionevilexecution |
| Mood: | poetic justice |
| Locations: | space battleouter spacespaceforestdesertwoodscampfirespace station |
| Characters: | warriorbrother sister relationshipfamily relationshipsfather son relationshipafrican americanalientough guyaction hero |
| Period: | future |
| Story: | spacecraft cockpithuman in outer spacestarshipsmugglerhologrameaten aliveandroidplanetspacecraftfictional wargood versus evilshowdownswordcomputershootout …firechaseexplosionnumber in titleviolencesequelbondagekissfightdancinglickingpunctuation in titlerescuebattlegunfightbikinifalling from heighthand to hand combatnumbered sequelrobotcombatsubjective cameracleavagesword fightambushstrangulationdisguisemixed martial artsweaponno opening creditsscantily clad femaledisarming someonetonguecreatureprincessdueltreepuppetelectrocutionattackcharacter's point of view camera shottough girlscreamtrapgeneraltwinfireworksbattlefieldmoondestinylifting someone into the airroman numeral in titletwinscaucasianassaultblockbusterrebelsevered handpart of trilogyrebellionlasercompassiongun fugun battleslavepromisereverse footagefalling to deathbooby trapmusical numberbounty huntersword duelwilhelm screamtelekinesislaser gunreturning character killed offkendocremationfemale fighterexotic dancerwar violencegiant monstersex slavefemale spyemperorhugsorcererpatricidetyrantkindnessfriends who live togetherlightsaberbestialityfinal battleoverweightempirechainedfamous scoreflameorchestral music scorefather son estrangementsixth partroman numbered sequelvictorychainstreeslifting person in airalien creatureslimex rayed skeletonvillain turns goodcrime lordhumantragic villainmessiahsagacult figurefireworkfrozen bodyrescue attempttransportangrylaser beamfire fightzoophiliafuneral pyrelifting male in aircollarlifting an adult into the airthe forcejedi knightswordplayfather and sonoutrunning explosionsupervillainjet packpublic executionhumanoid alienfictional planetgalactic warpsychokinesisangry mandroidflamesinvented languageabyssstormtroopertalking robothang glidingdesert planetfraternal twinselectrical torturestorm troopergreen skinhumanoid robotman eating monsterenslavementwarp speedalien civilizationdeath starleather gloveslast wordsmandalorianstarfightermale aliensymphonic music scorefemale humanoid alienchained womansparksparkswookieedeath rayevil empiremausercharacter says i have a bad feeling about thissaved from executionspace navyleitmotifelongated cry of noforce lightninghuman maleat st walkercollar and leashhuman femalemauser c96 pistoltie fighterastromech droidend of trilogyfar far awayfather son fightgladiatorial combatmauser pistolmillennium falconstrangled with a chainfate of the universegold bikinihigh speed chaser2 d2shuttlex wing starfighterhuman alien sexual relationsprotocol droidslave collarstar destroyerstarship battledeep voicefemale green skinned humanoid aliengold robotlong time agoloss of handmistaken for godrebel starshipstarfighter pilotstarship versus starshiptransport starshipblaster pistolchained humangr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperred blade lightsaberspeeder bike (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com