Please wait - finding best movies...
Number 5, one of a group of experimental military robots, undergoes a sudden transformation after being struck by lightning. He develops self-awareness, consciousness, and a fear of the reprogramming that awaits him back at the factory. With the help of a young woman, Number 5 tries to evade capture … and convince his creator that he has truly become alive. (Read More)
| Themes: | artificial intelligencemilitary |
| Locations: | truckbathtub |
| Period: | 1980s |
| Story: | cloud gazingtv commercialstruck by lightninganimal lovergarbage truckfalling off a bridgesentient robottalking robotrobot as pathosthree legged dogchased by carmarine hymnrorschach testgrasshopperencyclopedia …malfunctionskunkpacifistreference to john wayneraccoonoregoncloudkittencomputer crackerex boyfriendtracking deviceparachutebutterflyindiancommerciallaserlifecowfirst partlightningproduct placementvananimalbridgerobotcatwatching tvtwo word titledog (See All) |
RJ, a raccoon who needs food, accidentally takes food from a hungry bear named Vincent and he wants his food to be found in exactly the same place in a week. He finally finds that an animal family, with a tortoise named Verne as their leader, could help him restore the food from the suburbia, the ga …teway to the good life. But little does RJ know, there is a woman who has recently hired an exterminator to try to hunt them down. (Read More)
| Subgenre: | computer animationcgi animation |
| Themes: | revenge |
| Mood: | nightmarenight |
| Locations: | truckforestcavesuv |
| Characters: | family relationshipsfather daughter relationshipfriendvillain |
| Story: | skunkraccoonlaserlifeanimalcatdogtitle spoken by characterexplosioncell phonefoodwomanhousedream sequencetree …suburbtrapgardenbearbirthday caketalking animalstealingturtlerefrigeratorbarbecuechainwilhelm screamsurprise after end creditsbullet timeconservationsquirrelcookieconsumerismvending machineanimal that acts humanbased on comic striphumanwagonpretending to be deadexterminatortalking catcgi filmanimal protagonistbelchjunk foodstealing foodgarden gnomecoolerpotato chipporcupinerabieshibernationgirl scoutsgelatinbug zapperurban sprawlpersian cattalking bearpossumpet doorpool housetalking turtleanimal driving a carsqueeze toyhome owners association (See All) |
In 2035, technophobic homicide detective Del Spooner of the Chicago PD heads the investigation of the apparent suicide of leading robotics scientist, Dr. Alfred Lanning. Unconvinced of the motive, Spooner's investigation into Lanning's death reveals a trail of secrets and agendas within the USR (Uni …ted States Robotics) corporation and suspicions of murder. Little does he know that his investigation would lead to uncovering a larger threat to humanity. (Read More)
| Subgenre: | martial artsdystopiachrist allegorypolice procedural |
| Themes: | artificial intelligencemurderdeathsuicideheroinvestigationbrutalityparanoiahomelessnessprejudicerevolutiontechnologymurder investigationpolice investigation |
| Mood: | nightmarecar chase |
| Locations: | trainmotorcyclechicago illinoislaboratorytunnel |
| Characters: | policetough guyaction herointerracial relationshippolice detectivegrandmother grandson relationshipbabe scientisthuman versus robot |
| Period: | future2030s |
| Story: | sentient robottalking robotrobot as pathosproduct placementrobotcatbased on novelnuditybloodmale nudityviolenceflashbackgunfightchase …surprise endingpistolshowerpunctuation in titleshootoutdreamcorpseshot to deathblood splatterfistfightmachine guncar accidentshot in the chestshot in the headslow motion scenecomputergunfightbrawlsecretfalling from heighthand to hand combatinterrogationfightingcombatshot in the backdinerexploding carno opening creditsone man armyhit by a cardrowningshot in the foreheadattempted murderone against manymistaken identitydeath of childscarexploding bodyneck breakinggrandmothertrustriottv newslawblockbusterrebellionpart animationgun fuandroidgun battledivinghologramtough coplens flarebroken armbullet timesexual tensionstandoffasthmabullet balletbaseball capscene of the crimegun duelcrushed headroad accidentcarnagemurder suspecttitle same as bookfirst person titledemolitionscience runs amokexit woundkiller robotpunchingcorporate crimegun kataprosthetic limbhumanoidgun saucaught in a netman versus machinerobot as menacerobot versus robothuman versus computercyberneticsevil robothumanoid robothuman versus machinemotorcycle jumphansel and gretelsentiencetunnel chase scenefuturistic trainfuturistic carreference to harold lloydfed extechnophobiabrief male nudity (See All) |
Autobots Bumblebee, Ratchet, Ironhide, Mirage (aka Dino), Wheeljack (aka Que) and Sideswipe led by Optimus Prime, are back in action taking on the evil Decepticons, who are eager to avenge their recent defeat. The Autobots and Decepticons become involved in a perilous space race between the United S …tates and Russia to reach a hidden Cybertronian spacecraft on the moon and learn its secrets, and once again Sam Witwicky has to go to the aid of his robot friends. The new villain Shockwave is on the scene while the Autobots and Decepticons continue to battle it out on Earth. (Read More)
| Subgenre: | conspiracyepicchrist allegory |
| Themes: | militarymurderdeathrevengekidnappingbetrayaltortureinvestigationdeceptionsurveillancespace travel |
| Mood: | car chasearchive footage |
| Locations: | truckbarrestaurantchurchhelicoptersnowairplanebusdesertelevatorwheelchairafricaofficeouter spacechicago illinois …fire trucknew mexicoairplane accidentspace battle (See All) |
| Characters: | husband wife relationshipfather son relationshippolicemother son relationshipboyfriend girlfriend relationshipsoldieralienhostagewarriorsecurity guardsnipersecretaryrussianemployer employee relationshipsniper rifle …engineermilitary officeramerican soldierhuman versus robot (See All) |
| Period: | 1960s2010s20th century21st centuryyear 1969year 1961 |
| Story: | sentient robottalking robotcomputer crackertracking deviceparachutelaserproduct placementbridgerobotdogbloodviolencesequelflashbackbare chested male …fightexplosionchasepistolpunctuation in titlecell phoneshootoutbeatingshot to deathmachine guncar accidentshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facecomputerbattleswordbrawlfalling from heightshowdownheld at gunpointbombcar crashinterrogationscientistshot in the backdecapitationgood versus evilflashlightbraaxedisguisemansionmontagestabbed in the chestweaponexploding carsevered headno opening creditsassassinationpart of seriesfictional warspaceshipthird partnews reportshot in the leglimousinebinocularsbased on tv seriesstabbed in the backprologuefbielectrocutionstatuecover uptanku.s. presidentscene during end creditsconvertibleamerican flagbodyguardexploding bodycharacter says i love youmercenarysevered armshot in the armgeneralsecret agentwashington d.c.moonmissiletraitorsabotagegrenadehead buttnipples visible through clothingsecurity cameraelephantwalkie talkiespacecraftexploding buildingkicked in the stomachplanetblockbusterswat teamwristwatchjumping from heightfaked deathrocket launchermexican standoffwhite housemilkback from the deadgas maskcamera shot of feetrampagealien invasionbarefootmiddle eastexplosiveu.s. armyfight to the deathinventorjob interview3 dimensionalchaosgash in the faceresurrectionsuper villainfalling to deathkicked in the crotchblack braspecial forcesexile3dexploding headjumping through a windowthrown through a windowastronautcommandobulletproof vestbody landing on a carlens flarelieutenantlasersightexploding helicoptergovernment agentnewspaper clippinggatling gunteleportationlaser gunreference to barack obamabased on toynasalaptop computersatellitegiant robotnarrated by characteraccountantreturning character killed offset upstuffed animalreference to facebookfountainspit in the facespiral staircaseworld dominationdronemachinecomic reliefwatchmegalomaniactrailer homepopcornmedalbased on cartoondenialshot in the eyecomputer hackercrash landingfighter jetassistantmilitary basespace shuttletentaclecrashing through a windowchandelierepiloguevehiclewoman wearing only a man's shirtmercedes benzfinal battlejettop secretcamcorderhigh technewscastreference to twittercommando raidvaultalien planetexploding shipshapeshiftingaircraft carriercamera phoneneck bracediplomatu.s. air forceexploding airplanedreadlockspentagonfinger gunx rayed skeletonhead ripped offalien racethrown from a carscottish accentstarts with narrationslow motion action scenekiller robotjohn f kennedyenglishwoman abroadsurprise during end creditssecret organizationhuman versus alienblack holecovert operationstudio logo segues into filmalien technologynsaconspiracy theoristzebrabody torn apartcollapsing buildingdefectortv broadcastmoon landingexploding planeblack opsmass destructionuh 1 huey helicopterenglish accentwashington monumentprintercosmonauttransforming robotarmy generalukrainianarmed forcesrichard nixonvintage cargeiger counternavy sealjumping from an airplanebase jumpingfighting in the airancient astronautapollo 11alien attackexploding planetuh 60 blackhawk helicopterrobot versus robotrocket launchingair battlecollege graduateshape shifting alienchernobyl ukrainespace probedestroyed citycamarosecretary of defensealien robotemployee employee relationshiphuman versus machinechevrolet camarotransformerscrashing through a wallnuclear disasterlincoln memorialnsa agentsecret government organisationcar showroomend of the world scenarioseticoncordehuman alien relationshipmailroomchernobyl disasterjob huntingsecret military operationabandoned townautobotoptimus prime the characterimax versionbeam of lightcrash sitedecepticonfriendly alienneil armstrongstolen kisstransformer robotu.s. department of defensebumblebee the charactermegatron the characteranimate carbonsai treeformer agenthummer h2mechanical lifeformshot through the eyeautobot versus decepticoncar collectionextraterrestrial robotbuzz aldrinreference to colonel sandersbuilding destructionspine rippingtop secret documentyuri gargarinhuman versus transformerradio dish antennav 22 osprey (See All) |
A long time ago, far away on the planet of Cybertron, a war is being waged between the noble Autobots (led by the wise Optimus Prime) and the devious Decepticons (commanded by the dreaded Megatron) for control over the Allspark, a mystical talisman that would grant unlimited power to whoever possess …es it. The Autobots managed to smuggle the Allspark off the planet, but Megatron blasts off in search of it. He eventually tracks it to the planet of Earth (circa 1850), but his reckless desire for power sends him right into the Arctic Ocean, and the sheer cold forces him into a paralyzed state. His body is later found by Captain Archibald Witwicky, but before going into a comatose state Megatron uses the last of his energy to engrave into the Captain's glasses a map showing the location of the Allspark, and to send a transmission to Cybertron. Megatron is then carried away aboard the Captain's ship. A century later, Captain Witwicky's grandson Sam Witwicky (nicknamed Spike by his friends) buys his first car. To his shock, he discovers it to be Bumblebee, an Autobot in disguise who is to protect Spike, who possesses the Captain's glasses and the map engraved on them. But Bumblebee is not the only Transformer to have arrived on Earth - in the desert of Qatar, the Decepticons Blackout and Scorponok attack a U.S. military base, causing the Pentagon to send their special Sector Seven agents to capture all "specimens of this alien race." Spike and his girlfriend Mikaela find themselves … (Read More)
| Subgenre: | teen comedychrist allegory |
| Themes: | artificial intelligencemilitarylovetorturedeceptiondysfunctional familyhopespace travelunlikely hero |
| Mood: | high schoolcar chase |
| Locations: | truckbathtubswimming poolhelicoptermotorcyclelos angeles californiadesertbicycletaxipolice stationpolice carlakeshiprooftopouter space …tunnelcar theftspace battlebicycle accidenthelicopter accidentcar bicycle chase (See All) |
| Characters: | husband wife relationshipfather son relationshippolicemother son relationshipteenagerteenage girlteenage boysoldieralienwarriorsecretaryaustralianpolice chasemilitary officerbabe scientist …ship captainhuman versus robot (See All) |
| Period: | 2000s19th century1890s21st century |
| Story: | sentient robottalking robotcomputer crackerlaserfirst partproduct placementbridgerobotdogone word titleflashbackfightchasepistolfire …voice over narrationcell phoneshootoutunderwearmachine gunurinationremakeshotgunrescuecomputerbattleundressingfalling from heightheld at gunpointinterrogationhandcuffsscientistreporterdecapitationgood versus evilbedroomaxebasketballimpalementexploding carfalse accusationno opening creditspart of seriesfictional warnews reportbased on tv seriesdangerprologuelocker roomfbibaseball battanku.s. presidentscene during end creditshigh school studentcheerleadergovernmentautomobileglassesgeneralsecret agentobscene finger gestureufowashington d.c.machismoicemissileundergroundcaptainplanetblockbusterswat teampart animationhonorend of the worldmexican standoffwhite houseback from the deadcannonalien invasionbarefootbraveryu.s. armyboxer shortschaosresurrectionsuper villainhologrambulletproof vestlens flarestadiumjuvenile delinquentlasersightflamethrowerwilhelm screamexploding helicoptergovernment agentgatling gungrenade launcherbased on toyheroismgiant robotpetteenage lovespiral staircasestairwaytelevision newsworld dominationarcticwebcamcomic reliefmegalomaniacidealismmasturbation referencebased on cartoonflarecrewhearing voicescomputer hackerfighter jetexploding truckmilitary basexbox 360macguffinplaying a video gamevehiclesurfboardspace warasteroidexplorershot through the mouthsole black character dies clichetow truckbadgepart computer animationalien contactaircraft carrierscatological humoradmiralu.s. air forceexploding airplanenegotiationpentagondonutradarhummerteenage heroalien racefederal agentguard dogcryogenicsboom boxcomputer virusfootball gamepower failuredouble entendrehuman versus alienorigin of heroalien technologyair strikevisachihuahuaexploding planebutchfrozenham radiocubeledgewashington monumenttransforming robotelectromagnetic pulseprotectorexploding bushdtvcnn reporterfast carreference to michael jordansemi truckancient astronautebayspectaclesunderground bunkerbattle tankrobot versus robotyoung romancewarrior raceairforce onecode breakingcamarosecret government organizationsecretary of defensealien robothack sawamateur radiocomputer chiphuman versus machineteenage heroinereference to ebayactor voicing multiple charactersfemale mechanicchevrolet camaro18 wheelerbelly buttonfamily petapple macintosh computerenglish subtitlesautobotburger kingfederal governmentoptimus prime the characterpanasonicjuvenile crimeqatarremake of tv showdecepticonhoover damtransformer robotu.s. department of defensebased on cult filmbasketball ballbumblebee the charactermegatron the characterprominent product placementused car dealeranimate carfrozen in icehooverhummer h2nokiaroadstermechanical lifeformmountain dewreference to wolverineanimal urinationautobot versus decepticonextraterrestrial robotschool matecabinet officerherbert hooverhotwirehuman alien teamstarscream the charactervehicle driving by itselfyear 1897basketball hoopratchet the charactertop secret documentironhide the characterbody torn in halfcybertron the planetemergency vehiclehuman autobot teamhuman versus transformerlos angeles river channelsemi truck driving itselfshyguysikorsky helicopter (See All) |
This is the story of a nine-year-old boy named Hogarth Hughes who makes friends with an innocent alien giant robot that came from outer space. Meanwhile, a paranoid U.S. Government agent named Kent Mansley arrives in town, determined to destroy the giant at all costs. It's up to Hogarth to protect h …im by keeping him at Dean McCoppin's place in the junkyard. (Read More)
| Subgenre: | cult film2d animationfish out of water |
| Themes: | militarydeathlovefriendshipfearescapeparanoiahopeprejudiceself sacrifice |
| Locations: | trainschoolforestcarsmall townbicyclewaterwoodslakesubmarine |
| Characters: | mother son relationshipfriendboysoldieralienreference to godsingle motherwaitress |
| Period: | 1950s |
| Story: | robot as pathosraccooncowrobotwatching tvcharacter name in titlebased on novelbloodgunexplosionchasethree word titlesurprise endingbased on bookcamera …falling from heightriflebedinterrogationbathroomclassroomprayernewspaperarmydinertoiletdinnerno opening creditschildcoffeetreebinocularsdirectorial debutgeneralsingle parentcold warrockmissileflyingcomic bookhelmetice creamragehuntersevered handrampagechild's point of viewresurrectiondaydreamfalldeertragic herogovernment agentchloroformchocolategiant robotjunkyardsculptorpopcornsquirrelunconsciousnessschoolteacheralien contactmetaltoy gunmainereference to supermanwindowtoilet paperphotosaying gracehit by a trainbased on poemmeteoritenuclear missilenaillessonbouldercollisiondummytriumphtidal waveaudio flashbacktrain wreckunconsciousdead deerdeer huntinggun controllaxativebad temperbeatnikyear 1957railbb gunmale soldieralien robotlife lessonflying robotkilling a deermilitary jeepwarner broswatching horror movie on tvanti violenceknocked unconciousmechanical lifeformextraterrestrial robotscrapstaring contesteating non foodwooden dummyunzipping pants flycartoon squirrel (See All) |
In Johannesburg, the police department reduced the high rating of criminality using robots from the Tetravaal Company, designed by the engineer Deon Wilson. The former military Vincent Moore is envious of Deon, since he has developed another project called Moose, but neither Tetravaal nor the police … department is interested. Deon has just developed an Artificial Intelligence but the Tetravaal's CEO Michelle Bradley asks him to abort the project. Deon decides to bring the damaged Robot 22 that was sent to be crushed to test his A.I. However he is kidnapped by the criminals Ninja, Yo-Landi and Amerika that want him to stop the robot cops. When they see the damaged robot in the van, they force Deon to program it to heist banks with them and they call it Chappie. However, Chappie acts like a child and need to be trained to learn and grow. Meanwhile Vincent follows Deon and plots an evil scheme to activate his robot. (Read More)
| Subgenre: | black comedyheistpunk |
| Themes: | artificial intelligencemilitarymurderdeathrevengesurrealismkidnappingbetrayaltortureescapegangsterdeceptionrobberybrutalityredemption …surveillanceself sacrificeman versus robot (See All) |
| Mood: | rain |
| Locations: | helicopterurban settingpolice stationpolice carafricaofficelaboratoryslumabandoned factory |
| Characters: | policetattoopolice officerpolicemanhostagesecurity guardaustralianemployer employee relationshipamerican abroadengineerex soldierhuman versus robot |
| Period: | future2010snear future |
| Story: | sentient robotrobot as pathostracking deviceproduct placementvanrobotdogcharacter name in titlebloodviolenceone word titleinterviewflashbackbare chested malecigarette smoking …photographtitle spoken by characterexplosionpartyknifesurprise endingpistolcell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenewritten by directorpaintingbookshowdownheld at gunpointbombcar crashinterrogationrevolvercriminalshot in the backf wordsubjective camerafoot chasegangambushstrangulationdeath of friendwomanmontageimpalementstabbed in the chestweaponnonlinear timelineexploding carman with glassesno opening creditsdouble crossnews reportcigar smokingshot in the legshot in the foreheadtrainingorganized crimebinocularscharacter repeating someone else's dialogueelectrocutionfactorycharacter's point of view camera shotrace against timedollactor shares first name with charactermanipulationexploding bodylaptopthreatened with a knifemercenarysevered armshot in the armdismembermentriotak 47crime bosseavesdroppinguzisabotagegrenadeelectronic music scoresociopathhelmettold in flashbacksecurity cameraswat teamrocket launcherburialsocial commentarybroken legandroidthugpump action shotgunswitchbladestealing a cartarget practicedual wieldinventortitle appears in writingthrown through a windowassault riflebulletproof vestpolice raidbroken armrpggatling gunshot multiple timesgrenade launchermedia coveragefast motion scenetorso cut in halfhit with a baseball batenglishman abroadgiant robotbag of moneycartoon on tvmolotov cocktailgun in mouthpistol whiparmored carsuper strengthpolice chiefarms dealerdroneurban decayactress shares first name with characterbased on short filmcarjackinghit with a shovelnewscastconsciousnesslearningshooting rangeceofinger gunarmorycrime lordarm ripped offkiller robotmegacorporationmoney falling through the airdetonatorset on firethrowing starshurikencircular sawnunchucksflash drivestray dogcaught in the raintarget shootingassembly linetorn in halfgun storesouth africanhand gunmulletprototypegold tooththrowing a rockgolden guneurocopter as350 squirrelrobot versus robotarmored car robberyjohannesburg south africahumanoid roboturban violenceemployee employee relationshipripped in halfwoman killedhuman versus machinecriminal as protagonistflying robotnunchucktattooed manblack sheepcrashing through a walllawlessnessbutterfly knifefist bumppolice headquarterspipe wrenchcluster bombrubber chickenhuman piloted robotnissan gt rsemi truck and trailermind uploadingrobot cophandheld detonatorrobot arm (See All) |
Tony Stark creates the Ultron Program to protect the world, but when the peacekeeping program becomes hostile, The Avengers go into action to try and defeat a virtually impossible enemy together. Earth's mightiest heroes must come together once again to protect the world from global extinction.
| Subgenre: | martial artssuperhero |
| Themes: | artificial intelligencemurderdeathrevengefeardrunkennessdeceptionmagicsupernatural powerterrorismapocalypseself sacrificetechnology |
| Locations: | new york citybarbeachchurchforestsnowmotorcycleairplanebuslondon englandelevatorwoodspolice stationcityafrica …shipcastlelaboratoryspace stationmotorcycle chasespace shiptrain accidentsinging on airplane (See All) |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshiptattoobrother sister relationshipsoldierhostagetough guywarrioraction heroprofessorpregnant womanengineer …ex soldierpregnant wifealien superhero (See All) |
| Story: | sentient robottalking robotrobot as pathostracking devicelaserlightningbridgerobotcharacter name in titleviolencesequelflashbackbare chested maleexplosionparty …surprise endingpistolcorpseshot to deathfistfightmachine gunshot in the chestrescueslow motion scenebattlebrawlfalling from heightbased on comicheld at gunpointhand to hand combatsecond parthallucinationrevolvercombatscientistshot in the backdecapitationgood versus evilspyorphanbased on comic bookambushterroristaxemontagearmymixed martial artsinternetexploding carsevered headno opening creditschild in perilunderwater scenetransformationtrainingcharacter repeating someone else's dialogueelectrocutionfantasy sequencemissionrace against timetough girltankopening action scenescene during end creditsdeath of brotheramerican flagcountrysideexploding bodydie hard scenariomercenarysevered armshot in the armsecret agentdismembermentbattlefieldstylized violencestrong female characterak 47missilefalling down stairsdestructionbow and arrowflyingjeepcagesociopathbarnjail cellexploding buildingblockbusterswat teamgiantstrong female leadmind controlorphanageend of the worldaction heroinecolonelinterracial friendshipcrushed to deathback from the deadandroidfemale warriorrampageshieldcameohaunted by the pastvisiontarget practiceinventor3 dimensionalresurrectionevacuationheadphonesensemble castmarvel comicsjumping through a windowassault riflewisecrack humorsuperheroinehologrambody landing on a carfemale doctoreye patchgadgetterrorist plottelekinesisgatling gunshot multiple timeslaser gunbullet timerockettorso cut in halffemale assassinsatelliteheroismfinal showdownreturning character killed offtimebombtractorwar heroarmored carsuper strengthshipwreckarms dealerworld dominationdronemegalomaniacarcherybunkerbillionairefemale spyneo nazihit by a truckfighter jetexploding truckdance clubgenetic engineeringinfertilityballerinasuperhero teamfinal battlecapejetteamworkhigh techarcheropen endedtragic pastaircraftaircraft carriercut into pieceseastern europehit with a hammerheart ripped outhuman experimentaerial combatsecret passageceoforce fieldglowing eyesscience runs amokarmoryballroomexpectant motherworld war two veteranchrysler building manhattan new york cityfictional cityregenerationvillain turns goodepic battlechopping woodslow motion action scenekiller robotgadgetrysexual innuendoexpectant fatherbrandinggadget carhuman aliensuper speedbuilding collapseinvulnerabilityflying carmayhemhidden doorsafe housetelling a jokesuper computercocktail partymotorcycle ridingfriendly fireflying manmarvel entertainmentelectromagnetic pulsesupervillainoslo norwaymarvel cinematic universebridge collapsesouth africanman versus machinelarge format cameradarwinismrobot as menacetalking computerexploding tankcostumed herohumanity in perilrobot armyred capeevil robotgauntlethumanoid robotradical transformationrobot suittrain derailmentcaped superherocommuter trainfuturistic aircraftgemstonescepterflying superheromale aliennorse godrunaway traindeath of twinmuscle growthextraterrestrial humantwin brother and sisterextraterrestrial manman wearing an eyepatchfloating citytechneparty gamejumping on a moving vehiclepunched in the face multiple timesthrowing dartsflying fortressstan lee cameosuperhero versus superherocharacter turns greengerman scientistseoul south koreathe incredible hulkblack widow the characterself driving carsemi truck and trailerverticle take off and landing aircraftfront wheeliewoman riding a motorcycleflying supervillainspitting out a toothwar hammerfalcon the characterhawkeye the characterhelicarrierreference to odintanker truck explosion (See All) |
It is the year 2029. Technology has advanced so far that cyborgs are commonplace. In addition, human brains can connect to the internet directly. Major Motoko Kasunagi is an officer in Section 9, an elite, secretive police division that deals with special operations, including counter terrorism and …cyber crime. She is currently on the trail of the Puppet Master, a cyber criminal who hacks into the brains of cyborgs in order to obtain information and to commit other crimes. (Read More)
| Subgenre: | independent filmmartial artscult filmsuspenseconspiracydystopiacyberpunkadult animationtech noir |
| Themes: | artificial intelligencemurderdeathsurrealismghostpoliticsescapeinvestigationdeceptionterrorismparanoiasurveillancephilosophynear death experience |
| Mood: | neo noiranimecar chase |
| Locations: | hotelhelicoptermotorcycleairplaneboatelevatorwheelchairapartmentjapanlaboratory |
| Characters: | policedoctorfemale protagonistsoldierpolice officerwarriorsniperpolice shootoutsniper riflepolice chase |
| Period: | future2020s |
| Story: | garbage truckrobot as pathoscomputer crackertracking devicelaserbridgerobotfemale nuditybloodviolencefemale frontal nudityfemale rear nudityfightfemale full frontal nudityphotograph …explosionknifechasesurprise endingpistolshootoutbeatingcorpseshot to deathfistfightmachine guncar accidentshot in the chestblondeshot in the headshotgunpunched in the facecomputerbattlegunfightbrawlbare buttbased on comichand to hand combatcar crashinterrogationrevolverscientistshot in the backsubjective cameraspyfoot chasebased on comic bookambushmassacremixed martial artspoliticianexploding carbrunetteunderwater scenebased on mangafugitivecharacter's point of view camera shotrace against timecover upkicked in the facetough girlfull frontal female nuditytankmanipulationpolicewomanmercenarysevered armsecret agentespionagefull frontal nuditysplattertopless womanuzisabotagegrenadeassassination attemptkicked in the stomachswat teamjumping from heightvirtual realitybuttmind controlparking garageaction heroinecolonelsocial commentaryandroidfemale warriorcyborgdivingfloodexploding headpunched in the chestsexy womanhologramsoulalternate realityyakuzapierpolice raidexistentialismgadgetferryclonegovernment agentbraingatling gunmannequintorso cut in halfshot through a windowdoppelgangerabandoned buildinginvisibilityhackerex copmarketpolice chiefmajorfemale spycomputer hackerhit by a truckoffscreen killingtopless girlpolitical prisonerhigh techwatermelonfemale copfemale police officersuperhuman strengthcrime fighterwoman fights a manmind readingdiplomatanti heroinescience runs amoksurveillance footageidentity crisislifting female in airhelicopter pilotcityscapeinterpreterdecoybegins with textcomputer virussuit of armordefectorblockadelifting a female into the airfalse memorycyberspacephilosophicaldeliberate crueltyerased memoryinside the mindvirtualitydiving suithalf humananimated nudityphilosophical conversationsecret government organizationbasset houndtough womanfuture shockdiplomatic immunityopen air marketimplanted memoryinfrared visioninvisibility cloaksynthetic humanghost in the machinehuman dignitycyberterrorismyear 2029 (See All) |
This theatrical movie based on the television series (which was also based on a popular multiform robot toyline) did not go over very well at the box office. The movie takes place in 2005, twenty years after the television series, and chronicles the efforts of the heroic Autobots to defend their hom …eworld Cybertron from the evil Decepticons. Both factions are seething with anger, and that hatred has blinded them to a hideous menace headed their way. That hideous menace is the colossal planet known as Unicron, who has been ready to consume anything that stands in its way. The only thing that can stop Unicron is the Autobot Matrix of Leadership, which is possessed by the Autobots and which the Decepticons, through Unicron's orders, plan to take away from them. (Read More)
| Subgenre: | independent filmmartial artscult filmtragedy2d animationchrist allegory |
| Themes: | murderdeathfriendshipkidnappingbetrayaltortureescapeherodeceptionredemptionsadismfaithexecutionhopecruelty …courageself sacrificetechnologynear death experiencespace travelfuture wardestruction of planet (See All) |
| Mood: | animedarkness |
| Locations: | trucktraincarhelicoptermotorcyclecityshipouter spacelaboratoryspace stationspace battlespace fight |
| Characters: | father son relationshipsoldieralienwarriorvillainself destruct |
| Period: | 2000sfuture21st centuryyear 2005 |
| Story: | sentient robottalking robotrobot as pathostracking devicelaserrobotviolencesequelgunfightexplosionchasesurprise endingsongshootout …corpseshot to deathfistfightshot in the chestrescuecomputerbattleswordgunfightbrawlshowdownhand to hand combatcombatscientistdecapitationgood versus evilspysurvivalsword fightbased on comic bookambushaxedisguisedeath of friendmixed martial artsweaponsevered headchild in perilhit by a carfictional wardouble crossspaceshipunderwater scenecreaturetransformationbased on tv serieselectrocutionrace against timetankmanipulationexploding bodydarkufobattlefieldmoonpickup truckmissileropedestinydestructionflyingelectronic music scoreheroinejail cellspacecraftplanetfaked deathmind controlgenocidehonorend of the worldcrushed to deathback from the deadandroiddinosaureaten alivepresumed deadfemale warrioralien invasionfloodtelescopebraveryfight to the deathdual wieldhatredresurrectionshopping mallprophecypsychotronicfather figurecapturesports carlaser gunbased on toyheroismunderdogfemale soldiergiant robotreturning character killed offkendojunkyardfemale fightergiant monsteracidcrownbased on cartooncrash landingfighter jetspace shuttleresponsibilityspace warlightsabersword fightingslingshothigh techalien contactoctopusalien planetexploding shipshapeshiftingstarshipchosen onefamous linethronekiller robotleadershipmessiahbombardmentalien technologyhuman in outer spaceplanet earthsquidcircular sawcoronationexploding planeescape podswordplayoutrunning explosiontransforming robotmissile launcherrobot as menacerobot versus robotcassette playerwarrior raceevil robotalien robotrobot suitalien civilizationfuturistic aircraftactor voicing multiple charactersalien worldmoon baseautobotfuturistic caroptimus prime the characterdecepticonexo suittransformer robotbumblebee the charactermegatron the charactermock trialspeaking in rhymemechanical lifeformalien spacecraftautobot versus decepticonhuman allypsychadelic imagerobot dinosaurfemale autobotfemale transformerironhide the charactertentacled alienarcee the charactercybertron the planetdinobotliving planetmatrix of leadershipultra magnus the character (See All) |
Set in futuristic Metro City, Astro Boy is about a young robot with incredible powers created by a brilliant scientist in the image of the son he has lost. Unable to fulfill the grieving man's expectations, our hero embarks on a journey in search of acceptance, experiencing betrayal and a netherworl …d of robot gladiators, before he returns to save Metro City and reconcile with the father who had rejected him. (Read More)
| Subgenre: | coming of agesuperherocomputer animationslapstick comedyfuturisticcgi animationchrist allegory |
| Themes: | artificial intelligencemilitarybetrayalpoliticsescapemonsterdeceptionsupernatural powerhopecourageself sacrificenear death experienceunlikely heroutopiarobotics |
| Mood: | high schoolpoetic justice |
| Locations: | airplanetaxirooftoptaxi driverlaboratoryfuture city |
| Characters: | father son relationshipteenagerteenage girlteenage boysoldierwarrioraction heroprofessorsingle fatherengineer |
| Period: | future |
| Story: | robot as pathostracking devicelaserrobottwo word titlecharacter name in titlebare chested maletitle spoken by characterexplosionchasesurprise endingcell phonebeatingmachine guncar accident …rescuewritten by directorbattlearrestsecretfalling from heightshowdownheld at gunpointcar crashsciencecombatscientistsubjective cameradecapitationgood versus evilorphanbased on comic bookambushaxemountainmontagearmyexploding carsevered headno opening creditschild in perildouble crosscreaturemarriage proposaltransformationon the runone against manybased on tv serieselectrocutionbased on mangafugitivecharacter's point of view camera shotevil manknocked outdeath of childpresidenthigh school studentexploding bodydeath of sonelectionsevered armgeneralsingle parentpizzachainsawmissiledestinyteen angstdestructionrevelationflyingloss of loved oneexploding buildinggiantservantpress conferencejumping from heightcompassioncrushed to deathsocial commentaryback from the deadandroidcannonpresumed deadfull moonrampagestealing a carbraverycrossbowcynicismfight to the deathloss of soninventormanhuntpower outage3 dimensionalresurrectionevacuationbutler3dhologramcapturelonerstadiumdeath of loved oneflamethrowerwilhelm screamsatelliteheroismgiant robotfinal showdownoutcastpickpockettaserhigh school teacherjunkyardsuper strengthgiant monstergolf clubdronecomic reliefskyscraperidealismbased on cartoon13 year oldshot in the eyecrash landingarenabaseball capcrashing through a windowloss of childilliteracycorrupt politicianbased on animefinal battletrampolineexperiment gone wrongfeatherhigh techopen endedrepeated linegladiatorfreedom fighterspray paintforce fieldvillain arrestedx rayed skeletonfictional citydeoxyribonucleic acidkiller robotbanishmentstun gunsuper speedintegrityorigin of heroflying carcollapsing buildingleonardo da vincicircular sawgiant creatureorbteenage superherooutrunning explosionelectromagnetic pulsespherefighting in the airhome schoolingrobot as menaceboy geniusfuturistic citydeathmatchflying robotrobot dogscience classx ray visioncrushed carsecret hideoutelectromagnetismstashabsorbing powerfuturistic trainsight gagfloating citysuper hearingcharacter shaped hole (See All) |
Everyone has bad mornings. You wake up late, you stub your toe, you burn the toast...but for a man named Arthur Dent, this goes far beyond a bad day. When he learns that a friend of his is actually an alien with advanced knowledge of Earth's impending destruction, he is transported off the Earth sec …onds before it is exploded to make way for a new hyperspace motorway. And as if that's not enough, throw in being wanted by the police, Earth II, an insane electronic encyclopedia, no tea whatsoever, a chronically depressed robot and the search for the meaning of life, and you've got the greatest adventure off Earth. (Read More)
| Subgenre: | fake documentarystop motion animation |
| Themes: | lovefriendshipkidnappingdrinkingmonsterparanoiapoetryspace travelevolutiondestruction of planet |
| Mood: | satire |
| Locations: | churchsnowouter space |
| Characters: | friendgirlalienactorpriesthostagelove trianglereference to god |
| Story: | talking robotencyclopedialaserlifecowrobotbased on novelflashbackgunkisstitle spoken by characterexplosionpartychaseshower …voice over narrationcell phoneunderwearfoodface slapcomputerdrinkbookvomitingbeertelephonesurvivaleatingdinerprisonerfishbirdspaceshipmicrophonecostumeprologuereadingrabbitringscene during end creditspresidentpursuitelectionflowerpoetpubrecord playericemissileanswering machinerecordingmousespacecraftspiderplanetgiantflatulencetv showend of the worldhitchhikertowelhitchhikingandroidalien invasionwindministeranimated sequencehighwayprison cellpajamasbrainnorwaysaving a lifebeheadinghandshakewhalebureaucracyportaltv reporterbeastdolphincostume partycrash landingbathrobephysicscrabsofatitle same as bookcaravangalaxydemolitionbutt slaphymnbulldozerreference to charles darwinheadachesurprise partytitle spoken by narratorforkliftmeaning of lifebased on cult tv serieshuman in outer spaceplanet earthray gunnoseleechbased on radio showescape podhimalayaspeanutswashroombased on radio seriesvacuumbureaucratexploding planetyawningmadagascarhyperspacematrixmale alieneverymanforced perspectivesussex englandearthlingmanic pixie dream girlphone videostarship interiornorthern territory australiadestroying a houseguide booktwo headed personfloating headpith helmettackled to the groundasia minorintergalactic traveldestruction of earthuniversal translatorwater show (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
| Subgenre: | cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie |
| Themes: | murderdeathfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness …murder of a police officermurder of family (See All) |
| Mood: | goresatirenightmaremurder of a boy |
| Locations: | truckhospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtaxi driver …laboratorysex in shower (See All) |
| Characters: | policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant …jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All) |
| Period: | 1980s |
| Story: | reference to john wayneindianfirst partlightningproduct placementvancatwatching tvdogsexfemale nuditynuditybloodmale nudityviolence …bare breastsfemale frontal nuditymale frontal nuditymale rear nuditybare chested malesex scenefemale rear nuditycigarette smokingknifechasesurprise endingshowertopless female nuditydreamcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeslow motion scenewritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carnews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotrace against timestatuecover upknocked outcollege studentactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youthreatened with a knifeprofanitylove interestpubnewspaper headlineundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderpentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All) |
After the battle between the Autobots and Decepticons that leveled Chicago, humanity thinks that all alien robots are a threat. So Harold Attinger, a CIA agent, establishes a unit whose sole purpose is to hunt down all of them. But it turns out that they are aided by another alien robot who is searc …hing for Optimus Prime. Cade Yeager, a "robotics expert", buys an old truck and upon examining it, he thinks it's a Transformer. When he powers it up, he discovers it's Optimus Prime. Later, men from the unit show up looking for Optimus. He helps Yeager and his daughter Tessa escape but are pursued by the hunter. They escape and Yeager learns from technology he took from the men that a technology magnate and defense contractor named Joshua Joyce is part of what's going on, so they go to find out what's going on. (Read More)
| Subgenre: | martial artssuspenseconspiracysupernaturalepic |
| Themes: | artificial intelligencemurderdeathfriendshiprevengekidnappingbetrayalsupernatural powerparanoiasurveillanceevilapocalypseman versus robot |
| Mood: | car chase |
| Locations: | truckchurchhelicoptersnowmotorcyclesmall townairplanedesertelevatorouter spacechinachicago illinoisgas stationtexaslaboratory …chinese restaurantcar motorcycle chaseabandoned factorymexico citycar truck chase (See All) |
| Characters: | father daughter relationshipteenagerboyfriend girlfriend relationshipteenage girlaliensecurity guardvillainsecretaryamerican abroadsingle fatherengineerchinese girl |
| Story: | sentient robottalking robotlaserproduct placementrobotviolencesequelflashbackfightexplosionknifepistolfireshootoutbeating …corpseshot to deathfistfightmachine guncar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facebattleswordgunfightbrawlfalling from heightheld at gunpointsunglassesbombrunningcar crashcombatshot in the backgood versus evilfoot chaseassassinsword fightambushaxedisguiseambulancedeath of friendimpalementfootballstabbed to deathstabbed in the chestexploding carsevered headno opening creditshit by a carfictional warspaceshipcreaturetransformationon the runtheaterlimousineone against manybinocularscharacter repeating someone else's dialogueprologueelectrocutionfactoryfugitiverace against timebaseball batexploding bodycharacter says i love youmercenarywaterfallsevered armsecret agentespionageciasubtitled scenebattlefieldsingle parentpickup truckmissileuzihand grenadewolfgrenadewarehousehong kongbarnloss of friendspacecraftexploding buildingkicked in the stomachfourth partmovie theaterblockbusteririshhonorend of the worlddinosaurcannonshieldshopliftingexplosivefight to the deathinventor3 dimensionalchaosmutefalling to deathspecial forcesexploding headpunched in the chestthrown through a windowassault riflebooby traphologrambounty hunterbody landing on a carraidcorporationlens flaresevered leglasersightsports cargovernment agentgatling gunlaser gunbased on toybullet timetorso cut in halfabandoned buildingcia agentgiant robotextraterrestrialyellingreturning character killed offex copirish americanarmored carparkourarcticdrone17 year oldbillionairebased on cartooncornfieldexploding trucksawed off shotgunentrepreneurtentaclecrashing through a windowdisembodied headnuclear bombtow truckrogue agentexploding housereference to shakespeare's romeo and julietexploding shipshapeshiftingheroic bloodshedcockney accentcar rolloverbeijing chinaepic battlenuclear weaponnuclear threatwoman punching a manfire breathingalien technologyjumping from a carnanotechnologyhand through chestblack opsgeologistmass destructionthrown through a windshieldmuscle cartransforming robotabandoned shipexploding busgreen bloodbleeped dialoguecar stunthead cut in halfvirgin mary statueman versus machinegreat wall of chinalong tonguefast carsemi truckalien space craftrobot versus robotshape shiftingshape shifting aliencamaroevil robotsecret government organizationalien robotleg blown offexploding bridgedeath by fallingexploding trailerabandoned theaterchevrolet camarorace car driverexploding traincar crashing through a windowbreathing fireannihilationautobotoptimus prime the charactertransformer robotbumblebee the characterabandoned trainmechanical lifeformsuper carextraterrestrial robothuman allywoman held captivesemi truck and trailerstabbed through the backabandoned gasoline stationratchet the characterrobot dinosaurmedical officerautobot insigniaautobot symbolemergency vehiclehuman versus transformerparis texassemi truck driving itself (See All) |
In Bedridge, Professor Parker Wilson finds an abandoned dog at the train station and takes it home with the intention of returning the animal to its owner. He finds that the dog is an Akita and names it Hachiko. However, nobody claims the dog so his family decides to keep Hachi.
| Themes: | deathlovefriendshipchristmasjealousypregnancyweddingfuneralmemorydeath of fathertheatre |
| Mood: | raintearjerker |
| Locations: | bathtubschoolsnowcemeteryairplanekitchenjapanstormshed |
| Characters: | family relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyteachergirlstudentdancerbabyjapanesegrandfather grandson relationshipgrandmother grandson relationship …human animal relationship (See All) |
| Story: | skunkanimalcatwatching tvdogcharacter name in titleflashbacksex scenekissdancingbased on true storytelephone callpunctuation in titlecryingremake …computercamerabeertearsanimal in titlebedapostrophe in titlepianoclassroomsubjective cameranewspaperdeath of friendmontagewidowcoffinforeign language adaptationbathflash forwardsuburbbased on short storychampagnecharacter's point of view camera shotflowerspianistdeath of husbandballetclasssleepingreference to william shakespeareblack americanheart attackpickup truckapplauseloyaltywhat happened to epilogueslow motioncagetold in flashbackrailway stationmilkinterracial friendshipremote controlwindmobile phoneballbookstoresnowingpuppywedding receptionphoto albumposterstairwayfencepopcornbellballerinatrain tracksepiloguecollege professorgravestonereference to shakespeare's hamletpolaroid camerashared bathwaitingdog moviebride and groomnewspaper reporterstreet vendorpoodlehot dog standmotivationaldog lovertalking to a dogbutcher shoprhode islandlost dogdog poundbarkinglocked in a cagereference to thomas edisonboy dog relationshiptripping and fallingdoghousehot dog vendorreference to christopher columbusremake of japanese filmremake of asian filmanimal's point of viewcommuterart restorationmaster dog relationshipbarbecue grillwatching through a windowwedding photographbaggage handlerchange of seasonsdog cagefrench poodlestation masterdog's point of viewanimal licking someoneakitabaseball on tvmusic professorplaying fetchschool report (See All) |
In a distant, but not so unrealistic, future where mankind has abandoned earth because it has become covered with trash from products sold by the powerful multi-national Buy N Large corporation, WALL-E, a garbage collecting robot has been left to clean up the mess. Mesmerized with trinkets of Earth' …s history and show tunes, WALL-E is alone on Earth except for a sprightly pet cockroach. One day, EVE, a sleek (and dangerous) reconnaissance robot, is sent to Earth to find proof that life is once again sustainable. WALL-E falls in love with EVE. WALL-E rescues EVE from a dust storm and shows her a living plant he found amongst the rubble. Consistent with her "directive", EVE takes the plant and automatically enters a deactivated state except for a blinking green beacon. WALL-E, doesn't understand what has happened to his new friend, but, true to his love, he protects her from wind, rain, and lightning, even as she is unresponsive. One day a massive ship comes to reclaim EVE, but WALL-E, out of love or loneliness, hitches a ride on the outside of the ship to rescue EVE. The ship arrives back at a large space cruise ship, which is carrying all of the humans who evacuated Earth 700 years earlier. The people of Earth ride around this space resort on hovering chairs which give them a constant feed of TV and video chatting. They drink all of their meals through a straw out of laziness and/or bone loss, and are all so fat that they can barely move. When the auto-pilot computer, acting o… (Read More)
| Subgenre: | cult filmpost apocalypsedystopiacomputer animationslapstick comedycgi animationspace operalive action and animationbiblical allegory |
| Themes: | lovedeceptionlonelinessamnesiaghost town |
| Mood: | satirerain |
| Locations: | swimming pooldesertouter spaceearthspace station |
| Characters: | babyself destructivenessship captain |
| Period: | future |
| Story: | struck by lightningtalking robotlaserlifelightninganimalrobotcharacter name in titlekisstitle spoken by characterchasefirecryingrescueslow motion scene …tearsorphanbrano opening creditschildacronym in titlespaceshipumbrellamissionscene during end creditsfilm within a filmgiftratmooncaptainslow motionlifting someone into the airspacecraftvideotapeblockbustertowelsocial commentaryhaircutobesitysculptureenvironmental issuemakeupfirst kissthunderstormpollutionrefrigeratorcorporationboxenvironmental issuesholding handsplanthappy endingvideo surveillancefire extinguishermake upcockroachlightervery little dialoguediggingbillboardcommanderdegradationlavashoeelectric shockspace shuttlemale protagonistconsumerismgarbagecruise shipoverweightpart live actionstarshipecological footprintcollectionspoonpsychotronic filmlifting person in airzippo lighterearth viewed from spaceglobedirtextinctionmegacorporationcuriositycorporate executivelight bulbmutinyforkrubik's cubehuman in outer spaceplanet earthstowawayipodlifting male in airtirewastedark futuregarbage dumplifting an adult into the airdehumanizationescape podexodusenvironmental disasterdiamond ringecologicalman versus machinenumber in character's namelifting a male into the airrepairsocial criticsolar powerclosing credits sequencelaunchdust stormleft behindcoolerhuman versus computerbootrun overscrap metalhuman versus machineairlocklaser cutteroil tankersoilstanding in the rainstarship captainautopilotsentiencebrainwashecological disastergarbage chutemorbid obesityunconventional romancewind farmmale captainopening creditsoriginal storyspace junkhubcapself repairhiding in plain sightmodernityadrift in spacetrash compactorbaby's first stepsbleak future (See All) |
In the near future, Major Motoko Kusanagi (Scarlett Johansson) is the first of her kind: A human saved from a terrible terrorist attack, who is cyber-enhanced to be a perfect soldier devoted to stopping the world's most dangerous criminals. When terrorism reaches a new level that includes the abilit …y to hack into people's minds and control them, Major Kusanagi is uniquely qualified to stop it. As she prepares to face a new enemy, Major Kusanagi discovers that she has been lied to: her life was not saved, it was stolen. She will stop at nothing to recover her past, find out who did this to her and stop them before they do it to others. (Read More)
| Subgenre: | martial artscoming of agesuspenseconspiracysuperherodystopiacyberpunkfuturistictech noircorporate conspiracy |
| Themes: | artificial intelligencemurderdeathrevengesurrealismsuicidekidnappingbetrayalfearescapeinvestigationdeceptionmemorycorruptionterrorism …paranoiaredemptionexecutionpanicamnesiaphilosophytechnologyevolutionrobotics (See All) |
| Mood: | neo noir |
| Locations: | barhelicoptermotorcyclecemeterynightclubtaxiurban settingapartmentjapanrooftopslumfishing boatcar motorcycle chasecar truck chase |
| Characters: | mother daughter relationshiptattoofemale protagonistnursehostagetough guywarrioraction herosecurity guardjapanesesniperchinesesniper rifleengineerfemale scientist …self surgery (See All) |
| Period: | near future |
| Story: | garbage truckrobot as pathoslaserlifevanrobotcatdogviolenceflashbackbare chested malegunfightcigarette smoking …dancingexplosionknifelesbian kisschasepistolfireshootoutbeatingcorpseshot to deathfistfightmachine guncar accidentshot in the chestremakeshot in the headshotgunrescueslow motion scenepunched in the facearrestgunfightbrawlshowdownheld at gunpointbeerhand to hand combatbombcar crashinterrogationhallucinationhandcuffsrevolvercombatscientistsubjective cameraspybisexualfoot chaseflashlightassassinambushterroristmassacremontagewidowmixed martial artstied to a chairfalse accusationanti herodisarming someoneunderwater scenegraveyardcigar smokingshot in the legshot in the foreheadbartenderlatex gloveson the rungunshotflash forwardattempted murderone against manybinocularscharacter repeating someone else's dialoguebeaten to deathdangerprologueelectrocutionbased on mangafugitivecharacter's point of view camera shotrace against timecover upknocked outkicked in the facetough girlopening action scenestreet shootoutmanipulationbodyguardinjectionexploding bodysevered armhandgunsecret agentobscene finger gesturesubtitled scenestylized violencehenchmaneavesdroppingmissileidentityuzihand grenadelgbtgrenadebulletassassination attemptelectronic music scorehypodermic needleheavy rainscene during opening creditstemplekicked in the stomachjumping from heightstrong female leadmind controlrocket launcheraction heroinegun fusocial commentaryandroidpresumed deadfemale warriorcyborgthugreverse footagehaunted by the pastexplosivedual wieldexploding headpunched in the chestjumping through a windowassault rifleaerial shotsexy womanhologramyakuzabulletproof vestdisfigurementraised middle fingerraiddark pastexistentialismlasersightterrorist plotexploding helicoptergovernment agentgatling guntelepathybullet timeprime ministermemory lossshot through a windowbisexual womanterrorist groupface maskharboralleyhackerfinal showdowntasersuper strengthmachinemajorfemale spybillboardhelicopter crashcomputer hackerman kills a womanwoman kills a manbased on animefight the systemexperiment gone wrongmetal detectorhigh techoverturning cartragic pastwoman fights a manmind readingcar rolloverceonight vision gogglesanti heroineevil corporationx rayed skeletonhackingkidnaptragic villainloss of memoryslow motion action scenecityscapekiller robotjumping from a rooftopmegacorporationcorporate crimeenglishwoman abroadcorporate executivewoman punches a manchopsticksbombardmentdark heroinerepressed memorycorrupt businessmangeishadisobeying ordershybridindividualitynight cityscapefalse memoryphilosophicalimplanthit with a car doormiddle fingerhand gunexposed braininside the mindvirtualitynetworkrobot as menacesecret projectfree fallstorm draincyberneticsphilosophical conversationsecret government organizationremake of japanese filmcorporate corruptionscience projecttragic heroinebeing shot atwar machinesecret lairbelongingsecret hideawaycyber terroristcyberterrorismhit teamwhitewashhit listlive action remake of animesuper visionjump from heightbisexual lead characterinner journey (See All) |
Sam Flynn, the tech-savvy 27-year-old son of Kevin Flynn, looks into his father's disappearance and finds himself pulled into the same world of fierce programs and gladiatorial games where his father has been living for 20 years. Along with Kevin's loyal confidant Quorra, father and son embark on a …life-and-death journey across a visually-stunning cyber universe that has become far more advanced and exceedingly dangerous. Meanwhile, the malevolent program CLU, who dominates the digital world, plans to invade the real world and will stop at nothing to prevent their escape. (Read More)
| Subgenre: | martial artssuperherodystopiacomputer animationcyberpunkallegorydisney |
| Themes: | artificial intelligencemurdersurrealismbetrayalescapedeceptionmagicangersupernatural powersurveillanceevilself sacrificeutopia |
| Locations: | barswimming poolcarmotorcyclenightclubtaxielevatorpolice stationseatunnelmotorcycle chasetwo on a motorcycle |
| Characters: | father son relationshiptattooalienpolicemanwarriorsecurity guardfatherengineeryounger version of charactercolleague colleague relationship |
| Period: | 1980s2000s |
| Story: | parachutelaserlifelightningproduct placementbridgetwo word titledogcharacter name in titlebloodviolencesequelflashbackbare chested malephotograph …explosionchasepistolpunctuation in titlecryingmirrorrescuepunched in the facecomputercameraarrestbrawlfalling from heightbookbeerbombsecond partdecapitationgood versus evilorphanflashlightarmyprisonerstabbed in the chestinternetdinnersevered headno opening creditsanti herofictional warnews reportnecklacebartenderparklibrarypilotcharacter repeating someone else's dialogueprologuemini skirtumbrellaactor playing multiple rolesrace against timeprankspeechdisappearancepursuitcontestexploding bodypigtrapreuniondirectorial debutsevered armfireworksgrandmotherdismembermentgaragehenchmanexperimentgrenaderaceelectronic music scorecopheavy rainlooking at oneself in a mirrorhelmetsecurity camerabeardhidingexploding buildingblockbustereccentricvirtual realitycgigenocidetorchapplefemale warriorwatching televisionanthropomorphismguardbarefootthunderfight to the deathgrandfatherresistanceson3 dimensionalfalling to death3djumping through a windowcartoonhologramalternate realitydisfigurementbody landing on a carpop songcanecorporationlens flarestadiumlasersightsecret identitysequel to cult favoritedictatorlightwilhelm screamclonecoinchildhood memoryteleportationposterrockettorso cut in halfleather jacketreturning character killed offfemale fighterspiral staircasesuit and tieportalrace carmegalomaniacarcadecheering crowdsplit personalitybearded mancomputer hackercrash landingsimulationman punching a womansunriseshort skirtmale protagonistaltered version of studio logofight the systemgame playingaircraftfather son reunioncircular staircasemotorcycle coparm cut offchild abandonmentpsychotronic filmelevator shafttechno musichackingregenerationstock marketcamera focus on female buttbedtime storysecret doorcut armzenel trainrubik's cubepagernew identityhidden doorexploding motorcyclehumanoidmotorcycle crashman punches a womansuper computercomputer programmerjedi knightboard meetingnightclub ownerbar ownershort haircyberspacecoors beerlong lost fathervirtual setbomb explosionbase jumpingfalling downmysterious disappearancefirst filmcomputer gamecomputer programair guitarfalling into a holedeathmatch3d sequel to 2d filmcartoon reality crossoverford motor companyhit by a motorcyclevirtual worldbody suitpug dogford crown victoriadiscreference to jules verneactor reprises previous roleimax versionneo 80squarterblurred visioncomputer simulationfalling elevatorglass elevatoropening creditssecret entrancetelevision news reportbrain in a vatinspirational speechreal worldcomputer generated imagerygladiatorial combatimpound yarddeath matchfalling down a holeprotagonist and antagonist played by same actorvirtual character come to lifeamputated armducatisetting a trapautocracycomputer worldford fusioninside a computerplaying air guitar (See All) |
When a devastating event befalls the city of San Fransokyo and catapults Hiro into the midst of danger, he turns to Baymax and his close friends adrenaline junkie Go Go Tomago, neatnik Wasabi, chemistry whiz Honey Lemon and fanboy Fred. Determined to uncover the mystery, Hiro transforms his friends …into a band of high-tech heroes called "Big Hero 6." (Read More)
| Subgenre: | martial artssuperherofuturisticcgi animationdisney |
| Themes: | artificial intelligencefriendshiprevengebetrayalescapefuneraldeceptionterrorismgriefself sacrifice |
| Mood: | car chase |
| Locations: | cemeterykitchenpolice stationsan francisco californialaboratorycar in water |
| Characters: | father daughter relationshipteenagerbrother brother relationshipteenage boyprofessoraunt nephew relationshipself referentialrevenge motive |
| Story: | talking robotlaserrobotcatflashbackexplosionchasesurprise endingfirefistfightrescueslow motion scenearrestpaintingbased on comic …hand to hand combatcafecollegeislandscientistgood versus evilbased on comic bookmansionmontageno opening creditsdrawingunderwater scenenews reporttrainingcollege studentdeath of brotherbodyguardexploding bodygeneralsacrificeicenerdtraitorsabotageflyingcomic bookgroup of friendstoyexploding buildingpress conferencefaked deathandroidmasked mannicknamechild's point of viewmourninginventor3 dimensionalbutlerscene after end creditsmarvel comicshologrameye patchsecret identityflamethrowerloss of brotherteleportationsurprise after end creditsfinal showdownmini dressportalcomic reliefscooterno title at beginningfall from heightsuperhero teamsoccer ballhigh techcollege campushot air balloonmasked heromasked villaingolden gate bridgealternate dimensionabandoned warehouseteenage herofictional citychild prodigyindustrialistexhibitionhidden roomel trainbubble gumnanotechnologyteenage superheroanti villainsupervillainfear of heightscostumed herorobot versus robottoy robottrue identity revealedboy geniusrobot suitfemale astronautfalling from a windowflying robotmarvel animatedspace capsuleschool mascotattempted revengescene at a windowscience labscience show (See All) |
Two artificial intelligence engineers come together as they work to create the first ever self-aware artificial intelligence. A veteran AI engineer secretly hopes to develop technology to help his diseased daughter, even if it means funding comes from the powerful Ministry of Defence (MoD). His new …partner, a young woman gifted in the field of AI, is brought on after her breakthroughs are recognized by the MoD. Things go wrong when the MoD takes over and advances the researchers' work to the next level, teaching the AI to kill and follow MoD instructions with its new and nearly indestructible body. (Read More)
| Subgenre: | independent filmmartial artsblack comedysuspensedystopiacyberpunkfuturistic |
| Themes: | artificial intelligencemilitarymurderdeathrevengesurrealismbetrayalfearescapedeceptionparanoiasurveillancepanicdyingrevolution …self sacrificetechnologydeath of daughterrobotics (See All) |
| Mood: | gorenightmare |
| Locations: | hospitalelevatorwheelchairlaboratory |
| Characters: | father daughter relationshipdoctortattoosoldierhostagechineseamerican abroadsingle fatherengineerex soldierbabe scientistamerican in the ukself immolation |
| Period: | near future |
| Story: | robot as pathoscomputer crackerbutterflyrobotdogfemale nuditycharacter name in titlebloodviolencebare breastsflashbackbare chested malefemale rear nudityfightcigarette smoking …dancingtitle spoken by characterexplosionknifesurprise endingpistoltopless female nuditycell phoneshootoutcorpseshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headrescueslow motion scenebattlegunfightbrawlbare buttheld at gunpointhand to hand combatlow budget filmbritishsciencecombatkung fuscientistshot in the backsubjective cameraspyassassinbound and gaggedambushstrangulationdisguisemontagethroat slittingstabbed to deathmixed martial artsstabbed in the chestweapontied to a chairno opening creditsfictional warshot in the foreheadtrainingdangerstabbed in the backkarateprotestwidowerperson on fireelectrocutioncharacter's point of view camera shotactor playing multiple rolesrace against timecover upkicked in the faceshot in the shouldermanipulationscarbodyguarddeath of sonneck breakingsuspicionthreatened with a knifemercenarysecret agentsingle parentcold warsurgeryexperimenteavesdroppingundergroundhand grenadegamegrenadeburned aliveelectronic music scoreheavy rainloss of loved onespiderrebelsocial commentaryandroidcyborgcamera shot of feettarget practiceresearchloss of soninventorjob interviewstabbed in the neckmuteassault riflehologramtitle at the endeye gougingdisfigurementlens flarewar veteranbroken armdeath of loved oneburned to deathmoral dilemmablood on camera lenstasershot in the necksuper strengthgolf clubloss of daughteramputeeno title at beginninghugscalpelcomputer hackerfilm starts with textman kills a womanbritish armywoman kills a manstabbed in the shoulderfight the systemfilmed killingquarantinetwo way mirrorhigh techconsciousnessstabbed in the facewoman fights a mansubterraneanmilitary trainingman on firebrain damagenakedglowing eyeszippo lightercamera focus on female buttcoercionbegins with textcomputer virusstabbed multiple timesmicrochipman wearing a wighomeless womanprosthetic limbpneumoniasuper computerfemale star appears nudelobotomyimplantmarblesecret laboratorywar woundbrain scanbasic trainingwoman murders a mancyberneticsman murders a womanbritish governmentstabbed with a penreference to george orwell's 1984prostheticsopening creditsartificially created womanministry of defencemissing armunderground complexturing testmissing leg (See All) |
A massive ball of furry creatures from another world eat their way through a small mid-western town followed by intergalactic bounty hunters opposed only by militant townspeople.
| Subgenre: | independent filmcult filmblack comedysuspenseb moviecreature featuresurvival horrormonster movie |
| Themes: | murderdeathlovesurrealismkidnappingfeardrunkennessescapemonsterdeceptionsupernatural powerparanoiahome invasionpaniccourage …near death experiencespace travel (See All) |
| Mood: | satirenight |
| Locations: | barchurchhelicoptersmall townbicyclekitchenpolice stationfarmpolice carrooftopouter spacebicycle accident |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlpolice officeralienpriesthostagelittle boy …alcoholicsheriffalien monster (See All) |
| Period: | 1980s |
| Story: | lasercowfirst partlightningcatwatching tvbloodviolenceone word titlecigarette smokingphotographtitle spoken by characterexplosionknifesurprise ending …firecorpseshot to deathblood splattercar accidentshot in the chestshotgunrescueslow motion scenerifleheld at gunpointbombcar crashrevolveralcoholtelephonesubjective camerasurvivalbedroomflashlightambushaxeimpalementtoiletradiochild in perilspaceshipcreaturepolice officer killednews reportbartendertreedangerprologuescreamingelectrocutionfirst of seriespay phonefugitivepoisoncharacter's point of view camera shotmissionrace against timeknocked outbaseball batprankexploding bodyfireworkssubtitled sceneufoarsonpickup trucksabotagedestructionburned aliveelectronic music scoreeggscene during opening creditsbarnjail cellspacecrafteccentricphone boothsocial commentarybroken legeaten alivemechanicredneckwhiskeyalien invasionwoman in jeopardydamsel in distressreverse footagestealing a carbraveryimpostormercilessnesspower outagechaospool tableevacuationhousewifepsychotronicescape attemptcigarette lighterhologramone daybounty huntersiegebowlingbroken armdead boymutationlaughingcellarburned to deathlaser gunsouthern accenthit with a baseball batclose up of eyesextraterrestrialmolotov cocktailhomageteenage lovescene before opening creditssuper strengthfarmhousebowling alleyreverendasteroidaudio cassetteconsumerismdeath of boyfriendslingshothijackingshockshot in the throatalien contactexploding houseexploding shipkansaspitchforkpsychotronic filmimprovised weaponprison wardenstupid victimclimbing out a windowglowing eyesalien creaturefirecrackeralien racehostile takeoverearth viewed from spacechild swearingchild with a gunmushroom cloudhuman alienhuman versus alienorganistruralloss of boyfriendenglish subtitles in originalkidnapped girlspikeclichedeus ex machinatranquilizerevil laughterhumanoid alienhovercraftstolen police carshape shiftingshape shifting alienhayloftman eating monsterman with a ponytailreference to john travoltatransmissionhuman duplicationgroundedspray canboy eatengas lampcattle mutilationfictional languageextraterrestrial alienbitten in the armalien versus alienchurch organbitten in the legfiling (See All) |
Gloria (Anne Hathaway) is an out-of-work girl who, after getting kicked out of her apartment by her boyfriend, is forced to leave her life in New York and move back to her hometown. When news reports surface that a giant creature is destroying Seoul, South Korea, Gloria gradually comes to the realiz …ation that she is somehow connected to this far-off phenomenon. As events begin to spin out of control, Gloria must determine why her seemingly insignificant existence has such a colossal effect on the fate of the world. (Read More)
| Subgenre: | independent filmblack comedyparanormal phenomenacreature featuremonster movie |
| Themes: | deathfriendshiprevengesurrealismjealousyfeardrunkennessescapemonsterangersupernatural powerparanoiaredemptionguiltinsanity …abusehome invasionalcoholismpanicunemployment (See All) |
| Mood: | ambiguous ending |
| Locations: | new york citybarswimming poolhotelhelicoptersmall townairplanetaxiairportapartmentpolice cargas stationschool bus |
| Characters: | female protagonistsoldierwriterbullywaitressalcoholicamerican abroadex boyfriend ex girlfriend relationshipchildhood friend |
| Period: | 2010s |
| Story: | struck by lightninglifelightningproduct placementrobotwatching tvbloodviolenceone word titleflashbackkissfightdancingphotographexplosion …chasesurprise endingfirecell phonefistfightface slapslow motion scenepunched in the facewritten by directorbattlebrawlshowdownbeerf wordambulancewomanmontagearmydinermapno opening creditschild in perilcreaturenews reportbartenderflash forwardparktreestalkerhotel roomdangerprologuerace against timeknocked outmanipulationscarstalkinglaptoppremarital sexfireworkslove interestnewspaper headlinesubtitled scenepickup truckdisasterdestructionmass murderbeer drinkingbeardyoutubejumping from heightmind controlrampageplaygroundfight to the deathgash in the facedeath threatevacuationkicked in the crotchthunderstormjumping through a windowaerial shotblack eyeexploding helicoptertelekinesispsychoticmoral dilemmamedia coveragememory lossenglishman abroadgiant robotmagic tricklevitationfinal showdownhomagehuman monstergiant monsterblackoutabandoned housebully comeuppanceyoung version of characterman punching a womanfinal battlewoman fights a mancamera phonefemale bartenderwoman slaps a manlifting person in airfirecrackerhostage situationloss of memorywoman punching a manhit with a chairabusive relationshipwoman punches a mankaijutv setgiant creatureaction figureemotional abusegooglebar ownerplaying cardthrown from heightseoulfilm with ambiguous titlequirkytoy robotmanifestationjumping into a pool with clothes onman woman fightair mattressdumped by boyfriendwoman with a black eyeseoul south korearobot monster battle (See All) |
When young Victor's pet dog Sparky (who stars in Victor's home-made monster movies) is hit by a car, Victor decides to bring him back to life the only way he knows how. But when the bolt-necked "monster" wreaks havoc and terror in the hearts of Victor's neighbors, he has to convince them (and his pa …rents) that despite his appearance, Sparky's still the good loyal friend he's always been. (Read More)
| Subgenre: | stop motion animationpuppet animation |
| Themes: | deathfearmonstergrief |
| Mood: | rain |
| Locations: | swimming poolcemeterysmall townbicyclepolice carbaseballsewer |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipteacherstudentbabylittle girllittle boymayor |
| Story: | lifelightningcatwatching tvdogone word titlephotographexplosionsingingfirecryingcorpserescuesecrettears …runningneighborclassroomscienceflashlightcandleambulancecoffindrawinghit by a carcreaturesearchgravemicrophonesuburbumbrelladollbaseball batscreamspeechratstagenewspaper headlinerecord playerexperimentapplauseballoonwatching a moviespiderlossphone boothfrogaudiencehome moviecarnivaltorchfull moonpromisethunderpet dog3 dimensionalshovelaquariumturtlechainuncleposterbatfiremantombenergyelectricitynotebookgategiant monsterfencepopcornelementary schoolgoldfishbellblackboardbaseball gamekitebased on short filmfrankensteinbackyardwindmillroller skatesgravestoneanguishpigtailsmovie cameradog moviebaseball fieldfairpet catslimearm slinghorror for childrenhunchbackangry mobphonograph recordreanimationfairground3 dmovie projectorexhumationniececadaverloftbanneromenscience experimentspeakerclotheslineumpiregrave robbingscreenauditoriumbaseball gloveremake by original directorscience teacherschoolhousebaby strollerscience fairbaseball pitcherscience projectnerd boydeath of a petsurgical stitchesvacuum cleaningmanhole coverpet cemeteryfrench poodleback to lifefrankenstein spoofboltelectric kiss (See All) |
In the near future, the Navy develops a fighter jet piloted by an artificial intelligence computer. The jet is placed on an aircraft carrier in the Pacific to learn combat manuevers from the human pilots aboard. But when the computer develops a mind of its own, it's the humans who are charged with s …topping it before it incites a war... (Read More)
| Themes: | artificial intelligencemilitarysuicidebetrayalfuneralterrorismself sacrificeradiationfuneral at sea |
| Locations: | foresthelicopternightclubcastlerussiacavealaskaairplane accidentairplane shot down |
| Characters: | sniperamericancomputer engineer |
| Story: | malfunctionparachutelightningone word titlebare chested maletitle spoken by characterexplosionshootoutmachine gunslow motion scenearrestbikinishowdowncafeterrorist …death of friendcigar smokingpilotshot in the shoulderwaterfallprofanityobscene finger gesturewashington d.c.flirtingmachismoeavesdroppingmissilesyringehypodermic needlejeepcrushforbidden loveanimal attackmedical examinationthunderstormscene after end creditsaviationairplane crashcasual sexexploding helicoptergatling gunseattle washingtonsurprise after end creditstreasontelevision newsdroneplane crashnavyflarecrash landingfighter jetexploding truckfighter pilotbehind enemy linesu.s. navysole black character dies clichehigh technewscastwoman in a bikinistealthair raidaircraft carrierdemolitionnorth koreadogfightaerial combathedonismscrabblescience runs amoknuclear weaponnuclear threatbuilding collapsestudio logo segues into filmfemale pilothangarexploding planenaval officermortarinsubordinationman versus machineanti aircraft gunsearch and rescuetalking computerfacial cutupside down camera shothuman versus computermilitary funeralcollateral damagemyanmarnuclear warheadfuturistic aircrafthuman versus machineopen air marketejection seatjet aircrafttajikistanreference to the three musketeerscomputer geniusf 18 hornetmountain rangestinger missilemid air collisionmil mi 8 hip helicoptersurface to air missileequationaerial refuelingaerial dogfightdemilitarized zonefacial recognitionpilot ejectsspeech synthesisair to surface missilekorean demilitarised zonerangoon (See All) |
Marty McFly, a typical American teenager of the Eighties, is accidentally sent back to 1955 in a plutonium-powered DeLorean "time machine" invented by a slightly mad scientist. During his often hysterical, always amazing trip back in time, Marty must make certain his teenage parents-to-be meet and f …all in love - so he can get back to the future. (Read More)
| Subgenre: | cult filmteen movieteen comedyalternate historytime travel comedy |
| Themes: | time traveldysfunctional family |
| Mood: | high school |
| Locations: | helicoptersmall townbicycleurban settingschool dance |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipteenagerteenage girlteenage boybullyself worth |
| Period: | 1980s1950sfutureyear 1985 |
| Story: | computer crackerfirst partlightningproduct placementdogphotographtitle spoken by characterchasesurprise endingfireunderwearshotgunslow motion sceneguitartelevision …bandterroristvideo camerawomanfour word titledinerhit by a carracial slursuburbfirst of seriespay phonemistaken identityrace against timeautomobiletv newsdestinyteen angstjeeplifting someone into the airbarnmad scientistoverallsblockbusterpart of trilogycrushskateboardpeeping tomclocktelescopeunderage drinkinginventorshopping malllove at first sightfirst kissthunderstormbulletproof vestgeekparking lotcar troublefire extinguisherirish americancafeteriafirst datetime machinebully comeuppancepolitical campaignfamous scorereference to ronald reaganunwanted kiss555 phone numberflying carpepsisequel mentioned during end creditsparadoxgirl next doornuclear powerspit takefamous songfalling from a treetoyotacastle thunderperson in car trunkclock toweraltering historyyear 1955lifting a male into the airplutoniumreference to darth vaderbattle of the bandsreference to pepsireference to jerry lewisbutt grabmanurerube goldberg machineremote control cardeloreanchocolate milktime travellerinterrupted kissburger kingself fulfillmentreference to chuck berryreversal of fortunebreakfast machinedigital watchmale time travellerscale model of citybottle openercoonskin capwaking up in strange surroundingsaudio feedbackmalt shop (See All) |
Ray Ferrier (Cruise) is a divorced dockworker and less-than-perfect father. When his ex-wife and her new husband drop off his teenage son Robbie and young daughter Rachel for a rare weekend visit, a strange and powerful lightning storm suddenly touches down. What follows is the extraordinary battle …for the future of humankind through the eyes of one American family fighting to survive it in this contemporary retelling of H.G. Wells seminal classic sci-fi thriller. (Read More)
| Subgenre: | cult filmsuspensedisaster film |
| Themes: | militarymurderdeathkidnappingbetrayalpregnancyfeartorturedrunkennessescapemonsterdeceptiondivorcebrutalityabduction …panicdyingapocalypsenear death experiencealien abduction (See All) |
| Mood: | gorerain |
| Locations: | trucknew york cityrestauranttrainchurchhelicopterlos angeles californiaparis francelondon englandbicycleaustraliashipbaseballouter spacestorm …usatunnelsuvcar in water (See All) |
| Characters: | family relationshipsfather son relationshippolicemother son relationshipfather daughter relationshipteenagermother daughter relationshipsingerbrother brother relationshipbrother sister relationshipteenage boygirlsoldieralienpoliceman …hostagelittle girljapaneseex husband ex wife relationshipsingle fathership captainmother in law son in law relationshipairplane stewardess (See All) |
| Period: | 2000s |
| Story: | lightningvanbridgewatching tvbloodviolencegunfightphotographexplosionsingingsurprise endingpistoltelephone callfire …voice over narrationcryingcell phonesongcorpseblood splatterfoodmachine guncar accidentmirrorremakeshotgunrescuebattlerifletearsdead bodycaferivercombatreportergood versus evilsurvivalflashlightambushaxemassacrevideo cameraeatingfour word titlesubwaybirdchild in perilfictional warspaceshipunderwater scenecreaturedrowningbeaten to deathdangerscreamingelectrocutionstatuetanklong takeamerican flagcrossexploding bodybasementratblindfoldsleepingrefugeeeuropeufobattlefieldriotpickup truckdisastertv newsundergroundhand grenadegrenadedestructionjeepcagesurvivorrome italyworking classexploding buildingblockbusterdesperationmobskateboardrocket launcherearthquakealien invasionremote controltensionstealing a carinvasionnew jerseyu.s. armyboston massachusettsmercilessnesschaoshungerevacuationshovelescape attemptsunairplane crashcellarferryneighborhoodreckless drivingasiabazookaearphonesextraterrestrialelectricitycartoon on tvmachineplane crashbroken windowdiggingtv reportertraffic jamcredit cardtentacleauto mechanicsouth americacarjackingalien contactallergypatriot10 year oldmass gravepsychotronic filmu.s. air forceathens greecealien creaturealien racecruiserefugee campdriver's licenseextinctionalgeriapower failurehuman versus alienauto theftfreezingipodhiroshima japanartillerymass destructionpeanut butterlullabybacteriamini vanmass deathsinking shipbridge collapsealien attackelectro magnetic pulsehumanity in perilplaying catchreflection in waterdestroyed cityblood donationjurassic parkhiding under a tableplane wrecksolar flaremilitary convoyrunaway trainsmashing a windowcar enginedeath rayunidentified flying objectcosmic zoomfalling overboardopening creditscapsized boatstalled cardead body floating in a riveru.s. national guardcapsizing shipexploding persontv news crewwoman disintegrateddisintegrating body (See All) |
Bolt, an American white shepherd, has lived his whole life on the set of his action TV show, where he believes he has superpowers. When separated from the studio by accident, he meets a female alley cat named Mittens and a hamster named Rhino. He's trying to find the way home, to the studio. Along t …he way, he learns that he doesn't have superpowers and that the show is not real. (Read More)
| Subgenre: | computer animationfish out of watercgi animationdisney |
| Themes: | friendshipescapehollywoodcourage |
| Locations: | new york citytrainhelicopterdesertroad tripjungle |
| Characters: | actressbully |
| Story: | laserlifevancatdogcharacter name in titleone word titletitle spoken by characterchasefirerescuetelevisionnew yorkmontagemap …no opening creditsbirdpaintrainingelectrocutionfilm within a filmsadnesslas vegas nevadamissileslow motiontalking animalcampmovie directortorchanthropomorphismguardhungermovie setbarbecuewilhelm screamexploding helicopterpigeongatling guntimebombohiogerman shepherdbrooklyn bridgetrailer homebillboardhelicopter crashexploding trucktrailer parkhollywood signmovie studiolook aliketeamworkillinoisdisillusionmentgolden gate bridgedog moviehamstermissouristun gunsuperpoweranimal shelterpet shopstickanimal protagonistdog poundpet owner relationshipgod complexfanboyjourney shown on mapsimulated realitywhite doganimal control workerartificial realitymovie agentbarkanimal escapes poundstyrofoam (See All) |
John makes a Christmas miracle happen by bringing his one and only friend to life, his teddy bear. The two grow up together and John must then choose to stay with his girlfriend or keep his friendship with his crude and extremely inappropriate teddy bear, Ted.
| Subgenre: | coming of ageblack comedyabsurdismslapstickslapstick comedy |
| Themes: | friendshipkidnappingchristmasdrunkennessescapedanceweddingdeceptionmagicabusehomophobiabreak up |
| Mood: | car chase |
| Locations: | bathtubbarrestaurantchurchhotelcarsnownightclubapartmentcityoffice |
| Characters: | homosexualfriendboyfriend girlfriend relationshipsingerboyprostitutehostagegay kisssecurity guardhomosexualityemployer employee relationshipgay friend |
| Period: | 1980s2010s80syear 2012year 1985 |
| Story: | lifefirst partlightningproduct placementwatching tvcharacter name in titleone word titleflashbackmale rear nuditysex scenekissfightphotographtitle spoken by characterparty …knifechasesurprise endingvoice over narrationcell phonebeatingfistfightcar accidentblonderescueslow motion scenepunched in the facewritten by directorbrawlbare buttfalling from heightpaintingbeercar crashmarijuanapianohallucinationf wordfoot chasegay slurconcertmontagefootballcocainebrunettenarrationritualspankingmarriage proposalparksmokingstalkerfantasy sequencemoaningchristmas treestalkingthreatened with a knifeobscene finger gesturegay couplekissing while having sexwhippingpot smokingsupermarketwhat happened to epiloguediscohead buttheavy rainflatulenceteddy bearbossback from the deadanthropomorphismcameoanti semitismgrocery storereconciliationthunderitalian americanwhipboston massachusettsjob interviewresurrectionkaraoketvsexual harassmentwisecrack humorrainstormbody landing on a cardressing roomduckstadiumethnic slurcrude humorarrogancetorso cut in halfmarijuana jointanniversaryalleycartoon on tvchristmas presentstabbed in the handbongscene before opening creditsmarketblonde womanfacebookhouse partymassachusettsplaystation 3reference to twitterreference to james bondreference to star warsfart jokedrug humorscatological humortoy gunscoldingcrazy humorlong brown hairvillain arrestedhide and seekbromancefanaticbaseball stadiumbudweiserexcrementmultiple time frameschild swearinggross out humorwoman moaning from pleasurewoman moaningsevered earmoaning womanlong blonde hairrascalstudio logo segues into filmart collectorshooting startoy comes to lifehdtvasian stereotypedirected by co starfat boyrocking horsereference to justin bieberdouble dateobscene gesturereference to indiana joneswild partycomedic sex scenereference to godzillafenway parkreference to joan crawfordends with weddingnegative asian stereotypereference to katy perrycosmic zoomwishes come trueparty gamereference to flash gordonhumorous sex sceneflash gordonco worker co worker relationshipreference to sinead o'connortalking teddy bearknocking a hole in a wallreference to channing tatumreference to tom bradystuffingreference to james franco (See All) |
Hardcore Henry is an action film told from a first person perspective: You remember nothing. Mainly because you've just been brought back from the dead by your wife (Haley Bennett). She tells you that your name is Henry. Five minutes later, you are being shot at, your wife has been kidnapped, and yo …u should probably go get her back. Who's got her? His name's Akan; he's a powerful warlord with an army of mercenaries, and a plan for world domination. You're also in an unfamiliar city of Moscow, and everyone wants you dead. Everyone except for a mysterious British fellow called Jimmy. He may be on your side, but you aren't sure. If you can survive the insanity, and solve the mystery, you might just discover your purpose and the truth behind your identity. Good luck, Henry. You're likely going to need it... (Read More)
| Subgenre: | independent filmmartial artsblack comedyexperimental filmsuspenseconspiracyabsurdismpunkrevenge plottech noir |
| Themes: | artificial intelligencemurderdeathrevengesurrealismkidnappingrapebetrayaltorturedrunkennessescapegangsterdeceptionmemorypsychopath …brutalitysupernatural powerterrorismsadismsurveillancehome invasionexploitationpanicamnesiacourageself sacrificepolice brutalitypolice corruptionnear death experiencerobotics (See All) |
| Mood: | gorecar chaseavant garde |
| Locations: | truckbarbeachforesthelicoptermotorcycleairplanebuselevatorwoodswheelchairapartmentpolice carrooftoprussia …strip clubbrothellaboratorycar motorcycle chaseairship (See All) |
| Characters: | husband wife relationshippolicedoctortattooprostitutesoldierhostagetough guywarrioraction herobullysecurity guardsniperrussianpolice shootout …sniper riflepolice chaseself mutilationhomeless manbabe scientist (See All) |
| Period: | near future |
| Story: | garbage trucktracking deviceparachutelaservanrobotcatdogfemale nuditycharacter name in titlebloodviolencebare breastsflashbackbare chested male …gunfemale rear nudityfightcigarette smokingexplosionknifechasesurprise endingpistolfiretopless female nuditycell phoneshootoutbeatingcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorbattleswordgunfightbrawlbare buttfalling from heightshowdownheld at gunpointhand to hand combatsunglassesbombcar crashinterrogationorgyrevolvercombatstripperscientistshot in the backf wordsubjective cameradecapitationgood versus evilsurvivalfoot chasegay slurassassinambushterroriststrangulationaxemassacredisguisemontagethroat slittingarmyimpalementcocainestabbed to deathmixed martial artsstabbed in the chesttied to a chairsubwayexploding carsevered headanti herodisarming someoneone man armyhit by a cardouble crossunderwater scenepolice officer killedfemme fataleshot in the legshot in the foreheadon the runpoint of viewparkattempted murderone against manydrug addictbeaten to deathdangerstabbed in the backperson on fireelectrocutionattackfantasy sequencefugitivecharacter's point of view camera shotevil manknocked outkicked in the facebaseball battankstreet shootoutshot in the shoulderlong takemanipulationbodyguardexploding bodyneck breakingpremarital sexcharacter says i love youmercenarydirectorial debutsevered armshot in the armsilencerobscene finger gesturedismembermentsubtitled scenecorrupt copstylized violencehenchmanak 47crime bossmachismouzihand grenadedestructionburned alivehead buttassassination attemptelectronic music scoremachetesociopathwalkie talkiemad scientistkicked in the stomachvillainesseccentricjumping from heightgrindhouserape victimfaked deathmind controlparking garagerock starrocket launcherrapistgun fucrushed to deathback from the deadmasked manbikergun battlecyborgthugrampagedamsel in distressshieldstealing a carbraveryfight to the deathhippiedual wieldstabbed in the throatinventormercilessnesschaosresurrectionmuteshot in the faceescape attemptstabbed in the headcigarette lighterstabbed in the legexploding headpunched in the chestjumping through a windowgang rapemusical numbercommandoone dayeye gougingwedding ringbulletproof vestdisfigurementbody landing on a carknife throwingraised middle fingerstabbed in the eyefemale doctorcastrationbody countterrorist plotkilling spreeflamethrowerburned to deathwilhelm screamclonetelekinesisgatling gunshot multiple timesgrenade launcherbullet timemoscow russiahit with a baseball batvodkamemory lossenglishman abroadtext messagingshot through a windowmarijuana jointabandoned buildingbazookablood on camera lensreference to elvis presleyterrorist groupfinal showdownstabbed in the handburied alivemolotov cocktailtaserspit in the facepistol whipstrongmanhead blown offscene before opening creditsarmored carsuper strengthparkourescalatorworld dominationmegalomaniacskyscraperstabbed in the armclimbing through a windowanarchycrash landingsawed off shotgunman kills a womanoffscreen killingcrashing through a windowwoman kills a mansex clubstabbed in the shoulderbullet woundfinal battledrive by shootingbritish soldierexperiment gone wronghigh techsome scenes in black and whitestabbed in the facecloningcut into piecesspitting bloodcockney accentcocaine snortingimprovised weapontommy gunshot through a doormurder spreefade to blacklifting person in airbreaking a bottle over someone's headheart in handknocked out with a gun buttarmoryhummerbilingualisminnocent person killedfreewaythrown from a carmotorcycle with a sidecarthroat cutwoman wearing black lingeriecryogenicsloss of memorythroat rippingdetonatorhit with a chairflame throwerreference to charlie chaplininvulnerabilityrescue attemptsong and dancebatteryshot through a wallbalisonghidden doorprosthetic limbbroken fingerleft for deadshaky camhand through chestsuper computervideo recordingsuper soldierlugerthrown through a windshieldalbinoescape podhit with a rockfirst personshipping containerover the topbroken backimplantprosthetic legsecret laboratorycamouflage uniformfighting in the airwater tankriding a busreference to darth vadertoy robotkilled by a propellerabandoned hotelcyberneticstaseredwalking in the woodsknife in handprosthetic armamnesiacshot through the floorstopped by policeclimbing up a buildingfighting with selfstabbed through the mouthfragmentation grenademil mi 8 hip helicopter50. caliber machine gundriver shotfiring guns from both handsghillie suitroof collapseevasionhanging from a ropechest ripped openclothes shoprobot hand (See All) |
The year is 2071. Following a terrorist bombing, a deadly virus is released on the populace of Mars and the government has issued a 300 million woo-long reward, the largest bounty in history, for the capture of whoever is behind it. The bounty hunter crew of the spaceship Bebop; Spike, Faye, Jet and … Ed, take the case with hopes of cashing in the bounty. However, the mystery surrounding the man responsible, Vincent, goes deeper than they ever imagined, and they aren't the only ones hunting him. The original creators of the virus have dispatched Electra to deal with Vincent and take out anyone who may stumble on the truth behind him. As the hunt for the man with no past and no future continues to escalate, they begin to question what about the world is reality and what is a dream as the line between sanity and insanity becomes more apparent. (Read More)
| Subgenre: | martial artscult filmblack comedyconspiracypost moderncyberpunkspace opera |
| Themes: | militarymurderdeathrevengesurrealismkidnappingbetrayalescapeheroinvestigationdeceptionterrorismillnessamnesiahunting …near death experiencespace travel (See All) |
| Mood: | gorerainneo noiranime |
| Locations: | airplanewatertaxielevatorcityouter spacetaxi drivercampfirelaboratory |
| Characters: | policedoctortattoosoldierhostagetough guywarrioraction herosecurity guardex soldiermysterious villainself healing |
| Period: | future |
| Story: | computer crackertracking deviceparachutebutterflyindianproduct placementbridgedogbloodviolenceflashbackbare chested malegunfightcigarette smoking …explosionpartychasesurprise endingpistolshowershootoutdreamcorpsearcade gameblood splatterfistfightmachine gunshot in the chestshot in the headshotgunslow motion scenepunched in the facearrestgunfightbrawlfalling from heightshowdownheld at gunpointhand to hand combatbombhallucinationhandcuffsrevolvercombatscientistsubjective cameragood versus evilhalloweenfoot chaseflashlightterroristdisguisemontagearmystabbed to deathmixed martial artssubwayexploding caranti herodisarming someonedrawingspaceshipnews reportshot in the foreheadbased on tv seriesstabbed in the backcharacter's point of view camera shotmissionmistaken identityrace against timecover upevil mankicked in the facetough girlopening action scenehalloween costumeshot in the shouldergovernmentmercenaryshot in the armfireworksmoonstylized violencejazzmissilecaptainhand grenadecard gamegrenadewarehouseheroinemass murdersociopathhatdiseaseviruscowboy hatjail cellwalkie talkiehunterspacecraftswat teamjumping from heightvirtual realitytv showrailway stationparadeaction heroinemexican standoffcolonelgun fufemale warriorgas maskvisionbombingveteranpower outagepunched in the stomachconvenience storeshopping mallscene after end creditsexploding headjumping through a windowairplane crashwisecrack humorhologrambounty huntercapturepolice raidexistentialismterrorist plotgovernment agentpipe smokingsurprise after end creditsbullet timememory lossdesert eaglefemale soldiermadmanterrorist grouphackerfinal showdownex coprobberscene before opening creditsarmored cartowerlost lovestandoffmegalomaniacplane crashtomboysleepasthmacomputer hackercrash landingfighter jetexploding truckgenetic engineeringshamanplaying a video gameshot in the handexperiment gone wrongmicroscopeterrorist attackairfielddogfightcockney accentcriminal investigationbiplaneexploding airplaneneo westernkicking in a dooranti heroinemars the planetscience runs amokwiretappinginnocent person killedattempted robberyjack o'lanterntragic villainmegacorporationantidotecorporate crimedetonatorvasejeet kune doel trainhuman experimentationjumping off a bridgehuman in outer spacehot dog standvaccinevideo arcadecamaraderieex special forceshazmat suitpneumoniasneezingnanotechnologyhand through chestexploding planehands tied behind backelectromagnetic pulseabandoned shipbiohazardmarblespace westerndrive in theaterterrorist bombingcontagionconvenience store robberynoodlesknife in backpharmaceuticalsabandoned apartmentfatalismpirate broadcastingjumping onto a trainmonorailterraformingshockwavefoiled robberyretro futureterrorist cellfuturistic trainstate terrorismbioterrorismcrop dusterbio terrorismhuman test subject2070sdeadly virushalloween paradepathogendomed cityweather controlstarship name in titlehay fever (See All) |
Wealthy businessman Ross Webster ('Robert Vaughn (I)' (qv))discovers the hidden talents of Gus Gorman ('Richard Pryor' (qv)), a mischievous computer genius. Ross decides to abuse his talents, in a way to help Webster with his plans for economic control. When the man of steel interferes, something mu …st be done about Supes. When Gus' synthetic Kryptonite fails to kill Superman, it turns him in an evil incarnation of his former self. The tar-laced Kryptonite pits man against himself, setting up the Clark vs. Superman battle. (Read More)
| Subgenre: | superheroslapstick comedybuddy comedy |
| Themes: | artificial intelligencedrunkennessweddingsupernatural powerredemptionunemploymentblindness |
| Mood: | high school |
| Locations: | bartrainchurchhotelhelicoptersnowsmall townbustaxielevatorpolice caritalylakeshipoffice …rooftopcavegas stationfire truckcanyondrinking at bar (See All) |
| Characters: | mother son relationshipboybrother sister relationshippolice officerphotographerbullysecurity guardalcoholicvillainsecretarymayorship captain |
| Period: | 1980syear 1983 |
| Story: | computer crackerproduct placementbridgerobottwo word titledogcharacter name in titlesequelfightexplosionsurprise endingpistoltelephone callfirecar accident …punched in the facecomputerfalling from heightcar crashnumbered sequelpianobased on comic bookaxedisguiseambulancedinersubwaymapman with glasseschild in perilthird partcoffeepay phoneumbrellabankconvertiblecabintypewriterredheadsingle parentmissileanswering machineflyingballoonheavy rainscene during opening creditslifting someone into the airroman numeral in titlefraudphone boothpicniccelebrationdiamondexplosivefanfight to the deathpower outagemillionaireconvenience storeoilarizonaolympicsskiingblind manbowlingfieldtragic herodc comicsworld trade center manhattan new york cityweatherfirefighterrocketsatelliteaccountantdonkeynew jobwedding ceremonyjunkyardstock footagecafeteriascene before opening creditsgerman shepherdgolf clubacidmegalomaniacbank robbertornadocornfieldcomputer hackerexploding truckbowling alleystatue of liberty new york citycolombiamilitary uniformroller skatingrainbowhot air balloonalter egoembezzlementmimeroman numbered sequelkansasrescue from drowningolympic gamescoalnewspaper reporterchrysler building manhattan new york cityrevolving doorcheckearth viewed from spacenew york city new yorkchildhood sweetheartbingosubway traingrand canyonhuman aliensuper speedpenthousehot dog standlaser beamcoal minehigh school reunionfax machinephoto boothsuper computergolf ballyo yocoal minerflying mandiamond ringsame actor playing two charactersnews broadcastactor playing dual roleyelling for helppie in the faceweather manipulationsame actor playing two characters simultaneously on screenhot dog vendorhuman versus computerseeing eye dogacid burningold friends reunitedoil fieldoil tankertime magazinechemical plantflying superherox ray visioncharacter appears on magazine coverjersey the garmentcombine harvesternewspaper manreference to immanuel kantkryptoniteextraterrestrial humanboy in dangerdrinking shotsextraterrestrial manpenthouse apartmentautomobile junkyardpaychecknewspaper photographercomputer classfake drunkennessoil leaktableclothsmallvillemotor car crusheradapted scorefalling from the skyski slopechild's birthdaycomputer operatorfighting with oneselfleaning tower of pisanewspaper ownernewspaper staffolympic torchperry whitepisa italyrobot womanwelfare office (See All) |
A megalomaniac C.E.O. sends his son into the dangerous African Congo on a quest for a source of diamonds large enough and pure enough to function as powerful laser communications transmitters (or is it laser weapons?). When contact is lost with his son and the team, his sometime daughter- in-law is …sent after them. She is a former CIA operative and, accompanied by gee-whiz gadgetry and a few eccentric characters (including a mercenary, a researcher with a talking gorilla, and a a nutty Indiana-Jones-type looking for King Solomon's Mines), sets out to rescue her former fiance. What they all discover is that often what we most want turns out to be the source of our downfall. (Read More)
| Themes: | military |
| Locations: | airplaneairportafricacavejunglecampfire |
| Characters: | soldierprofessoramerican abroadbabe scientist |
| Period: | 1990s |
| Story: | reference to john wayneparachutelaseranimalbased on novelone word titletitle spoken by characterexplosionpistolcorpseshot to deathmachine gunshotguncamerapainting …interrogationscientistdecapitationsurvivalambushmountainarmysnakeexploding carsevered headno opening creditsritualcigar smokinglegendtentskeletonmercenaryak 47uzicaptaincountry name in titleheavy raintalking animallifting someone into the airhuntertemplesevered handskullrocket launcheranimal attackdiamondhit in the crotchlionairplane crashvolcanorainstormtribecorporationsign languagetorso cut in halfsatellitetranslatorreference to elvis presleyexpeditioneyegolf clubterritory name in titlegorillaflarelavaexplorerhouston texashot air balloonapeairfieldcoughing bloodguideflare gunanimal killingexploding airplanegiraffechantingskydivingcongogolf cartromanianstudio logo segues into filmvolcanic eruptionhippopotamustanzaniasafariloud shirtanimal human communicationjumping from an airplaneex cia agentsimian fictionswahilifortune hunterlost cityzoologylaser cutterwhite water raftingcentral africaancient templehuman versus animalelectronics expertthrown from an airplanecharacter says have a nice daytalking gorillareference to prometheusprimatologistrobot sentry (See All) |
Jerry (Ryan Reynolds) is that chipper guy clocking the nine-to-five at a bathtub factory, with the offbeat charm of anyone who could use a few friends. With the help of his court-appointed psychiatrist, he pursues his office crush (Gemma Arterton). However, the relationship takes a sudden, murderous … turn after she stands him up for a date. Guided by his evil talking cat and benevolent talking dog, Jerry must decide whether to keep striving for normalcy, or indulge in a much more sinister path. (Read More)
| Subgenre: | black comedydark comedy |
| Themes: | murdersuicidekidnappingdrunkennesspsychopathmental illnessevilchildhood trauma |
| Mood: | gore |
| Locations: | bathtubbarpolice carchinese restaurant |
| Characters: | father son relationshippolicemother son relationshipserial killerkillerpsychiatristemployer employee relationshipstepfather stepson relationshipsuicide by fire |
| Story: | butterflycatwatching tvdogbloodviolenceflashbackbare chested maleexplosionknifecryingtitle directed by femalecorpsebig breastscar accident …vomitingtearsrunningdead bodyhallucinationreference to jesus christcleavagestabbingthroat slittingstabbed to deathfishchild abusebrunettesevered headfactorydatecharacter says i love youdismembermentkillingblood spatterheavy raintherapistbarefoot malecrushdead womanbreakfastbossgas maskcamera shot of feetimaginationattempted suicideblood on facekaraokeco workerdelusionmedicationheavendeath of protagonistaccidental killingmusical numbersexy womantied feetmale in showerreference to elvis presleytaking a showerdisposing of a dead bodyhearing voicesbowling alleyfactory workermercy killingoffice workerbare feetelvis impersonatorknife murdercut into pieceswhite brawet clothesschizophreniclocked in a roomtalking dogfeet on tableassisted suicidemale vomitingforkliftfridgeheadtalking headbiblical referencecaught in the rainroadkilltalking catabusive stepfatherchildhood homeknife woundstuffed animal toysock puppetcar won't startchildhood flashbacktape over mouthbritish womandismembered bodymale bare feetmurder by stabbingson murders motherwoman directorknife in chesttraumatic childhoodelvis presley impersonatorstood upfist bumppsychopath as protagonistbloody knifekilling a deerreflection in mirrorscared womanshippingvomiting in a toiletparanoid schizophrenicmentally ill mothermoving a dead bodyconga lineson kills motherkiller as protagonisttalking to a corpsekissing a dogreturning to childhood homeblack humourcompulsive hoardingmental illness in family (See All) |
A young boy learns that he has extraordinary powers and is not of this Earth. As a young man, he journeys to discover where he came from and what he was sent here to do. But the hero in him must emerge if he is to save the world from annihilation and become the symbol of hope for all mankind.
| Subgenre: | martial artscoming of agesuperheroepicchrist allegory |
| Themes: | artificial intelligencemilitarymurderdeathrevengekidnappingtortureescapedeath of fathersupernatural powerhopeadoptionapocalypseself sacrificespace travel …alien abductiondestruction of planet (See All) |
| Locations: | truckbarrestaurantschoolchurchhotelhelicoptersnowcemeterysmall townairplanedesertfarmcanadaouter space …gas stationlaboratoryschool busschool teacherfishing boatspace battlespace shiphumvee (See All) |
| Characters: | husband wife relationshipfather son relationshipmother son relationshipsoldieralienpriesthostagetough guywarrioraction herobullywaitressprofessoremployer employee relationshipfisherman …engineeru.s. soldieralien superhero (See All) |
| Period: | 2010s |
| Story: | laserfirst partproduct placementbridgerobotdogviolencesequelinterviewflashbackbare chested malefightphotographexplosionknife …chasethree word titlesurprise endingpistolfirecell phoneshootoutbeatingshot to deathfistfightmachine gunshot in the chestshot in the headrescueslow motion scenepunched in the facebattlearrestgunfightbrawlfalling from heightbased on comicshowdownhand to hand combatcar crashinterrogationhandcuffscriminalcombatscientistreportergood versus evilnewspaperorphanjournalistbased on comic bookarmyimpalementstabbed to deathmixed martial artsdinerstabbed in the chestnonlinear timelineexploding carman with glassesno opening creditsone man armyassassinationchild in perilfictional warspaceshipunderwater scenecreaturenews reportone against manybinocularscharacter repeating someone else's dialoguecostumefbiperson on firecharacter's point of view camera shotrace against timetentkicked in the facetankskeletonbankfarmeramerican flaginjectionchildbirthexploding bodydeath of husbandlaptopneck breakinggeneralufobattlefieldmooncivil waricemissilewaitercaptainflyinghead butthelmetbarnfbi agentspacecraftexploding buildingkicked in the stomachvillainessplanetblockbusterjumping from heightskullend of the worldhitchhikerfalse identitycolonelcrushed to deathhitchhikinggas maskalien invasiondamsel in distressu.s. armyconstruction sitefight to the deathmercilessnesspower outage3 dimensionalchaosfalling to deathpunched in the chestjumping through a windowthrown through a windowassault riflehologramtitle at the endlonerlens flarefemale reportersecret identitydc comicsferrywilhelm screamexploding helicoptertelekinesisgatling gunlaser gunmedia coveragetelepathyimprisonmentsatelliteheroismfemale soldieryellingdrifterhiding in a closetassumed identitysuper strengthfake identityworld dominationbully comeuppancefarmhousemegalomaniacyoung version of characterno title at beginningtornadohelicopter crashcornfieldcrash landingfighter jetexploding truckfighter pilotgenetic engineeringreluctant heroadopted sonmercy killingcrashing through a windowman punching a womanspace warmale protagonistaltered version of studio logofinal battlecapetwo way mirroralien contactalien planetexploding shipkansasbutt slappolar bearspitting bloodcoup d'etatmind readingu.s. air forceexploding airplanefetuslifting person in airnewspaper reporterspacesuitwar criminalx rayed skeletonalien racefictional citybudweiserearth viewed from spacetruckerfemale journalistspace explorationcryogenicsdeoxyribonucleic acidinvestigative reportermoney falling through the airwoman punching a maninfantnewspaper editorbank vaultsuit of armorhuman alienhuman versus aliensuper speedblack holeinvulnerabilityorigin of herorestraintbritish actor playing american characterclothes lineair strikelifted by the throatsuperhumancollapsing buildinghumanoidexploding planedrink thrown into someone's facerebootwoman in laboroil rigcouncilhuman skullescape poduh 1 huey helicopteranti villainflying manfoster parentsupervillainoutpostsuper villainessfamily farmsurrogate familyadoptive fatherthrown through a wallfighting in the airancient astronautinside the mindamerican midwestexploding gasoline stationexploding planetnewspaper officeuh 60 blackhawk helicopteradoptive mothercostumed herohumanity in perilch 47 chinook helicopterdestroyed cityred capedc extended universepirate broadcastingalien civilizationreboot of seriescaped superherosaturn the planetterraformingflying superherox ray visionoil platformexploding traineditor in chiefre bootfalling objectimplosiontree swingpopulation controlextraterrestrial humanrocket launch33 year oldextraterrestrial manspace capsulestarship interioralien starshipfemale supervillainm1 abrams tankguided missilecodexblow outmetropolis the cityalien supervillaincatching someone who fallsectogenplane crashing into a buildingsikorsky sh 3 sea king helicopterartificial wombectogenesisoh 6 cayuse helicopterc 17 globemasterfairchild republic a 10 thunderbolt iiflying supervillainlockheed martin boeing f 22 raptorextraterrestrial womanfalling debris (See All) |
This film follows the 'life' and times of the lead character, an android who is purchased as a household robot programmed to perform menial tasks. Within a few days the Martin family realizes that they don't have an ordinary droid as Andrew begins to experience emotions and creative thought. In a st …ory that spans two centuries, Andrew learns the intricacies of humanity while trying to stop those who created him from destroying him. (Read More)
| Subgenre: | futuristic |
| Themes: | artificial intelligencefreedom |
| Locations: | road triproad movie |
| Period: | 2000s21st centuryyear 200523rd century22nd century |
| Story: | robot as pathosrobotbased on noveljourneybased on short storyactor playing multiple roleson the roaddestinyslaveryandroidhologrameuthanasiadual roledisembodied headcross country …liberty2040scross country trip2060sreference to methuselahwhittling (See All) |
Mitch Taylor is one of the youngest students ever accepted to a university known for its programs for geniuses. He partners up with his roommate, science club legend Chris Knight, on a project to develop a high-powered laser. Together with their hyperkinetic friends, they employ their intellects in …the pursuit of bigger blasts, practical jokes, and a deeper understanding of what real genius means. When they find out that their professor intends to turn their work over to the military for use as a weapon, they decide to get even. (Read More)
| Subgenre: | independent filmcult filmteen movieteen comedy |
| Themes: | militaryrevengebetrayal |
| Characters: | teenagerstudentteacher student relationshipprofessor |
| Story: | computer crackerlaserf ratedpartytitle directed by femalecollegesciencescientistweaponprankgeneralciaexperimenticeeccentric …researchmentorgeniusdormitorymajorpopcorntop secretexploding houseegou.s. air forcehawaiian shirtbeauticianairforceteleprompterpenis enlargerwhiz kidsmart kids (See All) |
Three pets (Chance, a young dog unfamiliar with the world; Shadow, an aging, wise dog; and Sassy, a snobby cat) are left behind when their family goes on vacation. Unsure of what happened, the animals set out on a quest to find their family. This journey across America is very dangerous and the anim …als risk never seeing their masters again. The group of pets travel across forested mountains and areas of wide-open countryside, while their family searches for them in the same areas. (Read More)
| Themes: | friendshipescapedysfunctional familywilderness |
| Mood: | affection |
| Locations: | farm |
| Characters: | family relationshipsboygirllittle girllittle boyhuman animal relationshipstepfather stepson relationshipdog actorcat actor |
| Story: | skunkfirst partcatdogbased on novelremakerescuemountainjourneyon the roadrabbitreunionchickenwaterfallbear …loyaltytalking animalinjuryquestanimal attackpresumed deadveterinariansarcasmfalling into watergrasscross countrydog moviepitturkey the birdgolden retrieveranimal sheltershrimplost in woodspet owner relationshipporcupinemountain lionsierra nevada mountainspet owner reunionboxer doglost pettriangle the musical instrumentanimal escapes pounduse of phrase bad hair day (See All) |
An apparent murder-suicide in a hospital emergency room leads to an investigation by the on-call doctor, which reveals a plot by an insane toymaker to kill as many people as possible during Halloween through an ancient Celtic ritual involving a stolen boulder from Stonehenge and Halloween masks.
| Subgenre: | cult filmholiday horror |
| Themes: | suicidesupernatural powermurder of familymurder of father |
| Mood: | gorerainmurder suicide |
| Locations: | hospitalsmall towngas stationcar on fire |
| Characters: | doctorolder man younger woman relationshipdaughter |
| Period: | 1980s |
| Story: | tv commercialcommercialrobotcatsexfemale nuditynumber in titlebloodmale nuditysequelfemale frontal nuditymale rear nuditybare chested malenipplesexplosion …showerwritten by directormaskdecapitationhalloweencaliforniabreast sucklingexploding carsevered headhit by a carthird partfactorydeath of childsix word titledismembermentgothicwitchcraftphone boothhomicideandroidreverse footagesurveillance camerapsychotronicdead childmurder of a childeye gougingsequel to cult favoritepumpkinhuman sacrificemotel roomdisembodied headcrazinessroman numbered sequelpsychotronic filmhead ripped offno endingcamperkiller robotblond boycurfewpower drilllaser beamdisembodied handirishmandruidtelevision commercialbrief female frontal nudityprivate investigationstonehengeambient musicdrill in the headnorthern californiagrabbed by the throatfactory ownerhalloween maskcar crashing into a treefembottoy factoryoctoberfem botstand alone sequelblack teddychild killed by animaldriller killertowel slipfather disappoints childpumpkin head masksmashing a tv setstrapped to a chairadvertising jingledead child with eyes opendrilled to deathspider in moutheyeballssetting oneself on fireskeleton masktoy manufacturer (See All) |
Bound by a shared destiny, a bright, optimistic teen bursting with scientific curiosity and a former boy-genius inventor jaded by disillusionment embark on a danger-filled mission to unearth the secrets of an enigmatic place somewhere in time and space that exists in their collective memory as "Tomo …rrowland." (Read More)
| Subgenre: | martial artsdystopia |
| Themes: | artificial intelligencemurderdeathsurrealismbetrayalfearescapeinvestigationdeceptiontime travelredemptionfaithsurveillancehome invasionhope …apocalypseself sacrificenear death experiencespace travelunlikely heroutopia (See All) |
| Mood: | high school |
| Locations: | bathtubnew york citybeachrestaurantswimming poolforestmotorcycleparis francebusbicycleelevatorwoodspolice stationafricaouter space …laboratoryfire trucktwo in a bathtub (See All) |
| Characters: | father son relationshipfather daughter relationshipdoctorboybrother sister relationshipteenage girlgirlartistwarriorsecurity guardsingle fatherengineerself referentialself healing |
| Period: | 1960sfuture2010sseeing the future |
| Story: | robot as pathoslaserproduct placementrobotdogviolenceone word titleflashbackgunfightphotographtitle spoken by characterexplosionchasesurprise ending …firecell phoneshootoutbeatingcorpsefistfightcar accidentshot in the chestrescueslow motion scenepunched in the facecameraarrestgunfightbrawlfalling from heightshowdownhand to hand combatsunglassesbombcar crashinterrogationclassroomsciencekung fuscientistsubjective cameradecapitationsurvivalfoot chaseflashlightassassinambushambulancemontagemixed martial artsweaponmapnonlinear timelinesevered headno opening creditschild in perilhit by a cardouble crossspaceshippolice officer killednews reporton the runcharacter repeating someone else's dialoguebeaten to deathkaratewidowerperson on fireelectrocutionfactorypay phonefugitivecharacter's point of view camera shotrace against timeknocked outkicked in the facelong takebodyguardhigh school studentexploding bodymercenarysevered armarsonfreeze framemoonstylized violencesingle parentstrong female characterpickup truckdestinyfalling down stairssabotageflyingassassination attemptheroineheavy rainhelmettold in flashbackbarnsecurity camerawalkie talkiemad scientistagentexploding buildingkicked in the stomachwristwatchfloridarebeljumping from heightsevered handstrong female leadend of the worldfatecrushed to deathsocial commentaryandroidapplefemale warriorcyborgcamera shot of feetreverse footagefloodstealing a carexplosivecynicisminventorpower outagetitle appears in writingescape attemptswampexilepunched in the chestastronautbooby trapaerial shothologramtitle at the endalternate realitybody landing on a carrelease from prisongadgetjuvenile delinquentlasersightteleportationlaser gunfirefightersouthern accentnasarockettorso cut in halfhit with a baseball batclose up of eyestranslatorgiant robotbarbed wiretaserhigh school teachertimebombtractorwebsiteeiffel tower parissuper strengthportalinventiondronemachinesecret societyroller coastergramophonecornfieldpocket watchcrash landingworkshopspace shuttlereluctant herofall from heightbaseball capmacguffinsaving the worldchewing gumaltered version of studio logohumordesignerbadgehigh techhouston texasexploding housesubterraneancut into piecescamera phonefrenchmantsunamireclusenuclear explosionflashback within a flashbackalternate dimensionchosen oneforce fieldlifting person in airtrespassingbilingualismthrown from a carchild prodigyearth viewed from spaceglobefalling through the floormultiple time frameskiller robotworld's fairgadgetrymushroom cloudsuper speedhidden roomsecret passagewayhidden doortoy storevideo recordingorbthrown through a windshieldescape podanti villainstopwatchsubliminal messagebomb squadelectromagnetic pulsealternate worldjet packchild driving a cartime freezerobot as menacereference to thomas edisonrobot versus robotfree fallhole in chestpinwheat fieldboy geniusscience fairoptimistabandoned cityreference to nikola teslafuturistic cityteenage heroinefighting the systemlaser cuttermagnetismmonorailreference to the titanicfuture shockreference to george orwellchild geniusself destruct mechanismfuturistic trainreference to jules vernefuturistic carhotwiringwet pantslock pickingsecret placenew york world's fair 1964 1965wire cuttersbased on theme park attractiontachyonaltering the futurereference to gustave eiffel (See All) |
A scientific experiment unknowingly brings extraterrestrial life forms to the Earth through a laser beam. First is the cigar smoking drake Howard from the duck's planet. A few kids try to keep him from the greedy scientists and help him back to his planet. But then a much less friendly being arrives … through the beam... (Read More)
| Subgenre: | martial artscult filmsuperherob moviestop motionfish out of water |
| Themes: | monsterseductionapocalypseunlikely herounlikely friendship |
| Mood: | rain |
| Locations: | bathtubapartmentouter spacecar explosion |
| Characters: | singeralienmusicianlustvillainevil alien |
| Period: | 1980s |
| Story: | laserlifecharacter name in titlepantiesfistfightcondomrock musicguitarscientistbased on comic bookconcertdinerrock bandwhite pantiesexploding car …birdmini skirtpay phonepossessionautomobileflirtingbeer drinkingtalking animalplanetanthropomorphismalien invasionjanitoranthropomorphic animalmarvel comicshot tubalternate realityred pantiesduckwilhelm screamteleportationanimal name in titleinterrupted sexpink pantiesmini dressportalworld dominationquitting a jobsaving the worldbestialitysushicleveland ohioalien creaturemusical performancephysicistnight clubnuclear power plantgirl bandinterspecies sexminiskirtmisanthropealien possessionlovecraftianglam rocknubile womanrock clubwoman wearing a miniskirtinterspecies romancefemale drummergirl wearing pantiesparallel dimensionworst picture razzie winnerindiana jones spoofcartoon on televisionfemale guitaristanthropomorphic duckwoman wearing pantiesfemale rock singerfemale bandmicroskirtfemale bassistcrooked manager (See All) |
Sam Brenner, Will Cooper, Ludlow Lamonsoff, and Eddie "The Fire Blaster" Plant all played classic arcade video games as teenagers. But now they have to use their skills to try to save the world from aliens. The aliens watched video feeds that they thought was a declaration of war. So they send down …the classic arcade games to destroy earth. They also get help from a military specialist. They have three lives and if all three get used then earth will be destroyed, and every time they lose a live the aliens take someone's life. Who will win, us or the aliens? It's an all-out battle to save our planet and everyone on it. (Read More)
| Themes: | militaryfriendshipsurrealismkidnappingprisondrunkennessescapeherodeceptionredemptionrivalryapocalypsecourageunlikely heroalien abduction |
| Mood: | satire |
| Locations: | new york citybarcarhelicoptermotorcyclesmall townlondon englandbicycleapartmentindialaboratoryschool busfire truckhelicopter accident |
| Characters: | husband wife relationshippolicemother son relationshipsoldierpolice officeralienhostagesingle motherjapaneseamerican abroadbabe scientistamerican in the uk |
| Period: | 1980s2010syear 1982year 2015 |
| Story: | computer crackerlifeproduct placementrobotone word titleflashbackkissdancingtitle spoken by characterexplosionpartychasesurprise endingpistolfire …cell phonearcade gamecar accidentrescueslow motion scenebattleswordshowdownbeersunglassescar crashhandcuffscombatscientistgood versus evilsurvivalambushambulancewomanmontageprisonerexploding carman with glasseschild in perilfictional warspaceshipnews reportmarriage proposaltransformationtrainingflash forwarddangerprologueprotestattackmissionrace against timebaseball batu.s. presidentstalkingcontestexploding bodyex convictgeneralpubufobattlefieldwashington d.c.single parentdisasternerddestructionrevelationfarcescene during opening creditsspacecraftsergeantvideotapepress conferencejumping from heightparking garagetournamentend of the worldwhite housecolonelandroidrampagealien invasiondwarfcameoprison guardtarget practicebraveryu.s. armymisunderstandingdual wieldinventorchaosevacuationspecial forcesnintendotitle at the endrelease from prisontrophygeekexploding helicopterriding a bicyclechloroformchallengemedia coveragefirefighternasamale virginclose up of eyesprime ministersatellitetext messagingfemale soldierpervertkatanahiding in a closetreading aloudyoung version of characterlosercomputer hackerfighter jetmilitary basereluctant herobritish armyplaying a video gamebased on short filmkicked in the headu.s. navyfirst ladypart computer animationalien contactreference to star warscamera phonehit with a hammeradmiralu.s. air forceballroomchrysler building manhattan new york cityalien racethrown from a carregenerationreference to madonnanypdrunning for your lifeconspiracy theoristvideo arcadejumping from a carray gundisobeying orderscubewashington monumentcranewashington dcnew york city skylinesubliminal messagedonkey konghdtvtaj mahalcar stuntpac manair force basenavy sea air and land forcevideo gamerwoman wearing a red dresslieutenant colonelreference to martha stewartalien attackcentipedeman wearing a tuxedotetrischeaterhumanity in perildisintegrationreflection in eyedriving in reversereference to jfk assassinationsmurfreference to pinocchiotime capsuledivorced womancelebrity cameoflip bookinanimate object comes to lifedwarfismu.s. secret servicedisaster in new yorkshort manvideo game culturelemonade standearth in perilkiss on both cheekshyde park londonmen huggingejected from a moving vehiclehigh definition televisionbig screen televisiondodge the carlockheed martin boeing f 22 raptorq*bertsmart car automobilechallenged to a fight (See All) |
An adaptation of J. M. Barrie's story about a boy who never grew up. The three children of the Darling family receive a visit from Peter Pan, who takes them to Never Land, where an ongoing war between Peter's gang of rag-tag runaways and the evil Pirate Captain Hook is taking place.
| Subgenre: | coming of age2d animationdisneyswashbuckler |
| Themes: | friendshipsurrealismkidnappingjealousyheromagicangerchildhoodmythology |
| Locations: | boatlondon englandseaenglandcavejunglecity of children |
| Characters: | family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrenbrother brother relationshipboybrother sister relationshipgirllittle girlnative americanlittle boymermaid |
| Period: | 1900s |
| Story: | skunkraccooncloudfirst partdogcharacter name in titlebased on novelfighttitle spoken by characterbased on playdreamrescueswordbedisland …good versus evilorphansword fightmapjourneycigar smokingprincessduelattempted murderumbrellarabbitwaterfallbearmonkeypiratecaptainflyingwoundlifting someone into the airblockbusterimpersonationteddy bearclockexplosivefairychild protagonistshadowpipe smokingnannymotherhoodtimebombfoxnarratordual rolecrocodilehideoutboy with glassesseagullfantasy worldfriends who live togetheraltered version of studio logoskyoutlaw gangracial stereotypehookpirate shiprhinocerosbig ben londonhippopotamusrotoscopingchiefhook for handanimal costumecannonballpirate captainthermometertinker bellswallowed wholecaptain hookflying boysecret hideoutwalking the plankgang that lives togethermagical worldmaturationhook for a handgoofy hollerhair covering breastsnever neverlandseashell bikinimagical dustflying boatscene at a windowcrowingflying girldelayed gravity (See All) |
Pongo and Perdita have a litter of 15 puppies. Cruella De Vil takes a fancy to the pups, and wants to get hold of them, as well as more pups, to make herself a lovely dalmatian skin coat... Cruella hires some thugs to kidnap the pups and hold them at her mansion. Will Pongo and Perdita find them in …time ? (Read More)
| Subgenre: | 2d animationdisney |
| Themes: | revengesurrealismmarriagechristmaspregnancyfearweddingangerabductionfashionfalling in love |
| Mood: | car chase |
| Locations: | truckcarsnowlondon englandkitchenfarmenglandlakestorm |
| Characters: | family relationshipshusband wife relationshipmothermaidfatherpregnantpregnant wife |
| Period: | 1960s |
| Story: | cowlightningcatwatching tvdogbased on novelnumber in titlefightcigarette smokingexplosionchasetelephone callcryingsonghorse …rescuebattlebrawlpianogood versus evilnewspaperdisguisemansionwomancigar smokingparksmokingdisappearancechildbirthhenchmanfireplacetalking animalquestbarnstealingcrying womanvillainessblockbustercomposerbirthburglarpet dogthunderstormchristmas evelaughtersongwriterpuppylaughingpipe smokingnannygiving birthpetcar troublegerman shepherdcartoon dogbottletelling someone to shut upblizzardpipefemale villainponddesignerevil womanslappingfur coattelevision setpentalking dogdog movieslapensembleexpectant mothercheckgoosefurreference to ludwig van beethovensnowstormcoatcar wreckexpectant fathermatchmakingbig ben londoncigarette holderfrozen lakeinkleashstovetalking catmockerycastle thundergreat danerich womananimal protagonistmoving vandalmatianred eyesbad temperbarkingbloodhoundtalking horseimpatiencecheck booklabradordognappinganimal matingsheepdogpomeranian doglittercollie doganimal trackautomobile chasepregnant animalhenchmenbarkspiraling eyesspotsoottalking pet (See All) |
A remake of the television series, Matthew Broderick stars as Gadget, who suffers an accident at the beginning of the film, and befriends Brenda, a robotic surgeon who repairs Gadget so that he can defeat the villain Claw. In the meantime, Gadget and Brenda fall in love.
| Subgenre: | martial artscult filmsuperheroslapstickslapstick comedy |
| Themes: | murderkidnappingherosurveillance |
| Mood: | car chasebreaking the fourth wall |
| Locations: | hospitalhelicopterwonder car |
| Characters: | policegirltough guysecurity guardvillainuncle niece relationshipbabe scientist |
| Story: | parachuteproduct placementbridgerobotdogcharacter name in titleviolencedancingtitle spoken by characterexplosionpartychasemachine gunremakerescue …camerashootingshowdowncar crashscientistgood versus evilfoot chaseexploding carcigar smokingtrainingduellimousinebased on tv seriesfantasy sequenceactor playing multiple rolesstatueevil mantough girlscene during end creditsconvertibleblindfoldlove interestnewspaper headlinenerdspiderblockbusterjumping from heightback from the deadandroiddamsel in distressinventorsuper villaintitle appears in writingbutlerjumping through a windowgadgetpolice inspectorflamethrowerlaser gunrocketactress playing multiple rolescartoon on tvjunkyardworld dominationamputeefilm camerabased on cartoonmegaphonedisembodied headclawcrime fighterinspectorballroomfedoraphysical comedygadget carmicrochipcomic herocomic violencebowling ballaudio flashbackmanic laughterlarge format cameratoothpasteevil businessmandodge vipertalking carsmart carrobocopgirl dog relationshipigorprison escapeebumbling heroanimal licking someone (See All) |
At 17 Mike O'Donnell is on top of the world: he's the star of his high school basketball team, is a shoo-in for a college scholarship, and is dating his soul-mate, Scarlet. But at what's supposed to be his big game where a college scout is checking him out, Scarlet reveals that she's pregnant. Mike …decides to leave the game and asks Scarlet to marry him, which she does. During their marriage, Mike can only whine about the life he lost because he married her, so she throws him out. When he also loses his job, he returns to the only place he's happy at, his old high school. While looking at his high school photo, a janitor asks him if he wishes he could be 17 again and he says yes. One night while driving he sees the janitor on a bridge ready to jump, and goes after him. When he returns to his friend Ned's house, where he has been staying, he sees that he is 17 again. He decides to take this opportunity to get the life he lost. (Read More)
| Subgenre: | coming of ageteen movie |
| Themes: | pregnancymagicangerdivorceregret |
| Mood: | high schoolstar wars spoof scene |
| Locations: | schoollos angeles californiaschool partywater boy |
| Characters: | husband wife relationshipfather son relationshipfather daughter relationshipfriendboyfriend girlfriend relationshipteenage boybest friendbully |
| Period: | 1980s2000syear 1989 |
| Story: | falling off a bridgelifebridgetwo word titlenumber in titlebare chested malekissfightpartyerectionshowerdigit in titleface slapcondomsword …falling from heightlettersword fightbasketballjudgeno opening creditsfired from the jobperson on firehigh school studentcheerleaderfreeze framechesscoachteen angstathletejanitormillionairewishgeekseparationteenage pregnancycafeteriafirst date17 year oldcheering crowdschool principalsex educationprincipalbowling alleyxbox 360unplanned pregnancylightsaberreference to star warsbasketball playerreference to batmanbody swapunwed pregnancycanteenhigh school seniorerectile dysfunctionbody switchingabstinencemarriage crisispretendingreference to lord of the ringswhat ifmistaken for gaybasketball coachincestuous overtonesbody transformationwild partyice cream parlorplaystation portableadult as childcheerleading squadstar athletebig gamedo overlandscaperdivorce courtreference to vanilla icecivil court20 years later (See All) |
Jenny Hayden never did get over the death of her husband. So when an alien life form decides to model "himself" on the husband, Jenny is understandably confused if not terrified. The alien, or Starman, as he is called, has a deadline to meet, and kidnaps Jenny in order to meet it.
| Subgenre: | cult filmblack comedysuspensefish out of waterchrist allegory |
| Themes: | militaryrevengesurrealismfearescapedeceptionsupernatural powergriefhome invasiondying |
| Mood: | car chasetearjerkerbittersweet |
| Locations: | trainforesthelicoptersmall townbusdesertwoodspolice carroad tripmotelouter spacegas stationroad movielaboratorysinging in a car …forest fire (See All) |
| Characters: | policesoldierpolice officeralienbabynative americanwaitresssheriffpolice chase |
| Period: | 1980s |
| Story: | lifelightningproduct placementwatching tvmale nudityviolenceone word titlemale rear nuditybare chested malesex scenekissfightcigarette smokingphotographexplosion …chasesurprise endingpistolfirebeatingcorpsefistfightmachine guncar accidenturinationshotgunrescuepunched in the facebrawlbare buttrifleheld at gunpointrunningcar crashscientistshot in the backsubjective cameraarmywidowdinerpoliticianmapwhite pantiesdrivingnews reportcigar smokingon the runpay phonefugitivecharacter's point of view camera shotrace against timelong takegenerallas vegas nevadaobscene finger gesturekissing while having sexcult directorufowashington d.c.pickup truckmissilefireplaceelectronic music scoreheavy raincookhunterspacecraftsergeantimpersonationhome moviewhite housesocial commentaryback from the deadhitchhikingrednecktarget practiceu.s. armyresurrectionmiracletvsenatorpunched in the chestarizonarainstormdeerphoto albumsouthern accentdead animalwalletmajorrestroomtrailer homeflaskmessagecrash landingfighter jetexploding truckinfertilityroadblockslot machinealien contactcar radiotragic endingflying saucerwisconsinbilingualismtruckervinylwrenchdeoxyribonucleic acidcigardecoytruck stophuman alienmale full back nudityorbstate troopermarblecratersex with alienindian reservationdumb policeapple pieamerican midwestshape shiftingshape shifting alienfirst contactsaturn the planetseticherry piehealing giftnoradamerican musclegas bombriding a freight trainvoyager golden record (See All) |
All looks lost for the Rebellion against the Empire as they learn of the existence of a new super weapon, the Death Star. Once a possible weakness in its construction is uncovered, the Rebel Alliance must set out on a desperate mission to steal the plans for the Death Star. The future of the entire …galaxy now rests upon its success. (Read More)
| Subgenre: | suspensetragedyepicspace operascience fantasy |
| Themes: | artificial intelligencemurderdeathfriendshiprevengekidnappingbetrayalpoliticsprisonfeartortureescapedeceptionangerdeath of father …brutalitysupernatural powerdeath of motherparanoiaredemptionexecutionhopedeath of wifepanicblindnesscourageself sacrificespace travelprison escape (See All) |
| Locations: | beachdesertelevatorfarmouter spacespacecavespace stationspace battlebattle station |
| Characters: | husband wife relationshipfather daughter relationshipmother daughter relationshipafrican americanfemale protagonistsoldieralienhostagetough guywarrioraction herolittle girlasiandirectorsniper …sniper rifleengineerrobot human relationship (See All) |
| Story: | sentient robotrobot as pathoscomputer crackerlaserlightningrobottwo word titlenumber in titleviolenceflashbackfighttitle spoken by characterexplosionchasepistol …fireshootoutcorpseshot to deathmachine gunshot in the chestshot in the headrescuebattleswordarrestgunfightbrawlfalling from heightheld at gunpointbombinterrogationcriminalcombatscientistshot in the backsubjective cameragood versus evilspysurvivalambushstrangulationmassacredisguisedeath of friendarmyimpalementstabbed to deathprisonerstabbed in the chesttied to a chairmapno opening creditsanti herochild in perilfictional wardouble crossspaceshipcreatureon the runflash forwardattempted murderone against manypilotbinocularscharacter repeating someone else's dialoguedangerstabbed in the backprologueelectrocutionattackcharacter's point of view camera shotmissionundercoverrace against timeevil manknocked outtough girlfarmerstreet shootoutshot in the shoulderexploding bodyloss of fathermercenaryex convictloss of mothershot in the armgeneralsecret agentsubtitled scenebattlefieldpowermoonstylized violencestrong female charactercivil wartraitorcaptainsabotagegrenadedestructionassassination attemptheavy rainsociopathhelmetlifting someone into the airspin offjail cellcaptiveloss of loved onetemplespacecraftsergeantexploding buildingloss of wifecaucasianplanetblockbusterrebeljumping from heightrebellionstrong female leadaction heroinemexican standoffsocial commentarybroken legpresumed deadfemale warriorgas maskcameohaunted by the pasttensionveteranbraverycrossbowresistancehatredfemale leadmercilessnesspower outageevacuationfalling to deathescape attemptsenatorhit on the headdeath of protagonistassault rifleaerial shothologramundercover agentcapturedark pastblind manbody countwar veteranbroken armwilhelm screamtelekinesismoral dilemmaprequellaser gunheroismshot through a windowswordsmanminingreturning character killed offbag over headbureaucracyfemale fighterfake identitytoweralarmworld dominationcomic reliefmegalomaniacplane crashyoung version of characterbunkergovernorstar warsfemale spybearded manmessagecrystalfilm starts with textcrash landingspace shuttlefighter pilotbehind enemy linesdamman kills a womanoffscreen killingspace warlightsaberdisembodied headguardianfight the systemfinal battlecapeempirefamous scoreopen endedtragic pasttragic endingexploding shipfemale criminalstarshipdistrustfemale prisonerfiring squadjailbreakadmiraldogfightarchivecockney accentmind readingpsychotronic filmbo staffresistance fighterforce fieldlifting person in airanti heroinegogglesknocked out with a gun buttinnocent person killedalien creatureextreme close uptotalitarianismepic battlescottish accenthumanlong haired malecapmushroom cloudsagasuit of armorstabbed in the footdeath of parentescaped prisonerfemale pilotmessengertransportair strikedark heroinecollapsing buildingprosthetic limbdefectorcollisiondisobeying ordersmass destructioncouncilthe forceblueprintescape podsuicide missioninsubordinationoutpostweapon of mass destructionspace westernbazaarmining townfictional planetcargo shipsecret weaponlock pickgalactic warjedidroidnight vision binocularsagainst the oddsstrong female protagonistdeath sceneexploding planetexploding tankextremistrebel leaderinformation leaksecret baseroninstormtrooperspaceship crashdestroyed citystorm trooperman with a ponytailsuper weaponwarp speedblasterdeath starwmdleather gloveshyperspacesecret messagealien languageprequel and sequelsecret planstarfightercommunicationsintelligence officeralien intelligencebad guys wingunshiptragic heroinefemale convictinbetwequelevil empireaerial battleblack maskdarth vaderextremist groupheroine diesmale captainopening creditsswitchboardcontrol towerenergy shieldfather killedhuman maleschematichuman femalemale pilotspace pilottie fighterastromech droidhandheld communicatorsith lordspaceship name in titlefemale senatorplanet viewed from outer spaceshuttleultimate weaponx wing starfighterprotocol droidrebel basestar destroyerstardustat at walkerdeep voicedestroyed planetrebel starshipshuttlecraftspacecraft cockpitstarfighter pilotstolen planstransport starshipwarrior monkblaster pistoldefectdroid human relationshipforce chokegr 75 medium transportimperial shuttleimperial star destroyerimperial starshipimperial stormtrooperrebel soldierred blade lightsaberrogue oneshared universestarfighter cockpit (See All) |
Fashion designer Anita and computer-game writer Roger meet, fall in love and marry along with their dalmatians Perdita and Pongo. But the proud dogs' puppies are kidnapped by Anita's boss Cruella De Vil, who is stealing young dalmatians to make the coat she has set her heart on. Enlisting the help o …f the British animal kingdom, Pongo and Perdita set out to find and rescue all ninety-nine pups from their fearsome captors, Jasper and Horace. (Read More)
| Subgenre: | slapstick comedydisney |
| Themes: | surrealismmarriagepregnancyweddingfashionfalling in love |
| Locations: | london englandfarm |
| Characters: | employer employee relationshippregnant womanpregnantpregnant wifedog actor |
| Period: | 1990s |
| Story: | skunkraccoonfirst partanimaldogbased on novelnumber in titletitle spoken by characterchasehorseremakerescuearrestwomanpark …rabbitchildbirthpigfaintingvillainessblockbusterbirthmuteinsultpuppynannycrowgiving birthpetcar troublefalling into waterdesignerevil womancar set on firecyclingdog movieensembleexpectant motherbulldogcoatexpectant fatherbig ben londoncigarette holdervillainess played by lead actressfalling through icerich womanlocked in a closetdalmatianacorncruel bosswoodpeckerlive action remakedognappinganimal matingbased on adaptationlitteranimal trackelectrical shockpregnant animalanimal urinationvideo game designer (See All) |
Bato is a living cyborg. His whole body, even his arms and legs, are entirely man-made. What only remains are traces of his brain and the memories of a woman. In an era when the boundary between humans and machines has become infinitely vague, Humans have forgotten that they are humans. This is the …debauchery of the lonesome ghost of a man, who nevertheless seeks to retain humanity. Innocence... Is what life is. (Read More)
| Subgenre: | cult filmdystopiacyberpunkadult animation |
| Themes: | artificial intelligenceinvestigationparanoiaphilosophy |
| Mood: | anime |
| Locations: | japancity |
| Characters: | detective |
| Period: | future |
| Story: | robot as pathosliferobotdogviolenceone word titlesequelgunfightshootoutcomputerbased on comicsecond parthallucinationbased on comic book …prologuebased on mangadollparadeandroidcyborgpartnerconvenience storebible quoteyakuzahackerrepeated scenemetamorphosiscrime fighterreference to charles darwinbattleshipmultiple english dubscyberspaceanti terrorismquotereference to john miltonsynthetic human (See All) |
Jackie Chan, a top secret militant soldier, crashes into the South African jungle after his mission of kidnapping three scientists (who were experimenting with a powerful mineral) has gone awry. Waking up in a village of local natives, Chan has no memory of who he is, thus being addressed as "Who Am … I". His journey with aid from two female sidekicks to find out his identity leads him all the way to Rotterdam where he coincidentally discovers the location of the organization that kidnapped the three scientists. With no memory, Chan is thirsty for answers by any means necessary. (Read More)
| Subgenre: | independent filmmartial artscult filmblack comedysuspenseconspiracyabsurdismfish out of waterspy spoof |
| Themes: | militarymurderdeathkidnappingbetrayaltortureescapegangsterherodeceptionparanoiasurveillancegreedpanicamnesia …police brutalityunlikely hero (See All) |
| Mood: | car chasejames bond spoof |
| Locations: | hospitalhotelhelicoptermotorcycleairplanedeserttaxivillagepolice stationafricarooftopcavejunglelaboratoryrooftop fight |
| Characters: | policedoctornursedetectivehostagetough guywarrioraction herohitmanjapanesepolice detectivepolice chase |
| Period: | 1990s |
| Story: | tracking deviceparachutelaserproduct placementbridgedogcharacter name in titleviolenceflashbackbare chested malefighttitle spoken by characterexplosionknifechase …surprise endingpistolcell phoneshootoutbeatingcorpsefistfightmachine guncar accidentrescueslow motion scenepunched in the facecamerabattlearrestgunfightbrawlfalling from heightheld at gunpointhand to hand combatcar crashinterrogationcafehandcuffsfightingcriminalcombatkung fuscientistreporterspyfoot chaseflashlightassassinambushmixed martial artsinternetmapsnakeexploding cardisarming someoneone man armyhit by a cardouble crosscigar smokingon the runone against manybinocularsbeaten to deathdangerprologuekaratescreamingpay phonewritten and directed by cast memberfugitivemissionundercovercover upknocked outkicked in the facetough girlopening action sceneskeletondirected by starbodyguardmartial artistlaptopdie hard scenariomercenarysemiautomatic pistolgeneralsecret agentsilencerespionagecianewspaper headlinesubtitled scenebattlefieldstylized violencehenchmaneavesdroppinganswering machinesabotagemartial arts masterhead buttspearassassination attemptelectronic music scorescene during opening creditssurvivorwalkie talkieagentkicked in the stomachjumping from heightsouth africaparking garagefestivalburialearthquakethugface paintsufferingpower outageblack and white scenespecial forcespunched in the chestaerial shotcommandoundercover agenttribegadgetwritten by starberettamemory losscia agentminingbloopers during creditsbag over headcar raceparkourarms dealerrace carskyscraperfemale spycommando unithired killerhelicopter crashcommando missionreluctant herobusiness cardmacguffinpalm treetop secrethigh techcamouflageoverturning carrogue agentsole survivorshot through a doorsnake bitewanted posterman with no namewu shugiraffewiretappingloss of memorycoconutgadgetrymeteoritegolf cartcompact discblack opscentral intelligence agencyoutrunning explosionsouth africancar stuntnative tribeair ventkicked in the buttnight vision binocularsjohannesburg south africaboardroomdrawbridgecode breakingmoney transferjumping from a helicopterrotterdam netherlandsamnesiacmineralpower stationrace car drivertribal dancegarbage chuterubber boatwalking on a ledgelost memorycorrupt agentsucking bloodtribal leaderenergy source (See All) |
© 2023 FilmTagger.com
·
New Movies
·
About
·
RSS
·
Conditions
·
Privacy
FilmTagger.com