Please wait - finding best movies...
A widowed child psychologist lives in an isolated existence in rural New England. When caught in a deadly winter storm, she must find a way to rescue a young boy before he disappears forever.
Subgenre: | psychological thriller |
Themes: | missing childadoptionmental illnessinsanityguiltobsessionangerescapejealousydrugsmurder |
Mood: | one nightnightnightmare |
Locations: | winter stormboy in a wheelchairrural settingstormlakewheelchairbathtubforest |
Characters: | stepmother stepson relationshiplittle boysingle fatherkillersingle motherteenage boyboydoctorfather son relationshipteenager |
Period: | winter |
Story: | young boydeaf boysinging a lullabydeaf childcar alarmhand over mouthdeaf mutecold weatherhome officefemale psychologistchild psychologistclaw hammerkilled with a hammerhome videohit with a hammer β¦teenage murdererhiding in a closetice stormtaking a bathcountry housewoman in a bathtubmissing boydream sequencedangling feet in water6 months latercreepy childfacial scratchtied up womancar truck crashreading the bibletied up nakedholding head underwaterediting roomtwist of fatestrongcatatonic statefollow upattempted drowningtelling a storyvideo callstepsonangry kidpantryfake illnessfootstepscrawlspacemoonlightneglected childtape over mouthoarduct tape gagjump scarefemale star appears nudestabbed in the bellyoedipus complexover the topcatatoniaseclusionfrying panlullabystartledruralpower failureskypecaregiveryoungpillow fightred herringcandlelightfather son conflictcaptivitypsychotronic filmhatchetraccoonhandicappedbreaking a windowhanddruggedpatricidefalling into water18 year oldwhisperingraftadvicealarmdockparalysisdeaflaptop computerweatherlanternbroken glassdelusiondamsel in distresspillswoman in jeopardytensionhomepsychologisttherapisthammerhidingpatientsingle parenttied upmurdererbasementisolationdisappearancemissing personscreamscreamingpoint of viewbathfishinghousesuicide attemptstabbed to deathwidowaxebound and gaggedcandlecar crashvomitingbare buttwatching tvrescueshotgunblondecar accidentcorpsedreamcryingknifefemale frontal nudityfemale rear nudityfemale nudityone word titletwo word titlenudityviolence (See All) |
An inksetter in New York, Quoyle returns to his family's longtime home, a small fishing town in Newfoundland, with his young daughter, after a traumatizing experience with her mother, Petal, who sold her to an illegal adoption agency. Though Quoyle has had little success thus far in life, his shippi β¦ng news column in the newspaper "The Gammy Bird" finds an audience, and his experiences in the town change his life. Then he meets the widow Wavey... (Read More)
Subgenre: | tragedy |
Themes: | adoptionangerdeathkidnappingmarriageinfidelityrapeadulterypregnancydrunkennessinvestigationmagicincestmemorypoverty β¦redemption (See All) |
Mood: | nightmarerain |
Locations: | rural settingstormlakehospitalbarsnowsmall townboatnightclubvillagewoodsshipcanadaoceancampfire β¦boat accident (See All) |
Characters: | little boysingle fathersingle motherfather son relationshiphusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrendetectivemusicianphotographerbabywriterlittle girl β¦employer employee relationshipfishermanaunt nephew relationship (See All) |
Period: | winter |
Story: | youngweatherhomesingle parentisolationscreamfishinghousewidowcandlecar crashvomitingrescuecar accidentcorpse β¦dreamcryingbased on novelflashbacksex scenekissphotographpartythree word titlepantieswoman on topcomputercamerathongtearsislandrivertelevisiontelephonereporterdecapitationsurvivalnewspaperbraambulancebridgedinermapaccidentfishdinnerdrivingsevered headritualsearchvoice overgraveyardbartendercursewidowerfactorydolllightningunderwaterreference to william shakespearetypewriternewspaper headlinechainsawiceropetraditionpirateteawoundreference to adolf hitlerbabysitterbuttockstimeirishjournalismcompassionback from the deadwatching televisionremote controlhaunted by the pastlandscapethunderplaygroundjob interviewsuperstitionice skatingice hockeyseasidecasual sexmarital problemferrysymbolismadulterous wifeauntbandageparenthoodmetaphoraccordionmental retardationoutsidersweatnewspaper articlekiteleukemiahearsebody bagfeverashesrainingsewing machinewakestorygravestonecarpenterriteurnmortalitycustomnewspaper editorcar wreckatlantic oceanmoosestarting overvisionscadaverpulitzer prize sourceancestordesertioncableouthousepaper airplaneprinterwirepatternpiracyincest rapenewfoundland canadanewspaper officehockey gamedeath in familyice skatescovenursery schoolnotesabusive wifecapsizeibmcairnreference to robert burns (See All) |
Barbra and Johnny visit their father's grave in a remote cemetery when they are suddenly set upon by zombies. Barbra manages to get away and takes refuge in what seems to be an abandoned farm house. She is soon joined by Ben who stopped at the house in need of gas. Beset by the walking dead all arou β¦nd them Ben does his best to secure the doors and windows. The news reports are grim however with creatures returning to life everywhere. Barbra and Ben are surprised when they realize there are 5 people hiding out in the basement: Harry, Helen and Judy Cooper; and a young couple, Tom and Judy. Dissensions sets in almost immediately with Harry Cooper wanting to be in charge. As their situation deteriorates, their chances of surviving the night lessen minute by minute. (Read More)
Subgenre: | independent filmcult filmsuspensetragedycreature featureallegorysurvival horrorzombie apocalypseamerican horrorzombie survivalindependent horrorzombie outbreak |
Themes: | escapemurderdeathrevengemarriagefearmilitarybrutalityparanoiapanicapocalypsecannibalismcourageself sacrificepolice brutality β¦near death experienceradiation (See All) |
Mood: | one nightnightgoredarkness |
Locations: | rural settingforestcarhelicoptercemeterywoodskitchenfarmtruckpennsylvania |
Characters: | doctorhusband wife relationshippolicefather daughter relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshipbrother sister relationshipzombieprofessorsheriffterrorpolice dog |
Period: | 1960syear 1968year 1967 |
Story: | youngpsychotronic filmhandpatricidebroken glasshidinghammerbasementisolationscreaminghousestabbed to deathaxebare buttwatching tv β¦rescueshotguncar accidentcorpseknifefemale frontal nudityfemale rear nudityfemale nudityviolencebloodbare breastsdoggunfightcigarette smokingexplosionchasesurprise endingpistolfiretopless female nudityhigh heelsbeatingshot to deathblood splatterfistfightfoodshot in the chestface slapshot in the headpunched in the facebrawlrifleheld at gunpointrunninglow budget filmrevolvertelevisionscientistshot in the backsurvivalfoot chasemassacrestabbingwomanbridgearmystabbed in the chestexploding carman with glassescultradiocontroversycreaturegraveyardpantyhosenews reporttransformationshot in the foreheadlimousinegravetreebeaten to deathdangerperson on fireattackfirst of seriesactor playing multiple rolesrace against timeknocked outscene during end creditsshot in the shoulderdeath of brotheramerican flagtragic eventexploding bodydie hard scenariofirst partdirectorial debutsevered armgeneralhandgunvigilantecult directorundeadwashington d.c.pickup truckdisastertv newsfalling down stairsfireplaceburned aliveelectronic music scoregothicmutantdiseasevirusbarnloss of loved oneimpersonationsevered handgrindhouseskulltorchend of the worldwhite housesocial commentaryback from the deadeaten alivecamera shot of feetseriescameobraverycannibalmercilessnesspower outagechaosresurrectioninsectpsychotronicescape attemptscene after end creditsinfectionone daysiegegasolinemutationcellarbonfireburned to deathloss of brothermoral dilemmashot multiple timessurprise after end creditsmedia coveragenasafemale stockinged feetsatellitenews reporterintestinesliving deadmolotov cocktailcremationgerman shepherdblack manpolice chiefabandoned houseplaguefarmhousebroken windowtv reportercameramansicknessfoot closeuphillbillyquarreloffscreen killingfriends who live togethershocksole black character dies clichecowardcar set on firedirector also cinematographermeteorflesh eating zombiepart of a serieswalking deadtv interviewtragic endingmatricidesick childwoman slaps manradio newswoman slaps a manimprovised weaponfade to blackfamous lineghoulgrindhouse filmheart in handsocial decaybludgeoningwinchester rifleoutbreakzombie attackman slaps a womanpower strugglewrenchcontaminationno survivorsdoomsdaynewscasterrunning out of gassurprise during end creditsbarricadeblack glovesnailgutszombie childposseexposed breastabandoned carbitten on the armman punches a womanafrican american manhit with a rockmidnight movieexpertremadenational guardmultiple cameosdrive in classicporchtire ironanthropophagusmass deathrefugeends with deathjarentrailshorror movie remadezombificationhunting rifleheadshothell on earthlivermeat hooknon personbabehole in chestblack man white woman relationshipmutilated bodyreference to nasaspace probeamoralityhordenonpersonfire pokerzombie bitedeadly diseasehickkeroseneinjured childvenusexplanationhit with a tire ironhead shotnight of the living deadcontemporary settingemergency broadcast systemgas pumpburning bodyhysterical femalematchstickmutant creaturevenus the planetalsatianreference to boris karloffpersonality conflicttrowelgardening toolmindless eatingmass panicsearch and destroyrifle scope (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | suspensesupernaturalparanormalpsycho thriller |
Themes: | missing childmental illnessinsanityescapemurderdeathsuicidekidnappingmarriagerapeghostprisonfeartorturememory β¦psychopathsupernatural powerparanoiadrug usesurveillanceevilunrequited lovepanicdeath of daughterescape from prisonthe devilmurder of husbandrape and murder (See All) |
Mood: | nightnightmaregorerainneo noirslasherdarkness |
Locations: | bathtubhospitalswimming poolcartaxipolice stationpolice car |
Characters: | killerdoctorfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshiptattoofemale protagonistserial killernursepolicemanlawyerreference to god β¦security guardvillainpsychiatristsheriffterrorself mutilationdoctor patient relationshipstepfather stepdaughter relationshipslasher killerserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All) |
Story: | catatoniadelusionpillswoman in jeopardypatientmurdererscreamingsuicide attemptaxecar crashwatching tvshotguncar accidentcorpsedream β¦cryingknifefemale frontal nudityfemale nudityviolencesexf ratedbloodinterviewflashbackbare chested malegunkissfightphotographexplosionchasesurprise endingpistolshowertelephone callfirecell phoneblood splattermirrorcomputershootingrifletearsrunninghallucinationreportersubjective cameraswimmingsurvivalfoot chaseflashlightvideo camerawomanthroat slittingbridgeprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophoneperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandtrustkillingtherapypizzamaniacsyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellbuttocksdesperationpsychorape victimrapistmental institutionbarefootjanitorprison guardsurveillance camerathunderdeath threatmental hospitalco workermedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctoraxe murdernervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderpsycho killerdead girlmemory lossintimidationgothserial murderpsychopathic killervideo tapebad guymental patientmadmanelectricitykillmental breakdownblackouthomicidal maniacsatanismslashingblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutpsycho terrordead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogictwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All) |
Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing β¦ voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)
Subgenre: | suspense |
Themes: | angermurderdeathfriendshiprevengemarriageinfidelityghostadulteryfearvoyeurismextramarital affairsupernatural powerunfaithfulnesspanic |
Mood: | rain |
Locations: | rural settinglakebathtubrestaurantswimming poolsnowcemeteryboatlaboratoryyacht |
Characters: | father son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipfriendteenage girlteacherstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror |
Period: | 2000s |
Story: | power failureyoungdruggedadvicedocklaptop computerhometherapisthammermurderermissing personbathhousecandlewatching tv β¦car accidentcryingbloodinterviewdogphotographpartythree word titlesurprise endingshowertelephone callcell phonemirrorcomputercatsecrettearsbathroomcollegeneighborwinewomanunderwater sceneroommategraveyarddrowninggravebinocularskeyelectrocutionpossessioncollege studentdeath of husbandhauntingratsuspiciongardenhaunted housetherapyrunawaypickup truckoccultteafireplacegothicmouseblockbusterdrug overdoseresearchboston massachusettspet doganxietyspyingpieropening a doorphoto albumvillain played by lead actorseancefireballphysicianfencesailboatparamedicshoecelloouija boardgeneticshitchcockiansleeplessnesspet catpoltergeistcellistfootprintmissing girl911vermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All) |
When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β¦p her from constantly getting visions of Jessica's fate. (Read More)
Subgenre: | independent film |
Themes: | mental illnessjealousymurderdeathsuicideinfidelityghostadulteryinvestigationdeceptionincestextramarital affairdeath of fathersupernatural powerunfaithfulness β¦father daughter incest (See All) |
Mood: | nightmarerain |
Locations: | rural settingstormwheelchairbathtubschoolcemeterysmall townwaterwoodscourtroombackwoods |
Characters: | single motherboyfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshiptattoolawyerlustwitchsheriffsuicide by hanging |
Story: | woman in jeopardytensiontherapisttied upmissing personwidowcandlebare buttwatching tvcorpsedreamfemale frontal nudityfemale nuditytwo word titleviolence β¦f ratedbloodflashbackmasturbationmale rear nuditydogbare chested malegunfightdancingphotographexplosionpartyleg spreadingpantiestelephone callfirebeatingthongsecretliedead bodysex standing uphallucinationhandcuffscleavagestrangulationwomanwhite pantieschild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathergrandmotherwhippingcult directorpsychictherapygarageheart attackgirl in pantiespickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sexdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetredneckreverse footagebloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotgirl stripped down to pantiesrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All) |
Kate and John Coleman are rebuilding their troubled marriage after the loss of their baby. The couple decide to adopt a child. When they meet the nine-year-old Estonian girl, Esther, at the St. Marina Orphanage, they immediately fall in love with the well-educated orphan. Their young son, Daniel, is β¦ hostile to his new sister; but their deaf mute daughter, Max, is enchanted with her - at first. Eventually, Kate begins to feel that Esther is manipulative and possibly even psychologically disturbed. John refuses to listen to his wife's misgivings. Kate calls Sister Abigail at the orphanage, and the nun informs her that Esther has a troubled and mysterious history. Kate delves further into Esther's past and discovers she is not what she claims to be. (Read More)
Subgenre: | suspensepsycho thriller |
Themes: | adoptioninsanitymurderinfidelitypregnancydrunkennessseductionpsychopathdeath of fatherdepressionbullyingalcoholismdying |
Mood: | nightmare |
Locations: | wheelchairhospitalsnowsex in kitchensex in the kitchensex in a kitchenkitchen knife |
Characters: | killerfather daughter relationshipmother daughter relationshipbrother sister relationshipgirlserial killersister sister relationshipartistlittle girlpsychiatristbiblemother in law daughter in law relationshipself injurynew studentself inflicted injury |
Period: | winter |
Story: | deaf childdeaf mutekilled with a hammerclaw hammerhit with a hammerhiding in a closetdream sequenceyoungdeafmurdererscreamingstabbed to deathfemale frontal nudityfemale nudityone word title β¦bloodmale nuditybare breastssex scenetitle spoken by characterchasesurprise endingtelephone callblood splatterface slapfalling from heightpaintingpianoclassroomrevolversubjective cameragood versus evilorphanbasketballbridgestabbed in the chestnunno opening creditschild in perildrowningstabbed in the backcharacter's point of view camera shotrace against timekicked in the facediarymanipulationscardeath of husbandneck breakingshot in the armarsoneavesdroppingsociopathcaught having sexarchitectdysfunctional marriagepsychologycoitusorphanagedwarfrear entry sexchild's point of viewplaygroundfight to the deathpower outagemental hospitalaquariumblack brahit on the headsibling rivalrysafedeceitlooking at self in mirrorfamily dinnerbroken armpigeonsign languageplaying pianopsycho killerinterrupted sexporn magazinedrunken manfemale psychopathsplit personalitywetting pantsgreenhousequarrelunsubtitled foreign languagekicked in the headaltered version of studio logorussian roulettekiller childsole black character dies clichemurder attempttreehousehiding placelaboradopted daughtervillain not really dead clichebreaking a mirrorchild with gunhide and seekpaintballcat and mouseprecocious childescaped mental patientred wineevil childbedtime storychild swearingsnowstormtantrumtroubled marriagestabbed multiple timescaught in the actestoniaconnecticutfrozen lakegrievingtraffic lightchild's drawingwine bottlerecovering alcoholicchild murdereremotional abusegrand pianopiano teacherchild uses gunenglish subtitles in originalorphan girlfalling through icehearing aidgrocery shoppingchild murderessrussian accentarm castbludgeoned to deathunderwater fightribbonlip readingsterilitybroken anklebox cutterpaintball guncardiac arrestsmothered with a pillowinternet researchpushed from heightadoptive mother adopted daughter relationshipurinating in fearblack lightstarting a firewhite rosemother kills own childpersonality disordersedationadoptive father adopted daughter relationshipadult as childstillbirthdiversionhello kittytrickerybinding breastscatholic orphanagepolice tapeburning evidencedisturbed childdwarfismlighter fluidstabbed in chesttourniquetaging disordervintage clothingdeaf personmental torturewinter timebegins with a dreamhit on the head with a hammerdomestic quarrelhair ribbonmen's magazinecastration threatfrozen pondstillborn babycar through wallheavy makeupdriving in snowplaying the pianoremoving makeupculvertcurtsykilling a witnessrunaway vehicleseduction attemptsleeping childsuborning a witnessreference to little bo peep (See All) |
While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)
Subgenre: | american horror |
Themes: | guiltescapemurderdeathfriendshiprevengekidnappingrapetorturepsychopathbrutalitysadismcrueltyvengeancemurder of a police officer |
Mood: | goreslasherhorror movie remake |
Locations: | stormlakeforestboatwoodskitchenmotel |
Characters: | killerboydoctorfather son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipbrother brother relationshipteenage girlserial killerhostageterrorserial murderer |
Story: | hit with a hammercountry houseparalysiswoman in jeopardyhomemurdererhousestabbed to deathbound and gaggedcar crashcar accidentcorpsefemale frontal nudityfemale rear nudityfemale nudity β¦violencebloodbare chested malechasepantiespistolshowercell phonebeatingblood splattershot in the chestremakeshot in the headpunched in the facemaskheld at gunpointshot in the backswimmingcleavagefoot chasewinestrangulationdeath of friendstabbed in the chestwhite pantiesscantily clad femalenecklaceon the runstabbed in the backliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonthreatened with a knifegirl in pantiesmaniacfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusrape victimrapistfemale killerstealing a carfight to the deathpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationpsycho killermarijuana jointpsychopathic killergirl in bra and pantiesmadmanviolence against womenshot in the neckhead woundmisogynisthuman monsterremorsefemale friendshipsexual violencehomicidal maniac17 year oldescaped convictshot in the eyenihilismheld captivesummer vacationunderage smokingnaked dead womanbroken nosegropingfemale criminalbutcher knifecoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerfemale serial killerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All) |
"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.
Subgenre: | black comedy |
Themes: | guiltmurderdeathfriendshipbetrayaldrunkenness |
Mood: | goreslasherhorror movie remake |
Locations: | kitchenfire truck |
Characters: | killerfather son relationshipboyfriend girlfriend relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend |
Story: | hiding in a closetlaptop computerwoman in jeopardytherapistbasementscreamhouseaxevomitingbare buttshotgunblondecorpseknifefemale frontal nudity β¦female rear nudityfemale nudityviolencebloodmale rear nuditybare chested malepartychasesurprise endingpantiesshowerfirecell phoneblood splattermirrorshot in the chestremakeslow motion scenepunched in the facesecretheld at gunpointlingeriecollegehallucinationhandcuffsvoyeuralcoholcleavageflashlightstrangulationambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentwhite pantiesscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentbraceletpranklong takestalkingcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendnosebleeddead womanbroken legpump action shotgunstabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefightervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | psychological thrillerindependent filmcult filmblack comedysuspenseb movieabsurdismsurvival horrorbody horror |
Themes: | insanityguiltescapemurderdeathfriendshiprevengedrinkingfeardrunkennessbrutalityparanoiaillnessunrequited lovehome invasion β¦exploitationpanicpolice brutalityhuntingcamping (See All) |
Mood: | goreraincar chaseambiguous ending |
Locations: | lakebathtubforesthospitalbicyclewaterwoodsfarmtruckcavegas stationcampfirebackwoodsshed |
Characters: | doctorfather son relationshippoliceafrican americanboyfriend girlfriend relationshippolice officersheriffself mutilationhomeless mankiller dog |
Period: | 2000s |
Story: | killed with a hammerhit with a hammerrafttensionisolationscreamingstabbed to deathaxevomitingbare buttshotgunblondecar accidentcorpseknife β¦female frontal nudityfemale rear nudityfemale nudityviolencebloodflashbackmasturbationdogbare chested malesex scenecigarette smokingfingeringphotographpartychasesurprise endingpantiespistolshowerfirecell phonewoman on topbeatingshot to deathblood splatterhorseshot in the chesturinationshot in the headslow motion scenepunched in the facewritten by directorbikinibrawlrifleheld at gunpointbeerdead bodylow budget filmmarijuanahallucinationrevolverguitarshot in the backf wordswimmingdecapitationcleavagesurvivalfoot chasegay slurambushmassacreambulancedeath of friendimpalementstabbed in the chesttied to a chairbrunettefalse accusationsevered headscantily clad femaleradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathstabbed in the backkarateperson on fireproduct placementstorytellingvacationknocked outbaseball batcollege studentscene during end creditspigpremarital sexthreatened with a knifedirectorial debutsevered armshot in the armobscene finger gesturevigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagestealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemiccanoemental retardationabandoned housesquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting blooddog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | psychological thrillerindependent filmblack comedysuspensepsycho thrillerslasher flickholiday horrorchristmas horror |
Themes: | mental illnessinsanityobsessionescapemurderdeathrevengekidnappinginfidelitychristmasbetrayalfeardrunkennessinvestigationdeception β¦lonelinesspsychopathparanoiasurveillanceabductioncrueltypanicmadnessnear death experience (See All) |
Mood: | one nightgoreneo noircar chaseslasherdarkness |
Locations: | new york citycarsnowwatertaxielevatorurban settingpolice carcityoffice |
Characters: | policefemale protagonistpolice officerpolicemanhostagesecurity guardpolice detectiveslasher killermysterious villain |
Period: | winter |
Story: | duct tape gagpower failuredruggeddamsel in distresswoman in jeopardytensionisolationscreamingaxebound and gaggedcar crashcar accidentcorpsecryingknife β¦one word titleviolencenumber in titleblooddogfightexplosionpartychasesurprise endingtelephone callfirecell phonehigh heelsbeatingdigit in titleblood splatterfistfightmirrorpunched in the facebrawlplace name in titlerunninghandcuffsvoyeurmanhattan new york cityf wordsubjective cameracleavagesurvivalfoot chasenewspaperflashlightwinestrangulationvideo cameraambulancestabbingwomantied to a chairnonlinear timelineexploding carfalse accusationapologyhit by a cardouble crossduelattempted murderargumentstalkerorganized crimestabbed in the backperson on fireelectrocutionattackcharacter's point of view camera shotproduct placementknocked outkicked in the facechristmas treeattempted rapebodyguardstalkingexploding bodydie hard scenarioobscene finger gesturerecord playermaniacholidaypickup truckeavesdroppinganswering machineburned alivekilling an animalsociopathsecurity cameracaptivekicked in the stomachvideotapeimpersonationcovered in bloodteddy bearfaked deathparking garageanimal attackcrushed to deathduct tape over mouthbarefootfloodstealing a cartrappedbloody nosesurveillance cameramisunderstandingpower outagebusinesswomantitle appears in writingco workerescape attemptstabbed in the headchristmas evesexual harassmentdisembowelmentaerial shotblood on shirtdead manone daybuildinggasolinestabbed in the eyelonerbody countduct tapenervous breakdowncharacters killed one by oneburned to deathreckless drivingchloroformphysical abuseflat tiredead dogintimidationintestinesreference to elvis presleyaccountantcar troubleyellingchristmas presenttaserdisposing of a dead bodyanimal abusemind gamebody in a trunkhandcuffedwoman kills a manstabbed in the shouldermurder witnesssexual frustrationcar set on firetow truckgropingoverturning carmenacenervousnesshomeless personwoman fights a mantormentcrowbarpsychological torturefemale victimwhite dressimprovised weapontrunklocked in a roommolestationanimal killingchristmas lightsdoormanman hits a womanstupid victimfake accentreal timesurveillance footagechrysler building manhattan new york citycat and mousecrime of passiontauntingdeeply disturbed personchristmas decorationstragic villainwrench911bipolar disorderwoman punches a mancrushed by a carforkman fights a womanhomeless womannight watchmanrottweilerman punches a womansingle set productionwoman hits a mandog bitehandcuffed womanrental carnew york city skylinetire ironfire hosechased by a dogno cellphone signallock pickdumb policesprinkler systempettingflipping carstabbed with a forksleeping womanclaustrophobicderangedemployee employee relationshippersonality disorderstuck in an elevatorattacked with a knifefingernail cut offdragged by a carelvis presley impersonatorsanta costumevictim invited to dinnercar showroomdeath of a petvideo screenkilling a petflooded roomwet dressburned up cartitle appears on screenbitten in the legbroken cameratitle appears in text on screenchicken racerace impersonation (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | independent filmsuspenseb movieb horrorindependent horrorsadistic horrorpsychological horrorfrench horrorhorror b movie |
Themes: | insanitymurderdeathfriendshipsurrealismkidnappingrapefeartorturepsychopathdeath of fatherbrutalitydeath of mothersadismevil β¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All) |
Mood: | nightnightmaregorecar chaseslasherdarknessblood and gore |
Locations: | rural settingbathtubforesthospitalwoodsroad tripfrancetruckgas stationsinging in a carbackwoodsback country |
Characters: | killerboyfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipteenage girlfemale protagonistserial killerstudent β¦best friendvillainterrorfrenchslasher killerbest friendsmysterious villainserial murderermysterious killerdeath of boy (See All) |
Story: | broken glasstensionmurdererhouseaxebound and gaggedcar crashshotguncar accidentcorpsedreamknifefemale frontal nudityfemale nudityviolence β¦f ratedbloodbare breastsflashbackmasturbationdogguncigarette smokingphotographlesbian kisschasesurprise endingshowertelephone callblood splattermirrorurinationshot in the headslow motion sceneshootingriflesunglassesbeddead bodylow budget filmbathroomneighborvoyeurtelephoneshot in the backsubjective cameradecapitationsurvivalflashlightmassacrestabbingthroat slittingimpalementstabbed in the chestsevered headscantily clad femalevanon the rundollevil mandeath of childdeath of brotherpursuitstalkingdeath of sondeath of husbandsleepingeuropekillingblood spattersplatterchild murdermaniacchainsawfireplacekilling an animalmass murderlistening to musicsurvivormutilationstabbed in the stomachpsychosevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecksurveillance cameramobile phonegash in the facemental hospitalplot twistbutcherperversionmurder of a childslaughterswingclassmatebody countaxe murdersexual assaultcharacters killed one by onekilling spreeparrotpsycho killerdead dogbeing followedpervertblood on camera lensserial murderpsychopathic killersuffocationtaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterhomicidal maniacfarmhousefemale psychopathslashinglistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamfemale villainevil womanextreme violencemurder of wifefilling stationgraphic violencemurderessstabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathmurder spreevineyardchainsdriving at nightdisturbed individualbutcherygrindhouse filmbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantfemale serial killerplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererbad girlpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy |
Themes: | insanitymurderdeathfriendshiprapeghostpregnancyfearmonsterinvestigationpsychopathbrutalitysupernatural powerdepressionsadism β¦eviltrauma (See All) |
Mood: | nightmaregoreslasher |
Locations: | hospitalchurchswimming poolcarmotorcyclewatercar on firedeath in a car accident |
Characters: | little boykillersingle motherboydoctorfather son relationshipteenagermother son relationshipfather daughter relationshipmother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipfemale protagonistgirl β¦serial killernursebabyartistreference to godlittle girlwaitressalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All) |
Period: | 1980s1940s |
Story: | dream sequencecreepy childpsychotronic filmbreaking a windowdamsel in distresstensionmurdererscreamscreamingcar crashbare buttwatching tvcar accidentdreamcrying β¦knifefemale rear nudityfemale nudityviolencenuditysexf ratedbloodbare breastssequelflashbackbare chested malegunphotographpartychasesurprise endingpistolshowertelephone calltopless female nudityblood splatterfoodslow motion scenefalling from heightshootingplace name in titlebeddemonhallucinationgood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchildpart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerlocker roomfantasy sequencechampagnepossessiondollevil manskeletonstalkingautomobilepremarital sexsevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampageplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workforced to eatgag reflexpicture comes to lifepushy father (See All) |
Patrick Bateman is handsome, well educated and intelligent. He is twenty-seven and living his own American dream. He works by day on Wall Street, earning a fortune to complement the one he was born with. At night he descends into madness, as he experiments with fear and violence.
Subgenre: | psychological thrillerindependent filmcult filmblack comedysuspensepsycho thrilleramerican horror |
Themes: | mental illnessinsanityangerescapejealousydrugsmurderdeathfriendshiprevengeinfidelityrapechristmasmoneydrinking β¦feartorturedrunkennessweddinginvestigationdeceptionmemorydivorcepsychopathbrutalityparanoiablackmaildrug userivalryevilabuseexecutionbreak upgreedpaniccannibalismhomelessnessfashionwealthmadness (See All) |
Mood: | nightgoresatireneo noirslasherambiguous ending |
Locations: | bathtubnew york citybarrestauranthelicopternightclubtaxiapartmentpolice caroffice |
Characters: | killerhomosexualpoliceboyfriend girlfriend relationshipprostitutepolice officerserial killerdetectivepolicemanlawyerlustsecurity guardvillainsecretaryterror β¦cousin cousin relationshipamericanpolice shootoutpolice chasehomeless manslasher killerserial murdererjewish americanself narrationcheating on one's girlfriendsex with prostitutesex killer (See All) |
Period: | 1980schristmas party |
Story: | over the topdruggedwoman in jeopardytensionmurderermissing personscreamscreamingstabbed to deathaxecar crashbare buttwatching tvblondecar accident β¦corpsedreamcryingknifefemale frontal nudityfemale rear nudityfemale nuditytwo word titleviolencef ratedbased on novelbloodmale nuditythreesomemale frontal nuditymale rear nuditydogbare chested malegunsex scenekissfemale full frontal nuditycigarette smokingdancingnipplesphotographexplosionpartyleg spreadingchasesurprise endingpantiespistolshowerfirevoice over narrationfondlingcell phoneshootouttitle directed by femalebeatingshot to deathunderwearblood splatterfoodmirrorshot in the chesturinationshot in the headcatcameradrinkundressinggunfightsex in bedthongheld at gunpointsunglassesrunninglingeriebeddead bodyinterrogationvoyeurrevolvermanhattan new york citytelephonemenage a troisf worddecapitationcleavagefoot chasegay slurbrawinenew yorkstrangulationvideo cameraambulancestabbingwomanmontageimpalementcocainestabbed in the chestexploding carmodelsevered headscantily clad femaledrawingdouble crosscontroversypolice officer killedvoice overcigar smokingshot in the foreheadbartenderracial slurconfessionattempted murderlimousineblack pantiesbusinessmanpay phonechampagnesex with shoes onmassagemistaken identityevil mankicked in the facechristmas treeshot in the shoulderfemale removes her clothesdatepigpremarital sexfirst parthandgunkillingblood spattersplattermaniacprivate detectivesurgerychainsawmachismoeyeglassescloseted homosexualpornographywaiteranswering machinefireplacerevelationmass murderlooking at oneself in a mirrortape recordersociopathscene during opening creditslifting someone into the airragevirusexercisewatching a moviebuttockseccentricgossipimpersonationphone boothpsychocovered in bloodvictimbrooklyn new york cityblack humorrapistschizophreniarealitymale underwearguardrampagebarefootremote controljanitorrear entry sextelescopecouchhatredfitnessimpostorcannibaldark humorbutcherheadphonesescape attemptlaughtersketchslaughterrefrigeratortuxedobody countduct tapeaxe murderbriefcasenervous breakdownalienationcharacters killed one by oneethnic slurkilling spreeworld trade center manhattan new york citysirenpsycho killerdrugged drinkwoman in bathtubpervertserial murdervillain played by lead actorpsychopathic killervideo tapefianceebad guyhysteriamadmanface masklaundrynotebookkilling a dogmisogynisthuman monstermen's bathroomspiral staircasefemale removes her dresssnorting cocainejournalmini dresssexual perversionhomicidal maniacrestroomskyscrapermasseuselaundromatslashingcall girlsplit personalitycredit cardbody in a trunknarcissismreference to donald trumpdance clubwoman in bra and pantiesnihilismyuppiebathrobebusiness cardoffscreen killingcdeastersense of smellbumpearl necklaceurinalcarnage80s musicsole black character dies clichevanityfur coatsushihomeless personreference to ronald reaganoverhead camera shotrealtorbloody violencehobopool of bloodfemale bartenderfemale victimlunaticsadistic psychopathcocaine snortingceohedonismvice presidentanimal killingmass murdererdisturbed individualjerkbutcherywalkmaninnocent person killedsuspenderscrime spreehigh societyidentity crisismaterialismstairwellmartinideeply disturbed personserial rapistcityscapekilled during sexbroken engagementcult figureborderline personality disordercorporate executivenail gunwall street manhattan new york cityaxe in the headsex act reflected in mirroranswering machine messageruthlessnessbritish actor playing american characterautomated teller machinebottled watercreepycompact discexercisingspiked drinkraincoatmisanthropeambiguitytwin towerscuisinemultiple personality disordervideotaped sexworld trade centersadisticstockbrokerharvard universitynylonswashroomdissectionhigh risedouble murderdragging a dead bodygory violenceeast coastsickolock of hairstreet walkeraxe murdererchauvinismmanicureunreliable narratorgruesomepornographic videotanning bedfirst lesbian experiencelasciviousnessmistletoemurder confessionbloodlustchainsaw murdermusic fansavagerywall streetsexual experimentationinvestment bankermurdered womanreservationsteroidlistening to music on headphonesvoice imitationyale universitydry cleaningemployee employee relationshiphacked to deathsex maniacbedsheetbrutalmergerreference to ted bundycheating on one's boyfriendoffice jobreference to mikhail gorbachevdecolletagestain27 year oldnarcissistic personality disorderparanoiacsadistic killeranti consumerismfemale victimsfrenzylithiumovercoatinner monologueslashed to deathstuffed toy animalxanaxreference to whitney houstoncouturefeet on deskreference to genesiswhite collarantisocial personality disorderblack nylon stockingsclothes hangerhiding evidencepet pigfalse alibikentucky derbysadistic sexsound systemreference to dorian graycorporate raiderdead body in bathroomreference to ed geinreference to phil collinswoman kicks a manchild of divorcechinese laundryhead in refrigeratorskin caresnorting coketruth taken as a jokecranberry juicepretend telephone callreference to elvis costellorope skippingcoasterharvard business schoolreference to ivana trump (See All) |
Forty-year-old Christine Lucas wakes up in bed with a man she does not know, in an unfamiliar house. The man explains that he is her husband, Ben, and that she suffered brain damage from a car accident ten years earlier. Christine wakes up every morning with no memory of her life from her early twen β¦ties onwards. Christine receives treatment from Dr. Nasch, a neurologist at a local hospital who provides her a camera to record her thoughts and progress each day, and calls her every morning to remind her to watch the video in the camera. Soon, she starts to discover the truth around her. (Read More)
Subgenre: | psychological thrillerindependent filmsuspensetragedyfamily tragedy |
Themes: | mental illnessguiltangerescapelovefriendshipmarriageinfidelitybetrayaladulterypregnancyfearinvestigationdeceptionmemory β¦extramarital affairdivorcebrutalityparanoiagriefunfaithfulnessillnesspanictraumaamnesiaforgiveness (See All) |
Mood: | nightmareneo noir |
Locations: | hospitalschoolhotelairplanelondon englandairportelevatorkitchenpolice carenglandfire truck |
Characters: | little boyteenage boyboydoctorfather son relationshiphusband wife relationshipmother son relationshipfriendfemale protagonistteacherbabybest friendpsychiatristex husband ex wife relationshippregnant woman β¦self discoverydoctor patient relationship (See All) |
Period: | 1990s2000s2010syear 1999year 2013year 2007 |
Story: | dream sequencefemale star appears nudered herringwhisperingbroken glasstensionpsychologisttherapistscreaminghousebare buttcar accidentdreamcryingfemale rear nudity β¦female nudityviolencenuditysexbased on novelbloodflashbacksex scenekissfightcigarette smokingphotographpartychasesurprise endingshowertelephone callcell phonebeatingblood splatterfoodmirrorface slapslow motion scenepunched in the facecamerawritten by directorarrestsecretletterlierunningbedsex standing upbathroomhallucinationbritishtelephonef wordsubjective camerafoot chasebedroomstrangulationambulancemontageeatingaccidentfalse accusationapologyno opening creditsdrawingdouble crosssearchon the runflash forwardparkattempted murderargumenthotel roomdangerkeyattackliarcharacter's point of view camera shotknocked outdiarydomestic violencescarinjectiondeath of sonreunionsleepingtrusttherapygaragefreeze framesyringerevelationwarehousehypodermic needleheavy rainlooking at oneself in a mirrorlistening to musicsociopathcrying womannosebleedbarefoot maleparking garagefalse identitypresumed deadreverse footagebloody nosemobile phoneblood on faceintrigueloss of sonimpostorhousewifeescape attempthit on the headevidencesurprisewedding ringvoice over letternotepierbruisebenchnewspaper clippingholding handsmannequinphoto albumfast motion sceneclose up of eyesfiremanmemory lossanniversarymental patient12 year oldclosetnotebookmedical maskviolence against womenrepeated sceneschemeassumed identitydoubtfake identitytwist endingfriendship between womenhospital roomhospital bedhearing voicesnewspaper articlehead injuryscene of the crimelocked doordomestic abuseseizurecamcorderrepeated linefacial scarmanipulative behaviorfirst person titlehiding placehitchcockiandistrustfully clothed sexwaking upwet clothesflashback within a flashbackbrain damageclose up of eyefade to blackman hits a womanwedding anniversaryman slaps a womanwrapped in a towelman slaps womanloss of memorycityscapevideo diaryconcussionfire alarmlearning the truthdigital camerapretending to be someone elseman hits womanpsychological manipulationrepeated eventman fights a womanrepressed memorywine bottlehysterical outburstleft for deadbloody mouthhidden truthman punches a womanvideo recordingobservatoryreconstructionsedativepenis slurkiss on the foreheadhummingmanipulative mandead sonoutburstpeepholeprivate investigationbirth certificatedisbeliefrepeated dialoguemysterious event40 year old8 year oldmentally unstablename tagfacial bruisechloroformedmale female fightwindshield wiperamnesiacmristanding in the rainviolent manmentally unstable womanbrushing one's teethclose up of handmentally unstable protagonistwoman wrapped in a towelhusband hits wifehusband slaps wifelocking a doorwrapped in a bedsheetbreaking a glassshort term memory losswedding photographlost memorymeningitiswaking up nakedgaslightingmistaken belief that someone is deadshoeboxill wifeshort term memorycamera shot of eyessick wifeanterograde amnesiareunited with familysearching for the truthskiing accidentage regressionhit with a lampchemistry teachermedical reportsick womanlooking through a peepholetalking to a camerasinging along to music (See All) |
In "House of 1000 Corpses", two young couples take a misguided tour onto the back roads of America in search of a local legend known as Dr. Satan. Lost and stranded, they are set upon by a bizarre family of psychotics. Murder, cannibalism and satanic rituals are just a few of the 1000+ horrors that β¦await. (Read More)
Subgenre: | independent filmcult filmdark comedyslasher flickcreature featuresadistic horror |
Themes: | mental illnessinsanityjealousymurderdeathsurrealismkidnappingrapefeartorturefuneralmonsterseductiontheftdeath of father β¦sadismtheatrecannibalismmadnessmurder of a police officer (See All) |
Mood: | nightmaregorerainslasher |
Locations: | cemeterypolice carroad tripcavegas stationmuseumtunnelshedcave in |
Characters: | father son relationshipfamily relationshipsfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother sister relationshipserial killerthiefsheriffslasher killerpolice lieutenantevil doctor |
Period: | 1970syear 1977 |
Story: | youngcandlelightlanterntied updisappearancemissing personhousestabbed to deathaxebound and gaggedwatching tvshotguncar accidentcorpsedream β¦knifeviolencenumber in titlebloodflashbackbare chested maledancingphotographchasesurprise endingpistolfirebeatingdigit in titleshot to deathblood splattershot in the headslow motion scenethongmaskrifleheld at gunpointhallucinationrevolvershot in the backsubjective camerahalloweenstabbed in the chesttied to a chairmapsevered headman with glassescoffinritualgraveyardshot in the foreheadgravecharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesevil manlightningskeletonhanginghalloween costumelong takecheerleadercrosssplit screenpigcharacter says i love youthreatened with a knifecult directormaniacpoemtv newsundergroundmass murdertape recorderlifting someone into the airtied to a bedcaptivewalkie talkiegiantphone boothflatulencepsychosevered handskullhome movierapistcommercialhitchhikercrushed to deathmasked mangas maskduct tape over mouthnicknameface paintgash in the faceshot in the facenewsreel footagemental hospitalbody landing on a carknife throwingraised middle fingerdead woman with eyes openpsychoticmannequintorso cut in halfhit with a baseball batintestinesmadmanburied aliveneedleshot in the neckold dark houseurban legendhuman monsterfreakmental retardationnight visionbillboardpsychedelicbody in a trunkdeputyauto mechanicdeath of boyfriendsleeping in a carburnt bodytow truckneck bracereference to john waynebreaking through a doorburn victimghoulevil clownpitattempted robberyjack o'lanternspotlightradio djdepravityliquor storeknife in the chesthidden gunserial rapistno survivorstv hostcult figurekiller clownhand cut offfemale serial killerreference to mickey mousetrick or treatsatanic ritualbreaking a car windowmusic score composed by directorscalpingsevered facemissing person posterbroken windshieldreference to charles mansonclown makeupdumb criminalhiding in a carclown facefried chickendrinking and drivingrabbit costumetourist attractionstocking capstraight edge razorfunhousevictim invited to dinnerreference to donald duckroadside attractionfetus in a jarmounted animal headreference to jayne mansfieldshooting out tirehead bracereference to nancy drewreference to ed geinreverse negativedunce cap (See All) |
In the heat of the summer, a lonesome house in the countryside between woods and corn fields, lives nine-year-old twin brothers who are waiting for their mother. When she comes home, bandaged after cosmetic surgery, nothing is like before. The children start to doubt that this woman is actually thei β¦r mother. It emerges an existential struggle for identity and fundamental trust. (Read More)
Subgenre: | cult filmsuspense |
Themes: | mental illnessmurderdeathmoneytorturedivorcedysfunctional familysadismtrauma |
Mood: | nightmaregore |
Locations: | stormlakebathtubforestchurchcemeteryvillagewoodstwo in a bathtubrunning through the woodsboy in a bathtub |
Characters: | boyfamily relationshipsmother son relationshipchildrenbrother brother relationshippriestchristiancrying boyevil mother |
Period: | summer |
Story: | singing a lullabytaking a bathdream sequencepsychotronic filmdelusionhomehousebound and gaggedbare buttknifefemale rear nudityfemale nudityviolencef ratedbare breasts β¦bondagephotographsingingtelephone callfiretopless female nudityurinationface slapcatundressingmasklieprayerflashlightaccidentapologychildgraveyardstrippingactor shares first name with characterdomestic violencecountrysidegifttrapreunionsuspiciontwinarsonstrong female characterpizzasurgeryeavesdroppingidentitygamekilling an animalnipples visible through clothingwoundlooking at oneself in a mirrorrepetition in titletied to a bedcaptivetwinscrying womanaccidental deathvisitfull moontrappedcrossbowimpostorchild protagonistcharityplot twistdead childbathingbarefoot femaleduct tapefieldcellarburned to deathphoto albumfirefighterplastic surgerycockroachdoubtbugfish tankdomineering motherimaginary friendaustriacornfieldbare chested boyhead injurytaking off shirtlocked dooridentical twinskiller childcrying femaletrampolinehiding under a bedfirst person titlematricide11 year olddead catdistrustwatching a videomagnifying glasswet clothesaltardelivery manhouse on fireimmolationframed photographabusive motherburningcentral europelong haired malebirthmarkhysterical womanred crossbloody facebad dreamaustriansecretly observingbossy womancharacter says i'm sorrydead brotherlocked inhysterical outburstmother son reunionhead bandageaudio tapeemotional abusebad motheraudio recordinghouse arrestwalking in the raincounting moneybaby monitorestranged sonwatching someone sleepwetting oneselfchild as main characterlistening devicecosmetic surgerymoney countingseeing dead peopleson murders motherfeeding someonemysterious eventwoman directorimaginary personhailstormlooking glassnaked outdoorsestranged mothermother son conflictplaying accordiondisbelieving adultsetting a firetwin brothersnine year oldcult favoriteguessing gameemotionally unstablebandaged facepretending to sleepanimal masksinging alongaccordion playermajor child rolebrushing one's teethbossy mothergoogling for informationmother slaps sontv personalityabusive womanantagonist as protagonisthouse for saleviolent womanfood deliveryvacuum cleaningwet pantscrying for helpkilling a petthrowing water on someonewoman on firetagabused boyface injurytelevision presenteremotionally unstable womantied handscapgras delusionhair cuttingwoman bound and gaggedcutting one's haireating a bugfemale bondagehysterical motheridentical twinlying on the floorson killedwetting one's pantsfrozen foodlocked in a carsextontalking to a photographurinating into a bottlewoman tied to a bedcrazy boycutting someonemother hits sonpouring raincovering someone's mouthson hits mother (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | psychological thrillercult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof |
Themes: | escapemurderdeathfriendshiprevengeinfidelitybetrayalfeardrunkennessinvestigationextramarital affairdivorcepsychopathbrutalitydeath of mother β¦paranoiahome invasionnear death experiencedeath of daughter (See All) |
Mood: | goresatirehigh schoolslasherdarkness |
Locations: | forestsmall townwoodskitchenpolice stationschool bus |
Characters: | single fatherkillerteenage boyfather son relationshipteenagerfamily relationshipshusband wife relationshippolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipteenage girlfemale protagonistserial killer β¦villainsheriffslasher killerself referential (See All) |
Period: | 1990s |
Story: | hiding in a closetred herringdamsel in distresssingle parentscreamstabbed to deathbound and gaggedcar crashwatching tvrescueblondecar accidentcorpseknifeone word title β¦violencef ratedbloodbare chested malecigarette smokingtitle spoken by characterpartychasesurprise endingpistolfirecell phoneshot to deathblood splattershot in the chestface slapshot in the headslow motion scenepunched in the facecomputercatarrestfalling from heightmaskshowdownheld at gunpointbeerinterrogationhandcuffstelevisiontelephonef wordsubjective camerasurvivalfoot chaseflashlightcaliforniadisguiseambulancedeath of friendthroat slittingstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangerstabbed in the backsuburbwidowerelectrocutionfirst of seriescharacter's point of view camera shotproduct placementhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionfirst partthreatened with a knifecult directorgaragestrong female charactereavesdroppingropeanswering machinefalling down stairsteen angstrevelationnipples visible through clothingloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenecameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionwater fountainsittingfalling off a roofdutch anglerookie copmystery killergeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | cult filmsuspensepsycho thrillerslasher flickamerican horrorholiday horror |
Themes: | insanityobsessionjealousymurderdeathfeartorturevoyeurismmemoryseductionpsychopathbrutalityparanoiablindnesstrauma β¦madnessmurder investigationmurder of a police officerpsychological trauma (See All) |
Mood: | nightgoreslasherdarkness |
Locations: | wheelchairhospitalcarsmall townpolice carhospital fire |
Characters: | killerteenagerpoliceboyfriend girlfriend relationshipteenage girlpolice officerserial killernursedetectivepolicemanvillainsheriffterrorslasher killerserial murderer |
Period: | 1970syear 1978 |
Story: | hand over mouthbroken glasspsychologisthammerhidingmurdererscreamscreamingbathstabbed to deathwatching tvblondecar accidentcryingknife β¦female rear nudityfemale nuditytwo word titlenudityviolencesexnumber in titlebloodmale nuditybare breastssequelmale rear nuditykisscigarette smokingnipplesexplosionchasetelephone callfireblood splattershot in the chestkissingbrawlsecretmaskshootingsecond partneighborvoyeurrevolversubjective cameragood versus evilhalloweenflashlightold manstrangulationambulancestabbingthroat slittingaccidentbrunettepart of serieshit by a carsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathstabbed in the backprologueperson on fireuniformpoisoncharacter's point of view camera shotproduct placementcollege studentinjectionstalkingglasseswitnesstrapsplattermaniactv newssyringedestructionelectronic music scorehypodermic needlesexual attractionlifting someone into the aircowboy hatmutilationwalkie talkiestabbed in the stomachbuttockscaucasianpoolpsychogrindhousebuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmercilessnessmutebutchercigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyedark pastbody countcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerpsycho killerflat tirefemale stockinged feetdead girlserial murderpsychopathic killerbad guyconfusioncar troublemadmanmysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonehomicidal maniacsuit17 year oldearringnurse uniformslashingdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettekiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelknife murderbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscaremurder spreenude bathingsilhouettevillain not really dead clichebutcherygrindhouse filmzippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidepsycho terrormidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead personboiling waterdark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patienthot waterneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nursescalded faceself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All) |
Best-selling novelist Paul Sheldon is on his way home from his Colorado hideaway after completing his latest book, when he crashes his car in a freak blizzard. Paul is critically injured, but is rescued by former nurse Annie Wilkes, Paul's "number one fan", who takes Paul back to her remote house in β¦ the mountains (without bothering to tell anybody). Unfortunately for Paul, Annie is also a headcase. When she discovers that Paul has killed off the heroine in her favorite novels, her reaction leaves Paul shattered (literally)... (Read More)
Subgenre: | suspensepsycho thrillersurvival horroramerican horror |
Themes: | mental illnessinsanityobsessionangerescapemurderdeathrevengekidnappingtortureinvestigationlonelinesspsychopathsadismevil β¦abductionwritingmadnessmurder of a police officerclaustrophobia (See All) |
Mood: | neo noirdarkness |
Locations: | wheelchairhelicoptersnowsmall townwoodssnow storm |
Characters: | killerserial killernursewriterhostagevillainterrorslasher killerserial murderershooting a police officermysterious killerbaby killer |
Story: | psychotronic filmtensionhomemurdererbasementisolationhousecar crashrescueshotguncar accidentknifeone word titleviolencebased on novel β¦bloodgunfighttitle spoken by charactersurprise endingbeatingshot to deathshot in the chestslow motion scenesubjective camerastabbingwomansearchduelattempted murderauthorcharacter's point of view camera shotpigobscene finger gesturetypewriterkillingmaniacsociopathragemutilationcaptivevillainesspsychologydesperationpsychovictimfemale killerbroken legrampagethunderfanfight to the deathbutchermedicationmurder of a childhighwaydark pastpsychoticnewspaper clippingpsycho killerphysical abuseintimidationserial murderpsychopathic killernovelold dark househuman monsterhomicidal maniacfemale psychopathslashingblizzardfemale villainevil womanmatchidolmurderesspsychological torturebloody violencereclusesadistic psychopathsledgehammervillain not really dead clichebutcherycreepmysterious strangerscrapbooktauntingdeeply disturbed personbipolar disorderborderline personality disorderobsessed fanfemale serial killerchild killerweirdocreepychild murderervillainess played by lead actresstorturersadisticpolice officer shot in the backdark and stormy nightdrive in classicbased on the works of stephen kingserial child killermarshalbludgeoned to deathbad girlmad womangruesomemeltingreference to liberaceattempted escapedruggingbrutaldislocated shoulderromance novelistvictim invited to dinnerfight sceneceramicgrande dame guignolmale victimserial child murdererhomecare nursepicking lockstruggling authorfemale emasculating a male (See All) |
After returning from a wedding reception, a couple staying in an isolated vacation house receive a knock on the door in the mid-hours of the night. What ensues is a violent invasion by three strangers, their faces hidden behind masks. The couple find themselves in a violent struggle, in which they g β¦o beyond what either of them thought capable in order to survive. (Read More)
Subgenre: | independent filmsuspensesurvival horror |
Themes: | murderfeartorturepsychopathparanoiahome invasionpanic |
Mood: | one nightnightslasher |
Locations: | rural settingkitchenshedcar fire |
Characters: | boyfriend girlfriend relationshipserial killerterror |
Period: | year 2005 |
Story: | hiding in a closetcountry houseisolationhousestabbed to deathaxecandlecar crashshotguncorpseknifeviolencebloodflashbackcigarette smoking β¦dancingsurprise endingcell phonebeatingshot to deathblood splattershot in the headwritten by directorpianoalcoholfoot chasebedroomflashlightdisguisedeath of friendstabbed in the chesttied to a chairnonlinear timelineno opening creditsmarriage proposalchampagneevil manknocked outstalkingthreatrecord playerpickup truckfireplaceice creambarnvandalismstabbed in the stomachcovered in bloodstrangerfemale killermasked manpump action shotgunconfrontationblood on shirtswingintruderwedding receptionmasked killerflat tireengagement ringmormonwoman in bathtubinterrupted sexharassmentbag over headvery little dialoguehomicidal maniaccottagemind gamebubble bathfilm starts with textcabin in the woodsscene of the crimebleeding to deathmasked villainknife murderpsychological torturebutcher knifebreaking through a doorcut handcat and mousestarts with narrationtauntingnightgownwriting in bloodred lightham radiocrawlingbroken windshieldmasked woman911 callwind chimecandlelight dinnershower curtainunmaskingtwisted ankleloading a gunheld at knifepointsmoke alarmrose petalmasked intruderassembling gunsack maskflannel (See All) |
New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)
Subgenre: | independent filmsuspenseconspiracyamerican horrorbritish horrorfolk horror |
Themes: | insanityguiltmurderdeathkidnappingreligionghostfearmagicdeath of fathersupernatural powerdeath of motherredemptionillnessevil β¦dyingdevilmadnesswildernessfather love (See All) |
Mood: | goreraindarkness |
Locations: | rural settingforestchurchvillagewoodsfarmenglandcampfirenew englandbackwoods |
Characters: | little boyboyfather son relationshipfamily relationshipshusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerbrother brother relationshipbrother sister relationshipteenage girlbabysister sister relationship β¦christianreference to godlittle girlvillainbiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All) |
Period: | winter17th century1600s |
Story: | whisperinglanterntensionisolationdisappearancescreamingaxecandlecryingknifefemale frontal nudityfemale nuditynudityviolenceblood β¦male nuditymale rear nuditydogbare chested malekisssingingsongblood splatterfoodhorseundressingsecretlierifledemonhallucinationreference to jesus christprayersubjective camerastrangulationstabbingwomaneatingfalse accusationsearchgunshotconfessiongravepoisonpossessionrabbitdeath of brotherdeath of sondeath of husbandsuspicionchickendirectorial debutsleepingtwinwolfmass murdergothiceggwitchcraftcrying womancrying manburialanimal attackgoatapplepromisehypocrisysonhungerbutchershovelpridemurder of a childslaughterdead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All) |
A young hospice worker helping care for an invalid who lives in a remote mansion in the Louisiana bayous finds herself caught in the middle of morbid happenings centered around a group of Hoodoo practitioners.
Subgenre: | suspense |
Themes: | deathkidnappingmarriageghostfearmagicpanic |
Mood: | nightmarerain |
Locations: | wheelchairbathtubhospitalcemeterynightclubelevatorkitchenrooftopgas station |
Characters: | little boypolice officernursemusicianbabylawyerlittle girlmaidfrenchwitch doctor |
Period: | 1920s |
Story: | younghatchetparalysispatienttied upisolationbound and gaggedcandleshotgunblondecar accidentdreamknifebloodflashback β¦fightdancingphotographpartysurprise endingpantiescell phonemirrorcamerasecretfalling from heightriverflashlightold manstrangulationmapritualroommategunshotattempted murderkeyumbrellalightningringhangingdomestic violencecountrysideloss of fatherstagerecord playeroccultropefalling down stairshypodermic needlegothicservanttorchhaircutthunderjob interviewnew orleans louisianaheadphonesrowboatswampsuperstitionatticrainstormvoodooblack magicmusic banddrugged drinkspellwifegardeninggatelouisianaelderlycanoelizardlaundromatno title at beginningponytailparamedichusbandstrokefall from heightbusiness cardpotionnursing homenoosehouse partydumpsterritesymbolpigtailslynchinglockphonographsecret roomamerican southvolkswagen beetledustbedriddenphonograph recordshackstreetcarbayouspiked drinkinvalidpeacocksouthern gothicchalkbraidscandlelight dinnerhospicesoul transferenceincantationbedsheetvictim invited to dinnerconjurerwant addouble barrel shotgunparalyzedskeleton keyhoodoogumbo (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | independent filmsuspenseamerican horrorindependent horrorsadistic horrorslasher horrorhorror b movie |
Themes: | insanityescapemurderdeathtorturepsychopathbrutalitysadismevilhome invasionexploitationcrueltymurder of a police officer |
Mood: | nightgoreslasherblood and gore |
Locations: | strip clubtrying to escape |
Characters: | killerteenagerhusband wife relationshipfather daughter relationshipmother daughter relationshipteenage girlserial killerhostagethiefvillainterrorself mutilationtalking to oneself in a mirrormysterious villainthe family β¦mysterious killerkiller dogdirector of photography (See All) |
Story: | captivitypsychotronic filmwoman in jeopardyhomehammerhidingisolationscreamscreaminghousestabbed to deathcar crashshotguncorpseknife β¦female frontal nudityfemale nuditytwo word titleviolencecharacter name in titlebloodbare breastsflashbackfightcigarette smokingnippleslesbian kisssurprise endingpistolbeatingblood splattermirrorslow motion scenepunched in the faceshowdownheld at gunpointdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurflashlightstabbingimpalementstabbed in the chesttied to a chairscantily clad femalechild in perilhit by a cardangerelectrocutiondebtevil manactor shares first name with characterneck breakingtrapfirst partthreatened with a knifeex convictblood spattermaniaccrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationspiderdesperationpsychocovered in bloodvictimteddy bearanimal attackhomicidemasked maneaten aliverampageburglartrappedsevered fingermobile phoneburglarymercilessnessgash in the facebutcherpsychotronicescape attemptscissorsscene after end creditsdisembowelmentperversiontitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerpsycho killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesserial murderpsychopathic killerbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidhomicidal maniacclimbing through a windowslashingself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathcut handhouse on firemurder spreedragging a bodyviolent deathbutcherygrindhouse filmex wifeexploitation filmcrime spreedeeply disturbed personclothes rippingbear traphung upside downthroat rippingmystery killersliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psychological thrillerblack comedysuspensesuperherotragedypsycho thrillersurvival horrorteen horroramerican horror |
Themes: | mental illnessinsanityescapemurderdeathfriendshipsurrealismkidnappingrapebetrayalfearfuneralmonsterdeceptionvoyeurism β¦psychopathdeath of fatherbrutalityparanoiasurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All) |
Mood: | goreneo noirslasher |
Locations: | foresttraintaxiwoodskitchenapartmentpolice cartaxi drivermuseumtunneltrain stationart museum |
Characters: | killerdoctorteenagerfather daughter relationshipafrican americanteenage girlpolice officerserial killerhostagesecurity guardvillainpsychiatristterroruncle niece relationshipslasher killer β¦serial murdererpolice dog (See All) |
Period: | 2010s |
Story: | crawlspaceskypedamsel in distresswoman in jeopardytherapistmurdererbasementmissing personwatching tvrescueshotguncorpseknifeone word titleviolence β¦bloodsequelflashbackdogbare chested maledancingtitle spoken by characterpartychasesurprise endingpantiescell phoneshot to deathshot in the chestcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversubjective camerasurvivalorphanbedroomflashlightambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangercharacter's point of view camera shottentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkinglaptoploss of fathersuspicionkillingmaniacrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasianeccentricpsychopart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotguncameohaunted by the paststealing a carcannibalmercilessnesspower outagezooshopping mallsuper villainescape attemptpedophilee mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerdark pastbody countcharacters killed one by onekilling spreechloroformpsycho killertorso cut in halfhit with a baseball batserial murdervillain played by lead actorpsychopathic killerbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationhomicidal maniacmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastchild molesterbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopconferencepower drillpsycho terrorpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophaguseast coastair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedreference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All) |
An Australian couple take a sailing trip in the Pacific to forget about a terrible accident. While on the open sea, in dead calm, they come across a ship with one survivor who is not at all what he seems.
Subgenre: | cult filmsuspense |
Themes: | insanityobsessionmurderdeathkidnappingrapeadulterytortureseductionpsychopathbrutalitydrug usegrief |
Mood: | nightnightmarerain |
Locations: | hospitaltrainaustraliapolice carseashipoceanyachtstorm at seaship on fire |
Characters: | doctorhusband wife relationshippoliceserial killerpolicemandancerphotographerhostageaustralianterroraustralian abroaddeath of killer |
Story: | druggedraftpillswoman in jeopardymurdererisolationbare buttrescueshotguncar accidentcorpsecryingknifefemale frontal nudityfemale rear nudity β¦female nuditytwo word titleviolencesexbased on novelbloodmale nudityflashbackmale rear nuditydogbare chested malekissfightcigarette smokingdancingphotographchaseshowerfiresongbeatingfoodheld at gunpointtearssunglassesdead bodysubjective cameraswimmingflashlightsubwayapologyradiounderwater scenedrowningduelbinocularsmicrophonekeyevil mandeath of childdeath of sonsuspiciondie hard scenariomaniacsociopathsurvivorcaptivewristwatchstrangerhome movierailway stationblack humorpassportdivingphoto shoottrappedloss of sonhit in the crotchdeath threattitle appears in writingrowboatmedicationexploding headdead childevidenceone dayrainstormsailoropening a doornude woman murderedpsychoticpsycho killerminimal castalonesailboatsailingdegradationmarried coupleflareunconsciousnessswimming underwaterlying on bedman in swimsuitstabbed in the shouldershot through the mouthtitle same as bookpsychological torturesole survivorbreaking through a doorflare gunmass murdererdriving at nightkicking in a doorknocked out with a gun buttradarvoyagecat and mousepacific oceandeeply disturbed personhands tiedwriting in bloodlooking at picturebathing suitmovie projectorsleeping pillsharpoonfood poisoningdeath of dogmerry christmasthrown through a windshieldnaval officerwashing hairabandoned shipspear gunwoman in perildead body in waterblonde childwater pumprotting corpsefilm with ambiguous titlearm injurysalvagenitrous oxidesinking boatkilled in a car accidentpumpnauseagas canmarlboro cigarettesman punches womanwife's sexual pretenceengine roomflare gun as weaponreference to joni mitchellbanging on a doorschoonerhead on collisionflooded roomreference to julio iglesiasday for nightplaying fetch with a dogdingyreference to orpheusfuel gaugebotulismpulling someone's hair (See All) |
In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.
Subgenre: | independent filmpost modern |
Themes: | insanitymurderdeathkidnappingvoyeurismpsychopathhumiliationhome invasionmurder of family |
Mood: | breaking the fourth wallhorror movie remake |
Locations: | kitchen |
Characters: | boyfamily relationshipshusband wife relationshipserial killerhostage |
Story: | country houseduct tape gagyoungdockhometied upstabbed to deathbound and gaggedvomitingshotguncorpsecryingknifeviolenceblood β¦bondagedogchasesurprise endingpantiescell phoneshot to deathblood splattershot in the chestface slapremakeshot in the headvoyeurprayertelevisioncleavagewhite pantiesscantily clad femaleacronym in titlechild in perillooking at the cameradrowningtalking to the camerapainproduct placementlong takefemale removes her clothesgirl in pantiesmaniackilling an animalnipples visible through clothingeggsociopathlifting someone into the aircaptivesocial commentarybroken legremote controlball gagpunched in the stomachdark humorhousewifemurder of a childtitle at the endbettied feetbroken armduct tapedead dogbarking dogbag over headforced to stripdead animalfemale removes her dressdead childrengolf clubsailboatsailingdegradationdouble barreled shotgunmind gameteasingwetting pantsupper classwoman in lingerietied up while barefootpsychological torturewoman smokerleg woundcat and mousebloody body of a childeggsglovechild with a gunno survivorshair dryerchild killergolden retrieverraincoatgolf ballcarpetpliersgolferno musichit with a golf clubmurderer duoremake by original directorlifting a male into the airchain link fencechild shot in the headsummer houseweird behaviorwading in waterrewindcar stereoanti violencerandom violencebroken eggsail boatbound hand and footwire cuttersleg splintmurdered pet (See All) |
A young boy, recently orphaned, is taken to England by his grandmother. At a hotel in which they are staying, a group of witches have gathered to prepare a plot to rid England of all children.
Subgenre: | conspiracyabsurdism |
Themes: | missing childangerescapekidnappingmoneyfearmagicdeath of fathersupernatural powerdeath of motherabductioncrueltypanic |
Locations: | beachrestaurantschoolhotelsnowsmall townbicycletaxielevatorkitchenpolice carenglandocean |
Characters: | little boyboydoctorfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipgirlpolice officerpolicemanbabylittle girl β¦maidwitchgrandmother grandson relationship (See All) |
Story: | young boyyounghandhidingdisappearancemissing personscreamcandlerescuecryingbased on novelsingingsurprise endingbased on bookunderwear β¦catmaskpaintingtearsrunningbirthdaysubjective cameragood versus evilfoot chaseorphanbedroommountaindisguisesnakechildradiodrawingchild in perilsearchcigar smokingold womantransformationhotel roomstripteaseuniformfantasy sequencemissionundercoverstorytellingvacationspeechpursuitwiggiftexploding bodyloss of fatherstageblindfoldfalse eyelashesloss of motherfireworkseuropebirthday cakeeyeglassesapplauseeavesdroppingtalking animalcakecagefaintingcomic booklifting someone into the airhatcookmousewitchcraftaccidental deathaudienceappleguestschool uniformlaughtermeetingnorwayspellchocolatepethysteriayellingcandyface masknotebookbirthday presentgloveseyebicyclingcheering crowdshoelistening to radiocabin in the woodsmetamorphosissoupconventionmeat cleavertreehousecashblack catsorceresshorse and wagonpigtailsdeath of parentstrunkdelivery mandiabetesstaffpet catvillain turns goodcarriagetoadbaldnessmissing girlscottishluggagemoney falling through the airbedriddenhuman becoming an animalrich kidhotel managershrinkingchild's drawingbaby carriagemousetrapmagical potionvillainess played by lead actressvisiting a gravehelium balloonlifting a female into the airbraided haircuisineclose up of mouthgluttonynorwegianman carrying a womancovenpastrybellhopbraidsorphan boyburpingbald womanchocolate barodorair conditionerman wearing a tuxedooverweight childtree housebaby strollerwhite roomformulagatheringlaser visionnative dressvignette formwoman wearing a one piece swimsuitgrande dame guignolkidnapping a childlanefragmentation grenademissing fingerwickednesspandemoniumhollow bookpompositybelief in witchesrubbing noseswoman dancinggrimoirehot water bottleevaporation (See All) |
In Tokyo, Shigeharu Aoyama is a widower that grieves the loss of his wife and raises his son Shigehiko Aoyama alone. Seven years later, the teenage Shigehiko asks why his middle-aged father does not remarry and Shigeharu meets his friend Yasuhisa Yoshikawa, who is a film producer, and tells his inte β¦ntion. However, Shigeharu has difficulties to approach to available women to date and Yasuhisa decide to organize a sham audition for casting the lead actress for the fake movie. They receive several portfolios of candidates and Shigeharu becomes obsessed by the gorgeous Asami Yamazaki. Despite the advice of the experienced Yasuhisa, Shigeharu calls Asami to date and he falls for her. But who is the mysterious Asami? (Read More)
Subgenre: | psychological thrillerindependent filmcult filmsadistic horror |
Themes: | obsessionangermurderdeathfriendshipsurrealismmarriagedrinkingfeartorturedivorcelonelinesspsychopathdeath of motherparanoia β¦drug usegriefdatinghumiliationsadismabusecrueltydeath of wifestarvationreligious cult (See All) |
Mood: | nightmarerain |
Locations: | wheelchairhospitalbarbeachrestauranthotelelevatorjapansearooftop |
Characters: | little boysingle fatherteenage boyboydoctorfather son relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipteenage girlnursedanceractress β¦little girljapaneseolder man younger woman relationshipfatheruncle niece relationshipaunt niece relationshipself destructivenessstepfather stepdaughter relationship (See All) |
Period: | 1990s |
Story: | druggedadviceparalysisdisappearancemissing personscreamfishingsuicide attemptvomitingwatching tvdreamfemale frontal nudityfemale nudityone word titleviolence β¦nuditysexbased on novelbloodinterviewflashbackdogbare chested malekisscigarette smokingdancingnipplesphotographtitle spoken by charactererectionpantiestelephone callcell phoneunderwearmirrorcomputerdrinkundressingliebeerbedcafepianohallucinationtelephonesubjective cameradecapitationfoot chasebedroombraconcertold manstrangulationvideo cameraambulancefishdinnerchild abusesevered headtonguecontroversysearchfemme fatalemarriage proposalcoffeebartenderpaintrainingflash forwardbusinessmanwidowerliarumbrellaauditionscarpianistinjectiondateballetdismembermentfalling down stairssyringekilling an animaldesirehypodermic needlelooking at oneself in a mirrorhappinessmutilationoverallslosssadomasochisms&mtokyo japansufferingsevered fingerpet dogsonco workerscissorsschool uniformlaughterpedophilefilm producerperversionstabbed in the eyehousekeeperroommisogynyplaying pianodead dogceremonypiano playerpervertvideo tapewifeneedlekilling a dogmen's bathroomstairwaysubtitlesstepfathersexual perversionfemale psychopathmasochismtraffic jamyoung womanhusbandpiercingunhappinessballerinaamputationlollipopmissingbleedingfilm productionbody bagextreme violencemurderesswoman in a bikiniritescriptwoman undressingscreenplayflashback within a flashbacksevered footbroken neckgrindhouse filmbody partremarriageballet dancerman in a wheelchairtelephone numbermiddle aged manpassing outbedriddenparallel worldsevered eargarroteburnweirdoacupuncturepneumoniafemalespiked drinkleg bracesevered tonguegolf ballclose up of mouthrecord companydance studioincensewashroomagonyrubber glovesbeaglemystery womanshorelineburn scarcasting callsackpushed down stairspaleontologistreference to julia robertsreference to katharine hepburnresumeyogurtvoice over readingballet dancingballet shoesdioramasit inupright pianocamera shot of a woman's legsjob applicantforebodingclinking glassesmace spraymissing fingerspasmpiano wireclothes cut offmissing limbbaton twirlerbody in bagrod and reeltongstuning forkbroken collarboneburning oneselfawakened by a phonefoot amputationnegativismturning self in to the policefake auditionpracticing golfpretty woman (See All) |
Subgenre: | psychological thrillerindependent filmcult filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horror |
Themes: | insanityescapemurderdeathfriendshiprevengekidnappingfeartorturepsychopathbrutalityparanoiahome invasionpaniccannibalism β¦couragehuntingmurder of a police officerwildernessnear death experience (See All) |
Mood: | goreslasher |
Locations: | bathtubforestwoodspolice cartruckcavegas station |
Characters: | teenage boyteenagerboyfriend girlfriend relationshipteenage girlpolice officerhostageinterracial relationshipself mutilationslasher killer |
Period: | 2000s |
Story: | damsel in distressscreamingstabbed to deathaxebound and gaggedcar crashrescueshotguncar accidentcorpsecryingknifeviolencesex β¦bloodcigarette smokingexplosionchasesurprise endingpistolfirecell phonebeatingshot to deathblood splattershot in the headslow motion scenefalling from heightshowdownriflemarijuanacollegeshot in the backdecapitationsurvivalfoot chaseflashlightambushmountaindeath of friendtoiletstabbed in the chestmapexploding carsevered headdisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerstabbed in the backprologueperson on firefirst of seriesdollcollege studentscene during end creditsprankstalkingfirst partthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckstealing a carbraveryjob interviewcannibalmercilessnesspolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countaxe murdersevered legcharacters killed one by onearrowtank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | independent filmmartial artsblack comedypost modernhorror spoof |
Themes: | escapejealousymurderdeathrevengekidnappingbetrayalfeardrunkennessfilmmakinginvestigationdeceptionvoyeurismtheftbrutality β¦paranoiacelebrityhome invasioncourage (See All) |
Mood: | nightmaregoresatireslasher |
Locations: | barswimming poolhelicopterlos angeles californiaapartmentpolice stationpolice car |
Characters: | killerpolicefather daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistpolice officerserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm director β¦ex boyfriend ex girlfriend relationshipdeath of girlfriendself referentialpregnant from rape (See All) |
Period: | 1990s2000s |
Story: | hiding in a closetseclusionyoungred herringbasementisolationscreamscreamingstabbed to deathbound and gaggedcar crashwatching tvrescuecar accidentcorpse β¦knifeviolencef ratednumber in titlebloodsequeldogbare chested malefightcigarette smokingphotographpartychasesurprise endingpistolshowercell phonebeatingdigit in titleshot to deathblood splatterfistfightshot in the chestshot in the headpunched in the facebrawlsecretfalling from heightmaskshowdownheld at gunpointsunglassesbirthdayhallucinationhandcuffsvoyeurrevolvershot in the backf wordreportersurvivalfoot chaseflashlightjournalistambushstrangulationambulancemansionthroat slittingtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumerace against timecover upknocked outkicked in the facetough girlbaseball batprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodypremarital sexsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phonehit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All) |
In this comedy, Lars Lindstrom is an awkwardly shy young man in a small northern town who finally brings home the girl of his dreams to his brother and sister-in-law's home. The only problem is that she's not real - she's a sex doll Lars ordered off the Internet. But sex is not what Lars has in mind β¦, but rather a deep, meaningful relationship. His sister-in-law is worried for him, his brother thinks he's nuts, but eventually the entire town goes along with his delusion in support of this sweet natured boy that they've always loved. (Read More)
Subgenre: | coming of ageblack comedydark comedy |
Themes: | mental illnessguiltjealousydeathfriendshippregnancydrinkingfearfunerallonelinessgriefdyingdeath in childbirth |
Locations: | rural settinglakewheelchairbathtubhospitalrestaurantchurchsnowcemeterysmall townofficeoffice party |
Characters: | boydoctorfather son relationshipfamily relationshipshusband wife relationshipboyfriend girlfriend relationshipsingerbrother brother relationshipdancerpriestlove trianglebrother in law sister in law relationship |
Period: | winter |
Story: | youngdelusionhomepsychologistisolationbathcharacter name in titledancingphotographsingingpartytelephone callsongfoodcomputer β¦drinkcafeneighborflashlightambulanceeatinginternetdinnergraveyardmarriage proposalflash forwardgravedollreadingflowersgaragerecord playerteddy bearrejectionanxietyheadphonesco workerfirst kisschoirsnowingbowlinggrowing updead motherbrushing teethsirenearphoneshandshakeshynesswebsitephysiciantombstonebowling alleyreverendresponsibilitynoosetolerancewakegravestonetreehousehymnvending machineschizophrenicscrabbleblanketchurch servicechopping woodemergencysex doll911phonograph recorddoctor's officeaction figureintrovertcounselingchurch choiranxiety attacklutheranartificial respirationspring the seasonmother dies in childbirthmail orderchild likeineptloss of confidenceaphephobiagrowing painsimaginary girlfriendin love with an inanimate objectlifesize dollcommunity support (See All) |
After a car accident, Michelle awakens to find herself in a mysterious bunker with two men named Howard and Emmett. Howard offers her a pair of crutches to help her remain mobile with her leg injury sustained from the car crash and tells her to "get good on those" before leaving the bunker. She has β¦been given the information that there has been an alien attack and the outside world is poisoned. However, Howard and Emmett's intentions soon become questionable and Michelle is faced with a question: Is it better in here or out there? (Read More)
Subgenre: | psychological thrillerblack comedysuspenseconspiracypost apocalypsepsycho thriller |
Themes: | angerescapemurderdeathkidnappingbetrayalfearmonsterdeceptionmemoryparanoiabreak uppanicapocalypsecourage β¦self sacrificenear death experienceregretalien abduction (See All) |
Mood: | nightdarknessambiguous ending |
Locations: | rural settingcarwaterkitchenapartmentfarmtruckgas stationusashed |
Characters: | female protagonistalienhostageex military |
Period: | 2010s |
Story: | car alarmruralpsychotronic filmalarmdamsel in distresswoman in jeopardytensionbasementmissing personscreamscreamingcar crashwatching tvcar accidentcorpse β¦knifenumber in titlebloodsequelflashbackbare chested malegunphotographexplosionchasethree word titlesurprise endingpistolshowertelephone callfirecell phonedigit in titleshot to deathfoodshot in the headslow motion scenebrawlsecretbookliebeersecond partbeddead bodyinterrogationneighborhandcuffsrevolversurvivalflashlightambushwomanmontagebridgetoiletstabbed in the chestmapaccidentfishdinnerexploding cardrivingno opening creditsbirdradiodisarming someonedrawingdouble crossspaceshipcreaturenews reportgunshotargumentcharacter repeating someone else's dialoguedangerkeyattackreadingtough girllightningmanipulationscarstalkingthreatpigsuspiciondie hard scenariothreatened with a knifedirectorial debutufoarsonstrong female characterpickup truckanswering machineburned aliverevelationspearheroinebeer drinkingsociopathbarncaptivebeardspacecraftwatching a moviemagazinevideotapeeccentricladderstrong female leadpuzzletorchend of the worldschizophreniasocial commentarybroken legfemale warriorgas maskwatching televisioncamera shot of feetredneckwhiskeyalien invasionbarefootbraverycynicismconfrontationnew orleans louisianadeath threattitle appears in writingescape attemptscissorscigarette lighterpedophileaerial shotdisfigurementbarefoot femalebroken armduct tapeburned to deathgunfiresmokemoral dilemmavodkaclose up of eyesmolotov cocktailminimal castlouisianadead animalmisogynistscene before opening creditshuman monstermetaphorcrutchesdvdwalletblackoutjukeboxacidcamera shot of bare feetdisposing of a dead bodyvacuum cleanerfarmhousebunkerearringfish tankburnt facegoldfishmind gamecornfieldone linerbaseball captentaclefemale herohead injuryoffscreen killingheld captivelocked doorvhsgasorchestral music scorealien contactcar radiohitchcockianoverhead camera shotchild molesterboard gameexploding shipdistrustsubterraneanwatching a videoradio newssole survivorimprovised weaponschizophrenicdriving at nightbreaking a bottle over someone's headvideo cassetteleg injurysecret roomarm slingcat and mousevinyldeeply disturbed personcontaminationkeysdoomsdayreference to santa clausdinner tablerunning for your lifepsychological manipulationconspiracy theoristcar keyssnorricamhazmat suitpadlockabandoned carhidden truthjigsaw puzzlesingle set productionleg bracepoison gasambiguitybeer bottlebomb shelterham radiovhs tapestreet in titleanti villainreference to paris franceaddress as titlewater bottlebiohazardunconsciousyelling for helpword gamematcheswatching a movie on tvair ventsurvivalisthandcuffed to a pipesmart phonefeature film directorial debutintravenousstitchesbox cutterliquid nitrogenshower curtainunderground bunkernight drivingcharadesfalloutdreadmonopolytoolboxchemical weaponslocked roomclaustrophobicchemical weaponamateur radioairlockmatchbookdead pigface burncontainmentinjured legreading a magazineargument between couplematchboxdown blouseemergency broadcast systemself sufficiencyfallout sheltershort term memory lossfashion designstitching a woundmatchstickreference to al qaedaunidentified flying objectwhiskey bottleanimal carcassbus ticketelectrical fireshort term memoryparanoid schizophrenicacid burnex navygas attackopening creditssingle settingbaton rouge louisianaforehead cutfrancophileman shoutingwatching a video on tvcar keymonopoly gamethreaten to killegg timerinjured womanplaying a gamepain medicationplaying a board gamereading magazinewhite lightiv linepuzzle piecereference to houston texasrunning from dangerwoman using crutches55 gallon drumshared universe (See All) |
When Ruby Baker's parents are killed in a car accident, she and her brother, Rhett, must travel to Malibu, to live with Terrence and Erin Glass, their former neighbors. At first, all seems well. Ruby is making new friends at school and Rhett is getting more video games and flashy toys than he's ever β¦ had in his life. When Ruby speaks to her family's estate lawyer, he tells her that her parents have left Rhett and her $4 million. Suddenly, Ruby begins to notice odd behavior from Terry and Erin. (Read More)
Subgenre: | suspensepsycho thriller |
Themes: | adoptiondrugsmurderdeathfriendshipsuicidedrinkingdrunkennessfuneraldeath of fatherdeath of motherdrug usewealthcheatinginheritance β¦murder of a police officerclaustrophobia (See All) |
Mood: | nightmarerainhigh school |
Locations: | restaurantschoolchurchswimming poolcarcemeterypolice cartruckschool teachercar explosiontruck accident |
Characters: | teenage boyboydoctorfather son relationshipfamily relationshipspolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipteenage girlfemale protagonistgirlpolice officer β¦policemanpriestlawyermaiduncle nephew relationshipuncle niece relationship (See All) |
Story: | caregiverbroken glasstensionscreaminghousestabbed to deathcar crashwatching tvcar accidentcorpsedreamcryingknifebloodgun β¦cigarette smokingexplosioncomputerdrinkbikinitearsdead bodycafeclassroomswimmingcleavageorphanflashlightbracaliforniamansionstabbinginternetchild abusedrivingdrawinghit by a cargraveyardgraveargumentdrug addictdebtlightninginjectionhigh school studentfilm within a filmloss of fathersuspicionloss of motherclassreference to william shakespearetrusthypodermic needlemachetefaintingcaptiveloss of loved onewatching a moviearchitecthome moviescamdrug overdosemovie theatreswitchbladejunkietheatre audiencee mailsocial workerdeath of loved onereckless drivingnintendo 64flat tiremenstruationtombstonedrunk drivingpopcornloanglassloan sharkguardianreference to shakespeare's hamletbmwcruisingmorphineloss of parentsvideo cassetteplagiarismcar wreckapple computerdriving lessondiabeticillegal drugseulogydead parentsperilinsulinshooting uplife insurancetrust fundseat beltgourmetsocial servicesunlikely criminalreference to meryl streepcheating on a testelectric drillbrake failurecar hit by a trucksaablegal guardianglass housestepfamilycar over a cliffferrari testarossadeviousnessmulholland driveradio producerdriver's educationsan bernardino californiaaol (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | independent filmcult filmsupernaturalpsycho thrillerstop motion animationamerican horror |
Themes: | insanitymurderdeathghostfuneralmonsterpsychopathsupernatural powersadismevil |
Mood: | nightmaregoreslasher |
Locations: | barchurchcemeteryschool boy |
Characters: | killersingle motherdoctorteenagerfather daughter relationshipmother daughter relationshipserial killernursetough guylittle girlvillainterrorself mutilationslasher killeralcoholic father β¦serial murdererevil nurse (See All) |
Period: | 1980s |
Story: | dream sequencefootstepsjump scaredruggedmurdererbasementisolationscreamingsuicide attemptstabbed to deathrescuecorpsedreamfemale nudityviolence β¦number in titlesequelbondagebare chested malecigarette smokingsurprise endingfiredigit in titleblood splatterslow motion scenethongfalling from heightbedrock musicbathroomnumbered sequeldemondecapitationfoot chasenewspaperstabbingdeath of friendimpalementstabbed in the chestnunradiochild in periltonguethird partcharacter repeating someone else's dialoguestabbed in the backpuppetpay phonedollevil manskeletoncharacter says i love youkillingundeadsplattermaniacfalling down stairsteen angstelectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathbutcherhypnosisstairsstabbed in the legschool uniformdead childjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokepsycho killerserial murderpsychopathic killerbad guymadmanalleyreturning character killed offohioevil spiritabandoned househomicidal maniacstabbed in the armslashinggroup therapyboy with glassesburnt facebody in a trunkscalpelone linerwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsmurder spreevillain not really dead clicheghoulsolitary confinementbreaking a mirrorbutcherysleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girllong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All) |
A young man is released from prison after many years and given a new identity in a new town. Aided by a supervisor who becomes like a father to him he finds a job and friends and hesitantly starts a relationship with a compassionate girl. But the secret of the heinous crime he committed as a boy wei β¦ghs down on him, and he learns that it is not so easy to escape your past. (Read More)
Subgenre: | coming of age |
Themes: | guiltescapejealousydrugsmurderdeathlovefriendshipsuiciderapeprisondrinkingfeardrunkennessdance β¦heroincestparanoiadepressiondrug usedysfunctional familycancerredemptiondatingillnessabusebullyingchildhooddyingforgivenessregretdying mother (See All) |
Mood: | nightmare |
Locations: | bathtubbarbeachrestauranttrainschoolcemeterybusnightclubwatertaxicourtroomrooftopcar theftsex in a bathtub |
Characters: | boyfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipbrother brother relationshipteachergirlstudentpolicemandancerphotographerlawyerlittle girl β¦bullywaitresssecretaryuncle nephew relationship (See All) |
Story: | dream sequenceyoungmurdererscreamscreamingfishingcar crashbare buttwatching tvrescuecar accidentcryingknifefemale nudityviolence β¦based on novelbloodmale nudityflashbackbare chested malesex scenekissfightdancingphotographpartybased on true storytelephone callcell phonebeatingunderwearmirrorface slappunched in the facecameradrinkcondomundressingsecretletterliebeertearsbirthdaybedcafejailhallucinationvoyeurclassroomrivercriminalreporternewspaperbraambulancefishchild abuseapologytrialdrawingbirthday partyvangraveyardold womanconfessionprologuefired from the jobliarhangingcourtgiftthreatdatewitnesslaptopex convictclasssleepingpubnewspaper headlinehateapplausetv newsidentityhuggingkilling an animalhead buttwarehouseloss of virginityfriendship between mensexual abusevandalismmale bondingclubfalse identitysocial commentaryembarrassmentpromiseremote controlhaunted by the pastnicknameshopliftinginnocenceshoessurveillance camerakickingtaking a pictureco workerfather figurefirst kissamusement parkschool uniformpridefriendship between boysmurder of a childbounty hunterpierpublic humiliationrelease from prisonmoral dilemmaadolescentsaving a lifenew jobporn magazinegatebirthday presentsneakersmen's bathroomfirst datefake identitytowerdvdestatewalletbully comeuppanceroller coasterdiggingmale rapelandladywormecstasytrain trackstrain ridebreast cancerrehabilitationsecond chancefather son estrangementparolegravestonecarouselestrangementtabloidreference to the virgin maryshared bathhoodiemerry go rounddelivery manexposechild rapedressingtrespassingfleeingleg injurymcdonald's restaurantsurrogate fatherhappy birthdayhooded figurerascaltrain conductorsaying goodbyemedia frenzynew identitychild's drawingchild murdererfollowingparole officerboardwalkchild murders a childeellimpingname changecuttingmanchestersocial realismbountycuddlingsneaking outwatching a movie on tvwatching news on tvdishonestynewsstandsecret revealedsurrogate sonfootbridgebox cutterused condomearthwormdangerous friendamusement park ridedancing alonebirmingham englandlagerfirst day at worknottingham englandalecrying during sexsaying i love younew shoesrape of girlthrowing a bottletrain ticketviolent youthbrother brother incestreference to steven seagalreference to jean claude van dammebeach chairreference to don juanthank you note (See All) |
As a toxin begins to turn the residents of Ogden Marsh, Iowa into violent psychopaths, sheriff David Dutton tries to make sense of the situation while he, his wife, and two other unaffected townspeople band together in a fight for survival.
Subgenre: | cult filmsurvival horrordisaster film |
Themes: | insanityescapemurderdeathfriendshiprevengepregnancymilitarydeath of fatherexecutionself sacrificehuntingmurder of a police officermurder of familyghost town |
Mood: | gorehigh schoolambiguous endinghorror movie remake |
Locations: | rural settinglakeswimming poolhelicoptersmall townboatbusdesertpolice stationfarmpolice cartruckgas stationschool buscar explosion β¦fire truckhumveetruck accidentcountry doctorcity on fire (See All) |
Characters: | doctorfather son relationshipteenagerfamily relationshipshusband wife relationshipmother son relationshipboyfriend girlfriend relationshipzombiesoldiersecretarysheriffmayor |
Story: | hand over mouthhiding in a closetcatatonic statecatatoniastabbed to deathbound and gaggedrescueshotguncar accidentcorpseknifeviolencebloodbare chested malefight β¦explosionsurprise endingpistolfirecell phoneshootoutshot to deathblood splattermachine gunshot in the chestface slapremakeshot in the headpunched in the facecomputerrifleheld at gunpointrevolvershot in the backf wordsurvivalstrangulationmassacreambulancedeath of friendarmyimpalementdinerstabbed in the chesttied to a chairexploding carno opening creditschild in perilcoffeeshot in the foreheadon the runperson on firefugitivecover uptankscene during end creditsfarmerdeath of husbandhandgunarsonchild murderriotdiseasevirusbarnjail cellwalkie talkiehuntermorguenosebleedgenocidegas maskpump action shotgunu.s. armystabbed in the throatchaosgash in the facepolice officer shotcigarette lighterswampassault rifleconcentration campinfectionautopsyparachuteblood on shirtbulletproof vestgasolinefemale doctormutationburned to deathflat tirefirefightersatelliteshot through a windowdementiastabbed in the handepidemicpolice officer shot in the chestlockerhomicidal maniacplane crashdouble barreled shotguncar washcornfielddeputywhistlingroadblockbaseball gamedeath of boyfriendstabbed in the shoulderquarantinefuneral homeopen endedoverturning carpitchforkiowanuclear explosionhouse on firebaseball fieldmortuarytrancekeystruck stopmushroom cloudcar wreckflame throwerbiological weaponset on firebottled waterhazmat suitcircular sawhigh school principalburning cargovernment coveruphanged womanlaundry drying on clothes lineno cellphone signalmarshamerican midwestchain link fenceweird behaviorinfectious diseasemouth sewn shutmaniacombine harvestergift shopcontamination suiteyes sewn shutatomic explosionsemiautomatic riflestabbed with a pitchforkharvesterdead pilotknife through handfemale physicianpull the plugsatellite imageshadowy figureexposure to radiationfugitive herowheel bootwooden match (See All) |
The pediatrician Alexandre Beck misses his beloved wife Margot Beck, who was brutally murdered eight years ago when he was the prime suspect. When two bodies are found near where the corpse of Margot was dumped, the police reopen the case and Alex becomes suspect again. The mystery increases when Al β¦ex receives an e-mail showing Margot older and alive. (Read More)
Themes: | guiltobsessionescapemurderdeathlovefriendshipsuicidekidnappinginfidelityrapepoliticsadulterydrinkingtorture β¦weddinginvestigationvoyeurismmemoryextramarital affaircorruptiondeath of fatherblackmaildrug usegriefunfaithfulnesssurveillancedeath of wifeforgivenesspolice brutalitymurder investigationpolice corruptionmysterious deathmurder of father (See All) |
Mood: | night |
Locations: | lakeforesthospitalbarrestaurantparis francebusairportelevatorwoodspolice stationpolice carfrancerooftop |
Characters: | killerboydoctorfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipfather daughter relationshipmother daughter relationshipfriendbrother sister relationshipgirlpolice officerserial killer β¦nursedetectivepolicemanphotographerbabylawyerwaitressfrenchamericanpolice chasechildhood friendcoronerfather in law son in law relationshipmother in law son in law relationshipboy girl kiss (See All) |
Story: | tensionhidingtied upmurdererdisappearancemissing personbare buttwatching tvshotguncar accidentcorpsecryingfemale frontal nudityfemale rear nudityfemale nudity β¦violencenuditybased on novelbloodmale nudityflashbackmale frontal nuditymale rear nuditydogbare chested malegunfightfemale full frontal nuditycigarette smokingphotographmale full frontal nuditylesbian kisschaseshowertelephone callcell phonebeatingshot to deathunderwearfoodhorsemirrorface slapslow motion scenepunched in the facecomputercameradrinkarrestundressingsecretshootinglierifletearsrunningdead bodycafejailvoyeurmale pubic hairrevolvertelephoneshot in the backsubjective cameraswimmingcleavagegay slurnewspapervideo cameramansioneatingfemale pubic hairinternetnonlinear timelinefalse accusationapologyman with glassesscantily clad femalecoffinassassinationforeign language adaptationsearchvanlatex glovesflash forwardconfessionparkskinny dippingsmokingbinocularsprologuekeycover upbaseball batfemale full rear nuditylong takegympursuitcountrysidedeath of sonthreathorse ridingsadnessratsuspicionflowerhandguntypewritergraffitiheroinapplausetv newsbow and arrowrevelationinjuryred dresswalkie talkieloss of loved onedrug abuseloss of wifedesperationdriving a carfaked deathstreet lifeclockhomicidepresumed deadpassportretirementcamera shot of feetdivingphoto shoothaunted by the pastinnocencesurveillance cameraplaygroundmourningburglarylesbian coupleautopsye maildeerhighwaycellphonesuspectpolice raidduckbruisenude woman murderedbenchsports cartan linechildhood memoryframed for murderdead dognude swimminganniversaryhandshakedark secretcremationstreet gangrepeated sceneabuse of powerstairwaystreet marketbitternessgun held to headframedtraffic jamfemale lawyermale rapehired killernude girlcigarettefallingscene of the crimeplaying a video gamednastableemergency roominsurancebody bagnaked dead womandocumentmurder of wifemultiple murderhitchcockiancircular staircasedead catanguishwoman undressingchild rapecriminal investigationtreadmillclimbing out a windowfinding a dead bodysurveillance footageintercomtelephone numbertrophy wifecrotch shotapple computerfemale in a showerstun gunhand kissingpocket knifealibistreet kidwife abusesafe deposit boxman undressingpokiesperjurydoor bellwood carvingequestrianransackinghitting a womanphoto studiosidewalk cafeaudio recordingbroken windshieldblood sample911 callwalking a dogwall safeinternet cafewiretapdead body in a car trunki.d.pediatricianbox cutterchildhood lovearm injuryprime suspectinsurance policyhemophiliahorse jumpingplanted evidencewatching a video on a computergarbage dumpsterbreaking a glassbluffingslipping and fallingwife beatingbandstandhorse stableidentifying a dead bodybody in a car trunkhunting accidentparisian outskirtsballisticsstreet riotoff screen suicidecar pileupcomputer storehiding in a dumpsterstate senatorcomputer searchhunting trophymounted deer headautopsy reportflower deliverymidnight swimdna sampledragged by hairheroin userinternal bleedingparc monceau paris (See All) |
After the death of her ill mother in a fire, the young teenager Anna tries to commit suicide and is sent to a mental institution for treatment. Ten months later, Anna still cannot remember what had happened on the night her mother died. Her psychiatric Dr. Silberling, however, discharges her telling β¦ that she has resolved her issues. Her father and successful writer, Steven, brings her back home in an isolated mansion nearby the coast. Anna finds that her mother's former nurse, Rachel Summers, is her stepmother now. Anna meets her beloved sister, Alex, swimming in the sea. She discovers that Steven has not delivered the letters and CDs that Alex had sent to her. As time moves on, Anna is haunted by ghosts and she believes that Rachel killed her mother. Alex and Anna decide to look for evidence to prove that Rachel is the murderer and Anna discovers the truth about the fire in the boat house. (Read More)
Subgenre: | psychological thrillersuspensetragedybased on fairy talepsychological horror |
Themes: | mental illnessobsessionangerescapemurderrevengesurrealismfeardrunkennessfuneralextramarital affairdeath of motherparanoiapanic |
Mood: | nightnightmareneo noirhorror movie remake |
Locations: | bathtubforestbeachcemeterywoodspolice stationoceancampfirenew england |
Characters: | teenage boyteenagerfamily relationshipspolicefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipfemale protagonistnursewritersister sister relationshiplittle girlpsychiatristsheriff |
Period: | 1980s2000syear 1986 |
Story: | younghomemurdererscreaminghousestabbed to deathcandlewatching tvcorpsedreamknifebloodflashbackkissfight β¦photographexplosionpartychasesurprise endingpantiesfireremakeslow motion scenearrestbikinibrawlfalling from heightvibratorbedsex standing uphallucinationislandsubjective cameracleavagestrangulationstabbingmontagedinerfalse accusationno opening creditsfemme fatalenecklaceattempted murderauthordangerkeywidowercharacter's point of view camera shotproduct placementknocked outscarinjectiontragic eventlaptopsuspiciondirectorial debutloss of motherlove interestnewspaper headlinechild murderterminal illnesseavesdroppingsupermarketsyringeburned aliverevelationhypodermic needlegothicheavy rainlooking at oneself in a mirrorsociopathcaught having sexcovered in bloodschizophreniamental institutionhaunted by the pastvisionfalling to deathmental hospitalhit on the headaccidental killingdeath of sisteraerial shotatticlipstickshadowblood on shirtgasolinepierdark pastpassionate kissbruisetank topburned to deathsports carnannymemory lossgothgirl in bra and pantiesmental patientapparitiondinner partyblood stainsplit personalityyoung womanbellbeach houseoffscreen killingpearl necklacefemale villainwoman kills a manbody bagloss of sisterevil womanexploding housetragic pastwoman in a bikinioverhead camera shotbutcher knifemainewhite dresshouse on firedelivery boyclimbing out a windowloss of memorytrail of bloodrepressed memorygrave side ceremonyghost childsmall communityburned bodysick motherchalkboardkeyholelooking through a keyholebroken backtranquilizerunreliable narratorgarbage bagseeing dead peopleboathouseseaside townpushed from heightevil stepmotherfemale sociopathhandprintremake of asian filmwatering canhouse explosionunwanted sexual advancesgas lampwrist cuttingslit wristslarge houseblock and tacklemedical kitremake of korean filmdaughter hates father's girlfriendocean front house (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | psychological thrillerindependent filmcult filmsuspensefairy talepost modern |
Themes: | escapemurderdeathsurrealismkidnappingfearfuneralmonsterfilmmakingdeceptiondeath of fatherbrutalitysupernatural powerparanoiacourage β¦near death experience (See All) |
Mood: | nightmaregoreslasher |
Locations: | wheelchairhospitalswimming poolcarcemeterylos angeles californiawatertrucksinging in a cartruck accident |
Characters: | boyfather son relationshiphusband wife relationshipmother son relationshipfather daughter relationshippolice officerserial killernurseactorpriesthostageactresssecurity guarddirectormaid β¦film directorself referentialcoroner (See All) |
Period: | 1990s |
Story: | hiding in a closetdream sequencescreamingstabbed to deathwidowcar crashvomitingrescueblondecar accidentcorpsedreamknifeviolenceblood β¦sequelinterviewexplosionchasesurprise endingfirecell phoneblood splatterslow motion scenefalling from heightpaintingshowdownsunglassesrunningbeddemonhallucinationtelevisiontelephonegood versus evilfoot chaseambushcaliforniastrangulationmansionstabbingdeath of friendstabbed in the chestsnakebrunetteno opening creditschild in perilhit by a cartonguenews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialogueperson on firecharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineburned aliveelectronic music scorewoundhypodermic needleslow motioninjurybabysitterlifting someone into the airmorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setstabbed in the legfilm settitle at the endalternate realityeye gougingdisfigurementstabbed in the eyefemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectsstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Subgenre: | black comedyteen movieteen horror |
Themes: | guiltescapemurderdeathrevengebetrayalfeardeceptionparanoianear death experience |
Mood: | nightmaregoreslasher |
Locations: | stormhospitalbarrestaurantchurchswimming poolhotelhelicoptercemeterysmall townairplaneboatnightclubairportkitchen β¦singing in a car (See All) |
Characters: | doctorfather son relationshipteenagerboyfriend girlfriend relationshipserial killernursemaidfisherman |
Period: | 1990syear 1988 |
Story: | dream sequencered herringbroken glassscreamingstabbed to deathaxevomitingrescuecar accidentcorpseknifeviolencebloodsequelflashback β¦bare chested malefightdancingchasesurprise endingpistolshowershot to deathblood splatterfistfightshot in the chestpunched in the facebikinibrawlshowdownsecond partmarijuanahallucinationislandrevolvercleavagesurvivalambushdeath of frienddrug dealerimpalementstabbed in the chestfalse accusationno opening creditsscantily clad femaleroommatebartenderattempted murdercharacter repeating someone else's dialoguestabbed in the backpay phonevacationrace against timecollege studentlightninggymthreatened with a knifefireplacespearheavy rainlooking at oneself in a mirrorlifting someone into the airkicked in the stomachpart of trilogyinterracial friendshippresumed deadhaunted by the pastblood on facestabbed in the throatpower outagepunched in the stomachkaraoketitle appears in writingstabbed in the headstabbed in the legaccidental killingatticrainstormpierlens flarecharacters killed one by onesequel to cult favoritevoodoofemale in showermannequinengagement ringtombmarijuana jointyellingstabbed in the handconfessionalcomic reliefstonerradio stationhurricaneresortgreenhousedance cluboffscreen killingman punching a womanman in swimsuitjockhanged mandeath of boyfriendpawnshophiding under a bedfourth of julyseason in titlefemale bartenderreference to richard nixonstupid victimvillain not really dead clichetoothbrushhookarm slingno endingfalling through the floorpost traumatic stresshooded figurestrobe lightwriting in bloodstabbed in the foothotel managerstabbed in the sidefilicidejumping on a bedsecond in trilogybahamassequel to cult filmspit takesparklerdark and stormy nightfear of flyingseasicknesswhite male pretending to be blackfalling down a hillhook for handtanning beddouble impalementstabbed through the chinstranded on an islandu.s. coast guardfalling through a rooftop windowreference to bob marleyreference to freddy kruegersleeping in classboatmanhook for a handreference to jason voorheesstabbed through the neck (See All) |
The twenty-one year-old Timothy "Tim" Allen Russell is discharged from a mental institution by his psychiatric Dr. Shawn Graham completely healed from a childhood trauma where his father purportedly tortured and killed his mother before being killed himself by Tim. His sister Kaylie welcomes him in β¦the parking area and brings him home. Then she tells that they need to destroy an ancient mirror that she has found through working at an auction house. She then steals the mirror and the reluctant Tim follows his sister and has fragmented recollections from their childhood, going back to when his father Alan buys a mirror for the home office of their new family home. Kaylie and Tim see a woman with their father in his office and the behaviors of Alan and Marie change, ending in a family tragedy. Kaylie blames the mirror and now she wants to destroy it with Tim. Will they succeed? (Read More)
Subgenre: | supernaturalparanormalparanormal phenomenaghost storysupernatural horror |
Themes: | insanityobsessionescapemurderdeathsuicideghostadulteryinvestigationdeceptiondeath of fathersupernatural powerdeath of motherdysfunctional familytrauma β¦childhood traumamysterious death (See All) |
Mood: | nightmare |
Locations: | hospitalpolice car |
Characters: | boyfamily relationshipshusband wife relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistgirlpolice officerpolicemanalcoholicpsychiatristself mutilationfiance fiancee relationship β¦colleague colleague relationshipcrying girlcrying boyghost in mirrorghost in a mirror (See All) |
Period: | year 2002 |
Story: | home officewoman in a bathtubdream sequencepsychotronic filmalarmlanterndelusionhometherapisthidingscreamhousestabbed to deathwatching tvcrying β¦one word titleviolencebloodflashbackdogbare chested malegunfightphotographchasesurprise endingtelephone callcell phonemirrorface slapremakecameraarrestshootingbirthdayhallucinationhandcuffsrevolverfoot chaseorphanflashlightstrangulationvideo cameraaccidentapologyanimaltalking to the cameragunshotargumentcursepossessionstatuedomestic violencescarloss of fatherreunionloss of motherhaunted houseredheadtherapystrong female charactersisterexperimenteavesdroppingnipples visible through clothinglooking at oneself in a mirrortold in flashbackwatching a moviecrying womanaccidental deathvisitcheating husbandcrying manchokingmental institutionpromiseresearchblood on facestabbed in the neckhousewifemental hospitalsculpturehit on the headaccidental killingdeath of sisterabusive fatherlooking at self in mirrorpuppyasylumchainalarm clockabusive husbandchildhood memoryshot multiple timesauctionplantunfaithful husbandmale objectificationfianceemental patientbarking dogillusionrepeated scenegolf clubvacuum cleaneranimal crueltybroken mirrorhearing voicesartifactlocked doorbased on short filmmoving inloss of sisterpsychiatric hospitalcrying femalemysterious womanoverhead camera shotiphonewatching a videospitting bloodtoy gunwoman slaps a mandog attackfeet on tablehusband murders wifebreaking a mirrorglowing eyesgrindhouse filmpointing a gun at someonescreaming womantear on cheekframed photographabusive mothercaged animalcrying malejumping out a windowthreatened with a gunhysterical womanflickering lightbad dreammental asylumnew housearchival photographfiancesecretly observingskepticismhand injurymarital crisisoverheard conversationlocked ingolden retrieverhysterical outbursttimerbloody mouthchild murdererblood on handscomputer programmertalking to an animalwoman hits a mancrime scene photographdog biteadulterous husbandson murders fatheranchorcaught cheatingtalking to a dogcheating on wifebloody handsingle locationdrinking wineband aidyear 1955private investigationhit with a golf clubblood on mouthlightbulbmagical mirrorchained to a wallabusive parentmysterious eventstrong female protagonistblood on wallchild's bedroommirror does not reflect realitypossessed womanrepeated scene from a different perspectiveanimal bitedead body in a bathtubblood on handhole in the walleating an applepacking a suitcasepossessed mansleeper holdloading a gunmale female fightsleeping shirtlesswatching a cartoon on tvbitten by a dogtelephone terrordragging someoneviolent manescape out a windowfemale alcoholiclabrador retrievermentally unstable womanspilled drinkdeath by stabbingbreaking a platepsychiatric evaluationabusive womanapple macintosh computergun pointed at faceviolent womanbrother sister reunionchained to wallcracked mirrorcursed objectchained womanvacuum cleaningyear 1864attacked by dogbarbellglowing eyeson hits fatherbroken platetraumatic memoryescape by the windowemotionally unstable womanhandcuffed mansitting on the floorsleeping in underwearvertigo shotbiting fingernailsfinger injuryhusband wife fightparanormal researchwoman wearing a negligeebottle of waterbrother kills sisterco worker co worker relationshipemergency callfilmed paranormal eventyear 1904house plantman's best friendreference to william tecumseh shermanscene repeated from alternative perspectiveyellow pagesdelusional manmysterious figureremoving a fingernailsanity hearingviolent fatherwatching a cartoonbroken lampchain around neckchanging a lightbulbcovering someone's mouthdestroying a cellphoneex mental patientmom and dadrelease from a mental institutionscared by a mirror imagescene told from more than one perspectivescreaming boy (See All) |
A man is hypnotized at a party by his sister-in law. He soon has visions and dreams of a ghost of a girl. Trying to avoid this, nearly pushes him to brink of insanity as the ghost wants something from him - to find out how she died. The only way he can get his life back is finding out the truth behi β¦nd her death. The more he digs, the more he lets her in, the shocking truth behind her death puts his whole family in danger. (Read More)
Subgenre: | independent filmsuspense |
Themes: | insanityguiltobsessionmurderdeathlovesuicidekidnappingghostpregnancydrinkingfeardrunkennessfuneralmemory β¦supernatural powerparanoiadrug usedysfunctional familyafterlife (See All) |
Mood: | nightmarerainmurder suicide |
Locations: | bathtubcemeterychicago illinois |
Characters: | teenage boyboyfather son relationshipfamily relationshipshusband wife relationshippolicemother son relationshipmother daughter relationshipchildrenteenage girlpolicemansister sister relationshipsuicide by gunshotbrother in law sister in law relationshipsuper hero β¦seeing a ghost (See All) |
Story: | breaking a windowdelusiondisappearancemissing personhousesuicide attemptvomitingwatching tvcorpsecryingknifefemale rear nuditysexbased on novelblood β¦bare chested malegunfightpartyerectionsongwoman on topshot to deathblood splattershot in the chestdrinksecretshootingheld at gunpointbeerdead bodymarijuananeighborhallucinationguitarshot in the backsubjective cameraflashlightbandambulancenonlinear timelinecoffinsearchgraveyardtalking to the cameragraveproduct placementcover upattempted rapesleepinghaunted housepsychicgamebabysitterguitaristamerican footballmovie theatercovered in bloodrailway stationremote controlchild's point of viewblood on faceunderage drinkingshovelhypnosissuperstitionfoglooking at self in mirrorsexual assaultneighborhoodbrainsuffocationearphonesold dark houseremorsemental retardationdigginghearing voicespremonitionhypnotismhearseloss of sisterpsychic powerfeatherwakegropingdeath of grandmotherpillowbagpipesheadachethirstmissing girlpick axestabbed in the footpassenger trainel trainextrasensory perceptionrepressed memoryfax machineorange juicegrave side ceremonyred lightclairvoyanceoraclemissing person postertalking to the deadable to see the deadbaby monitortoolyelling for helppill poppingjackhammercompulsionteeth knocked outdisorientationhard onx ray visiontalking to a ghostshooting selfsafety pinpost hypnotic suggestionjack knifemesmerismblue collar workerblock partystreet partyu haul truckswearing in front of childrenmummified bodyreverse negativebody hidden behind a wall (See All) |
Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.
Subgenre: | cult filmconspiracytragedyasian horror |
Themes: | mental illnessinsanityguiltobsessionjealousydeathlovefriendshipsurrealismsuicidebetrayalghostpoliticsmemorybrutality β¦paranoiacancerredemptionsexualitytheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All) |
Mood: | nightmareraindownward spiral |
Locations: | wheelchairsmall townbuselevatorvillagerooftop |
Characters: | boychildrenfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship |
Story: | dream sequencedockdelusionhomepatienthousecryingviolencef ratednumber in titlebloodinterviewflashbackfightcigarette smoking β¦photographsurprise endingpunctuation in titlehorsemirrorremakelierunningdead bodyhallucinationcolor in titlenewspaperorphanflashlightstabbingmontageaccidentdrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicionhaunted housecult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatdemonstrationloss of loved onedrug abusecommunityhomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitalscissorsbribemedicationblack brasibling rivalrydead childdeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All) |
A regular family - Maria ('Naomi Watts' (qv)), Henry ('Ewan McGregor' (qv)) and their three kids - travel to Thailand to spend Christmas. They get an upgrade to a villa on the coastline. After settling in and exchanging gifts, they go to the pool, like so many other tourists. A perfect paradise vaca β¦tion until a distant noise becomes a roar. There is no time to escape from the tsunami; Maria and her eldest are swept one way, Henry and the youngest another. Who will survive, and what will become of them? (Read More)
Subgenre: | independent filmsuspensetragedydisaster filmdisaster movie |
Themes: | angerescapedeathchristmasfearmemoryparanoiagriefhopecouragenear death experience |
Mood: | nightmarerainambiguous endingtearjerker |
Locations: | hospitalbeachrestaurantswimming poolhotelhelicopterairplanewaterairportseatruckoceanjungleblood in water |
Characters: | little boyteenage boyboydoctorfather son relationshipfamily relationshipshusband wife relationshipmother son relationshiptattoobrother brother relationshipfemale protagonistnursereference to godterrorgerman β¦americanamerican abroadtruck driver (See All) |
Period: | winter2000syear 2004 |
Story: | home videomissing boyfalling into waterlanterntensionscreamscreamingwatching tvrescueblondecorpsecryingfemale frontal nudityfemale nuditytwo word title β¦nuditybloodmale nuditybare breastsflashbackmale rear nuditybare chested malekissphotographsurprise endingbased on true storytelephone calltopless female nuditycell phoneblood splatterfoodurinationslow motion sceneundressingbikinitearsrunningdead bodytelephonesubjective cameraswimmingcleavagesurvivalwinemountaineatingmapfishapologyno opening creditsbirdscantily clad femalechild in perilunderwater scenesearchold womanpaintreecharacter's point of view camera shotvacationrace against timesuitcasetentscarinjectionfemale removes her clotheshairy chesttragic eventreunionflowersleepingstrong female characterholidaypickup trucksurgerydisasteritalianhuggingdestructionwoundhypodermic needleinjurytouristsurvivorswimsuitteddy bearhome moviestrong female leadearthquakepresumed deadwatching televisionpromisebarefootreverse footagefloodwindtelescopesufferingstarbraveryinsectballchristmas eveinfectionaerial shotwedding ringfemale doctorcanenoteholding handsmoral dilemmaseparationsunbathingclose up of eyesasiaenglishman abroadearphoneshistorical fictionchristmas presentdead animalrepeated scenehead woundnudeshipwreck14 year oldcoca colano title at beginningresortnude girlfilm starts with textstretcherfallingbare feetswimming underwaterkindnessbleedingpalm treereading a bookgurneyclimbing a treenatural disasterscarfoverhead camera shotfather son reunionspitting bloodfrenchmantsunamimattressping pongfade to blackwaveleg injuryleg woundoverhead shotorangebeetlecatastrophefloodingmissing fatherreference to santa clausenglishwoman abroadhusband wife reuniondevastationfamily vacationoxygen maskmother son reunionsoutheast asiadead fishmotivationaltidal wavemissing sonstar gazingceiling fancold the temperatureseparation from familythaithree brothersfear of flyingvomiting blood9 year oldlooking through a windowblenderseat belt7 year oldbeach resortsitting in a treeswedename tagmissing husbandmissing wifemissing brothermissing motherwading in waterindian oceanface woundrubbledragging someonenear drowningrapidssnorkelingassumed deadbeach ballbrother brother reunionturbulencesoda popfive year oldone breast exposedantibioticsearch for familyopening creditstorn clothesclothes cut offphuket thailandtangerineboxing daylifting a boy into the airsplashing water on someoneshoulder wound2004 indian ocean earthquake and tsunami73 year oldmissing familypaper lanternred ballswept awayfather son reunitedfloating lanternhole in ceilinglantern festivalthree sons (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their β¦ dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | independent filmcult filmsupernaturaldark fantasyurban fantasy |
Themes: | angerescapemurderdeathrevengesurrealismkidnappingbetrayalpregnancyfeardeceptionextramarital affairbrutalitysupernatural powerdeath of mother β¦paranoiaredemptionpanicapocalypseabortionnear death experiencesupernatural powers (See All) |
Mood: | nightgoredarkness |
Locations: | bathtubtrainswimming poolairplaneelevatorurban settingapartmenttruckrooftoprussiatunnelyachtfire escape |
Characters: | little boysingle motherdoctorfather son relationshipmother son relationshipboyfriend girlfriend relationshipsoldierpolice officerhostagetough guyvampirewarrioraction herowitchrussian β¦pregnant womanself mutilation (See All) |
Period: | 1990s2000s20th century21st centuryyear 1992 |
Story: | woman in a bathtubpsychotronic filmsingle parentscreamingstabbed to deathaxebare buttrescuecorpseknifefemale rear nudityfemale nuditytwo word titleviolencebased on novel β¦bloodflashbackdogbare chested malefightphotographtitle spoken by characterexplosionchasesurprise endingvoice over narrationcell phonebeatingblood splatterhorseslow motion scenepunched in the facebattleswordarrestbrawlshowdownsunglassesneighborsubjective cameradecapitationgood versus evilfoot chaseflashlightsword fightambushconcertbridgearmyimpalementstabbed in the chestsubwayfalse accusationsevered headno opening creditsanti heroone man armydrawingchild in perilfictional wardouble crossfemme fatalenecklacetransformationflash forwardattempted murderlegendcursecharacter repeating someone else's dialoguevirgindangerstabbed in the backprologuecharacter's point of view camera shotmissionrace against timeknocked outtough girllightningopening action scenescene during end creditsdarkfirst partthreatened with a knifesevered armloss of mothereuropedismembermentbattlefieldstylized violencedestinydestructionrevelationlooking at oneself in a mirrorhelmetlifting someone into the airexploding buildingwitchcraftspidernosebleedbuttknightmind controlfollowing someonehonorend of the worldaction heroinefemale warriorguardreverse footagevisionanimated sequencepower outagebutcherprophecystabbed in the headabsent fathermedieval timesairplane crashaerial shottigerfemale doctorstadiumblack magiclightowltelekinesisfast motion scenetelepathycrowmoscow russiawoman in bathtubvodkaspellabandoned buildinginvisibility12 year oldfinal showdownstabbed in the handlocal blockbustersubway stationremorselost lovesecret societystabbed in the armfemale vampireflaskhearing voicesbare chested boypremonitionmeat cleavercrushed headmale protagonistdeath of boyfriendhit with a shovelshape shifterstabbed in the faceimmortalslaughterhouseshapeshiftingeastern europehoodiemind readingimprovised weaponlifting person in airglowing eyesgas explosionregenerationstabbed with scissorsmacehuman becoming an animalsurprise during end creditslight bulbnuclear power plantdrinking bloodpregnant woman murderedsequel mentioned during end creditshand through chestvortexloss of boyfriendprotectorvomiting bloodtime freezesoccer stadiumshape shiftingd box motion codehooded sweatshirttruceblood suckingtooth knocked outx ray visionmajor child roleinanimate object comes to lifebaby dollmodern dayopening creditsnight watchface blown off (See All) |
Malcom Crowe ('Bruce Willis' (qv))is a child psychologist who receives an award on the same night that he is visited by a very unhappy ex-patient. After this encounter, Crowe takes on the task of curing a young boy with the same ills as the ex-patient ('Donnie Wahlberg' (qv)) . This boy "sees dead p β¦eople". Crowe spends a lot of time with the boy much to the dismay of his wife ('Olivia Williams (I)' (qv)). Cole's mom ('Toni Collette' (qv)) is at her wit's end with what to do about her son's increasing problems. Crowe is the boy's only hope. (Read More)
Subgenre: | suspenseconspiracytragedypsycho thrillerparanormal phenomenachrist allegory |
Themes: | obsessionmurderfearfuneralsupernatural powerredemptiontrauma |
Mood: | nightaffection |
Characters: | boyhusband wife relationshipmother son relationshipteacherpsychiatrist |
Story: | young boychild psychologistyoungpsychologistpatientsingle parentwidownumber in titlesurprise endingsecretchild in perilspiritualitypoisontoypsychology β¦compassionmisunderstandinggunshot woundsoulphiladelphia pennsylvaniaspiral staircaseelementary schoolmisfitroad accidentpsychic powerbus ridestutteringwatching a videoenlightenmentschool playprecocious childextrasensory perceptionemaciationwine cellarunderstandingghost childfilicidesanctuarytalking to the deadable to see the deadcold the temperatureseeing dead peoplehanged childthe color redtalking with the deadsixth senseable to hear the deadvcr tapecommunicating with the deadzoloftmunchausen syndrome by proxy (See All) |
U.S. Marshal Carrie Stetko is three days from the end of her tour at an international research station in Antarctica after which she'll resign. An incident from her past haunts her. The continent's first winter storm is coming when a body, wearing no gear, is discovered in the tundra. She investigat β¦es, soon finds more bodies, and must find a motive and a murderer before the storm and her departure. A U.N. agent, Robert Pryce, appears, seemingly out of nowhere, to help. An aging physician about to retire, a nervous mission chief, a downed Soviet plane, and the weather's deadly elements add to the story. Can Carrie trust Pryce and does she still have what it takes? (Read More)
Subgenre: | suspense |
Themes: | angerescapemurdersuicidebetrayalinvestigationcorruptiongreedmurder investigation |
Locations: | winter stormstormsnowairplaneresearch station |
Characters: | doctoraustralianrussianex militarysuicide of villain |
Period: | winter1950s |
Story: | cold weatherdream sequenceweathermurdererisolationcorpseknifeone word titlebloodflashbackbare chested maletitle spoken by charactermale full frontal nuditypartychase β¦surprise endingpistolshowershootoutshot to deathblood splattermachine gunshot in the chestshot in the headslow motion scenepunched in the facefalling from heightheld at gunpointdead bodymarijuanascientistshot in the backsurvivalflashlightbrabanddrug dealerthroat slittingprisonerstabbed in the chestmapradiodouble crossshot in the foreheadtrainingpilotstabbed in the backamerican flagneck breakingsubtitled sceneiceropegolfsyringewalkie talkiebroken legwhiskeydiamondexplosivesevered fingerfight to the deathbribestabbed in the legthrown through a windowairplane crashautopsyaxe murderfemale in showervodkataking a showerburied alivehead woundscene before opening creditsplane crashbroken mirrorcrash landingsaxophonebased on graphic novelwoman in bra and pantiesfall from heightblizzardfinger cut offbody baghit with a shoveldiceantarcticaleg woundthroat cuttrail of bloodsnowstormbandaged handhand injuryfrozen bodyu.s. marshaldeath of partnerhand through chestgeologiststabbedfalling through icebritish flagburied treasurejewelsstreakingfrostbiteyear 1957australian manstitchesfaxcargo planesouth polestitchresearch facilitysnowy landscapefalling into a holesnowplowc 130 herculeshiding behind a doorcanisteraxe in the backjellybeanelbowed in facefrozen corpsegirlie magazinefinger amputationthrown from an airplanegust of windwindybritish actress playing american characterfalling from the skyice axeaurora australisoni presspolar research station (See All) |
Renai is interrogated by a police detective about the supernatural events in the house. While the police investigate the house, the Lambert family temporarily moves to the old house of Lorraine Lambert. Renai is haunted by a woman in white and Josh has a strange behavior at home. Meanwhile Lorraine β¦seeks out Elise's partners Specs and Tucker expecting to find answers. (Read More)
Subgenre: | supernatural |
Themes: | murdersuicideghostinvestigationpsychopath |
Mood: | nightmare |
Locations: | hospitalpolice station |
Characters: | boyfather son relationshiphusband wife relationshipmother son relationshipbrother brother relationshipserial killerbabypolice detectivegrandmother grandson relationship |
Period: | 1980syear 1986 |
Story: | hit with a hammerhiding in a closetstartledwhisperinglanternhomebasementhousebound and gaggedcorpseknifenumber in titlesequelflashbackphotograph β¦surprise endingface slappunched in the facesecond partinterrogationpianodemonfoot chaseflashlightstrangulationvideo cameranonlinear timelinechild abusechild in perilcharacter repeating someone else's dialoguepossessionevil manknocked outhaunted housecross dressingmaniacsyringescene during opening creditsgas maskstabbed in the legthrown through a windowtitle at the endfemale doctordark pastnewspaper clippingmannequinhit with a baseball batclose up of eyesbad guyfire extinguisherapparitiontaserhuman monsterseanceevil spiritpiano playinghomicidal maniacyoung version of charactermediumvhsdicebreaking through a doorvcrabusive mothertoothhidden roomdollhousered lightgrand pianovhs tapehit with a frying panwearing a sound wireout of body experiencetranquilizerbaby monitorlucid dreamabused childabandoned hospitalrocking horsemetronomeimposterbookcasebone sawbreaking through a wallother worldtea kettleattacked with a knifetooth ripped outboy dressed as a girlfalling chandelierwooden chestsurgical tooltalking dollpipe wrenchmoving furniturestabbed with a needletooth falling outbarricading a doorroshambo (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β¦ear. (Read More)
Subgenre: | cult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie |
Themes: | escapemurderdeathfriendshiprevengesurrealismkidnappingghostfearmonstervoyeurismpsychopathbrutalitysupernatural powerparanoia β¦sadismevilpanicmysterious deathshower murder (See All) |
Mood: | nightmaregorerainhigh schoolslasherdarknesspoetic justice |
Locations: | stormbarschoolswimming poolsmall townbusdesertbaseballgay barschool busbus driverabandoned factoryschool bus driver |
Characters: | killerteenage boyboyfather son relationshipteenagerfamily relationshipshusband wife relationshiphomosexualmother son relationshipfather daughter relationshipmother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationship β¦teenage girlteachergirlserial killerstudentpolicemanlittle girlvillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All) |
Period: | 1980syear 1985 |
Story: | dream sequencepsychotronic filmbreaking a windowdamsel in distressmurdererbasementscreamscreaminghousestabbed to deathbare buttwatching tvshotgundreamcrying β¦knifeviolencenuditycharacter name in titlenumber in titlebloodmale nuditysequelmale rear nuditybondagedogbare chested malefightcigarette smokingpartychasesurprise endingshowertelephone callfiredigit in titleunderwearblood splatterface slapslow motion sceneundressingbikinisunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed in the chestsnakeapologybirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backlocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodyratcharacter says i love youthreatened with a knifeclasshaunted houseobscene finger gesturewhippingbare chested male bondagenewspaper headlineredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampageseriesblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All) |