Best popular movies like Sideworld: Damnation Village:

Do you need specific genre & keyword selection to find films similar to Sideworld: Damnation Village?
<< FIND THEM HERE! >>

Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sideworld: Damnation Village (2022)

Director George Popov explores the dark and disturbing secrets behind three of England's most haunted villages.

Subgenre:
folk horrorparanormalsupernatural
Themes:
mysterious deathghostdeath
Mood:
mysterious
Locations:
townwoodsvillage
Characters:
children
Story:
newspaper headlinehistory classeffect2015familiarregionalcriminalstalkingbackgroundspectredeephighwaymanviolentdivelocal β€¦storiespresentationheadlinehandsplayingsoundtrackfolktheoryspiritscreepyghostshauntedoutbreakinspirationkillhistoricaldiscussionlow budgetseriesclassreadingkeynarrationnewspaperrunning (See All)

The Amityville Horror (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Amityville Horror (2005)

In December 1975, George and Kathy Lutz along with their three children move into an elegant Long Island house. What they don't know is that the house was the site of a horrific mass murder a year before. They decide to keep the house and attempt to keep the horror in the past, but are now haunted b β€¦y a murderous presence. This is until, George starts to behave weirdly and their daughter, Chelsea starts to see people. What follows is 28 days of sheer, unbridled terror for the family with demonic visions of the dead. Based on the true story of George and Kathy Lutz, The Amityville Horror remains one of the most horrifying haunted house stories ever told - because it actually happened. (Read More)

Subgenre:
ghost story
Themes:
ghostdeathmurdersuicidetortureparanoiainsanitymurder of family
Mood:
nightmarearchive footagehorror movie remake
Locations:
restaurantbathtubkitchenrooftop
Characters:
childrenfamily relationshipshusband wife relationshipmother son relationshipmother daughter relationshipteenage girlteenage boypriestlittle girllittle boycatholic prieststepfather stepdaughter relationshipstepfather stepson relationship
Period:
1970s
Story:
newspaper headlinestorieshauntedsexbased on novelblooddogbare chested malegunchasepantiesblood splatterurinationremakeshot in the head β€¦shotgunslow motion scenefalling from heightvomitingrifleplace name in titlemarijuanashot in the backaxethroat slittingsuicide attemptchild in perilshot in the foreheadattempted murderpossessionscreambasementunderwaterhaunted housechild murderoccultpot smokingkilling an animalbabysittercovered in bloodteddy bearfamily dinneraxe murderdemonic possessionalarm clockdead dogdead girlreal estate agentbonghead woundmotorboatpotbullet woundmoving inrealtorholy waterbloody body of a childchild killedtortured to deathtorture chamberfamily in dangerbased on supposedly true storyabusive stepfatherable to see the deadwood choppinglocked in a closetchild shotmeat hookburial groundchild shot in the headboathousechild knocked unconsciouslakesidehole in the wallhanged childvillage name in titlebackwardsdeath of a petinsect attackwalking on a roofancient burial groundrefrigerator magnetmonster in mirrorupside down crucifix (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friend Request (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friend Request (2016)

Popular college student Laura (Alycia Debnam-Carey) has tons of friends, both on Facebook and IRL. She graciously accepts social outcast Marina's (Liesl Ahlers) online friend request, until Marina crosses the line and Laura unfriends her. To everyone's shock, Marina takes her own life in a ritual me β€¦ant to torment Laura, which appears in a video posted on Laura's profile. Even though it wasn't Laura who posted the video, or other creepy content that begins appearing on her page, her Facebook friend count begins to dwindle as a result. When her real-life friends start dying mysterious, cruel deaths, Laura must figure out how to break the deadly curse before it's too late. (Read More)

Subgenre:
paranormalvideo
Themes:
ghostdeathfriendshiprevengesuicidebetrayalfearfunerallonelinesssupernatural powerbullyingunrequited lovepanicpolice investigationrape and revenge β€¦end of friendship (See All)
Mood:
mysterious
Locations:
hospitalforestelevator
Characters:
mother daughter relationshipfriendfemale protagonistmotherwitchdaughtergirlfriendself immolationex friend
Story:
creepygunknifemirrorcomputerbirthdaycollegedemonstabbingstabbed to deathinternethit by a carbirthday partyritualcurse β€¦college studenthangingbasementhauntingoccultspiritloyaltyjoggingstabbed in the stomachwitchcraftorphanagestabbed in the neckone dayboyfriendlonerpsychoticlaptop computerreference to facebookcafeteriasocial mediafacebooksocialhoodiepsychotronic filmhouse fireyoung adultmental disordercollege lifesocial networksocial outcastwaspgeneration yvengeful ghostmillennialvisualhorror filmdistortiontaggingshooting oneself in the headdormcross necklaceinternet addictionpulling hair outwasp nestshooting oneselflearning to walk (See All)

The Grudge 2 (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Grudge 2 (2006)

In Pasadena, Mrs. Davis sends her daughter Aubrey Davis to Tokyo to bring her sister Karen Davis, who is interned in a hospital after surviving a fire, back to the USA. After their meeting, Karen dies and Aubrey decides to investigate what happened to her and gets herself trapped in the same situati β€¦on, being chased by the ghost of the house. Meanwhile in Tokyo, the three high school mates Allison, Vanessa and Miyuki visit the famous haunted house and are also chased by the ghost. In Chicago, Trish moves to the apartment of her boyfriend Bill, who lives with his children, the teenager Lacey and boy Jake. On the next door, weird things happen with their neighbor. (Read More)

Subgenre:
ghost story
Themes:
mysterious deathghostdeathmurderrevengefearangersupernatural power
Mood:
high school
Locations:
villagehospitaltrainbathtubrural settingjapancitychicago illinois
Characters:
childrenfamily relationshipshusband wife relationshipfather son relationshipmother daughter relationshipteenage girlteacherpolice officernursestudentlittle boyterrorstepmother stepson relationship
Story:
hauntednumber in titlesequelflashbackphotographsurprise endingpantiestelephone callcell phonecorpsemirrorurinationwatching tvcatcondom β€¦falling from heightsecond partclassroomgood versus eviljournalistbraritualdrowningcursediaryneck breakingschoolgirlhaunted housepsychicspiritbreaking and enteringgothicphone boothdead womantokyo japanpastdead childdeath of sisterdead woman with eyes opennewspaper clippinggothreturning character killed offphysicianaltered version of studio logoloss of sisterkiller childdarkroomvideo cassettewoman's neck brokenevil childdead woman on groundinter culturalremake by original directordefenestrationpasadena californiawraithurinating in fearfamily violencefemale urinatingestranged family memberrecords (See All)

The Woman In Black (2012) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Woman In Black (2012)

In London, solicitor Arthur Kipps still grieves the death of his beloved wife Stella on the delivery of their son Joseph four years ago. His employer gives him a last chance to keep his job, and he is assigned to travel to the remote village of Cryphin Gifford to examine the documentation of the Eel β€¦ Marsh House that belonged to the recently deceased Mrs. Drablow. Arthur befriends Daily on the train and the man offers a ride to him to the Gifford Arms inn. Arthur has a cold reception and the owner of the inn tells that he did not receive the request of reservation and there is no available room. The next morning, Arthur meets solicitor Jerome who advises him to return to London. However, Arthur goes to the isolated manor and soon he finds that Eel Marsh House is haunted by the vengeful ghost of a woman dressed in black. He also learns that the woman lost her son drowned in the marsh and she seeks revenge, taking the children of the scared locals. (Read More)

Subgenre:
suspensegothic horror
Themes:
ghostdeathmurderfriendshiprevengesuicidebetrayaldrinkingfearsupernatural powergriefadoptiondeath of wifevengeanceforgiveness β€¦madnessdeath of daughterafterlifedeath in childbirth (See All)
Mood:
rainnightmarehorror movie remake
Locations:
woodsvillagebeachtrainforestcarbathtublondon englandrural settingengland
Characters:
childrenhusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriendboygirlsister sister relationshipreference to godlittle girllittle boysingle fathersuicide by hanging β€¦baby boyghost girldeath of boysuicide by drowningself immolationdeath of girlsuicide by jumping out a window (See All)
Period:
1910s
Story:
hauntedkeynewspaperrunningbased on novelbloodviolenceflashbackdogphotographfirecryingcorpsefoodmirror β€¦rescueslow motion scenedrinksecretletterpaintingtearsdead bodycolor in titletelephonecandleaxemansioneatingwidowhouseaccidentdrivingchildbirdcoffindrawingsearchjourneygraveyarddrowningflash forwardgravecurseprologuescreamingwidowerperson on firedolldeath of childskeletonhangingtragic eventcrossdeath of sonbasementhauntingreunionsuspicionloss of mothersleepinghaunted housesingle parentfireplacelooking at oneself in a mirrorcrucifixtoyloss of wifeeccentriclossrailway stationclockthunderloss of sonwizardlostthunderstormsuperstitiondead childatticfogmurder of a childvoice over letterlanternbriefcasehorse and carriageparrotburned to deathchloroformsmokenannycrowmudtombbarking dogapparitionold dark housemental breakdownlast will and testamentstairwayestatelooking out a windowseagullknocking on a doorhearing voicespocket watchloss of childlocked doorbereavementtelegramravenmusic boxreading a newspaperinndead wifespitting bloodcoughing bloodhorse and wagonblack dresshouse on firelockethatchettrancecryptfootprintoverhead shotspiritualismrocking chairhit by a trainjumping out a windowportrait paintinglaw firmpassenger trainmausoleumfamily photographchild's drawingmanor housewriting on a wallbreaking down a doorchihuahuaoil lampinnkeeperfemale ghostghost childheadstonenurserytalking to the deaddead sonhanged by the neckbelief in heavensolicitorpeepholeblood vomitingconstablemarshchild suicidehearing noisescaged birddistorted voicewallpapertidewaving goodbyecovered in mudenglish countrysideopening a windowsandcastlebirthday carddead daughterbird in a cagehandwritten letterdeath certificatefootstepshandprintreunited familyterrierwind up toyspecterwoman in blackbird's nestwalking on train tracksdilapidated housestuck in mudengravinghorse drawn wagonbaby birdtoy bearkilled by a traindoor keywater faucettoy rabbitbroken dollgenuflectingpacing the floorwash basintoy monkeyfour year oldreflection in a windowshillingscream off camerazoetropefictional villagelyecarriage accidentthreat of job loss (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Autopsy Of Jane Doe (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Autopsy Of Jane Doe (2016)

Cox and Hirsch play father and son coroners who receive a mysterious homicide victim with no apparent cause of death. As they attempt to identify the beautiful young "Jane Doe," they discover increasingly bizarre clues that hold the key to her terrifying secrets.

Subgenre:
supernaturalsupernatural horror
Themes:
mysterious deathdeathmurderrevengefeartorturebrutalitysupernatural powersadismevilcrueltypanic
Mood:
mysteriousgorenightdarknessone nightblood and gore
Locations:
elevatorpolice carstorm
Characters:
father son relationshippolicezombiepolice officerbiblewitchsherifffathergirlfriendout of control
Story:
keyfemale nuditycharacter name in titlenuditybloodviolencebare breastsfemale frontal nudityfemale full frontal nuditynipplestitle spoken by characterfiretopless female nuditybeating β€¦corpseblood splattercataxeman with glassesradioritualpaindangerdarkkillingundeadsplatterdestructionrevelationmutilationmorguewitchcraftaccidental deathdead womanhomicidecrime scenesufferingsonpower outageescape attemptdisembowelmentautopsyheartsurprisedead mandark pastbruisedead girldark secretblackoutscalpelbellbleedinghallwaynaked dead womanfrightmultiple murdersorceryscareorganeyesloss of controlcorridortoothtortured to deathexaminationmultiple homicideliftsevered tongueevil powerdissectionevil forceaccidental murderbroken anklepower cuteviscerationforces of evilattempted escapekillingstorture victimlungsbroken bonedark forcestormy nightbruiseslungwhite eyesbroken wristmultiple killingforce of evilautopsy roomscar tissuemissing toothforces of darknessgrey eyescause of deathroman numeral (See All)

Grave Encounters (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Grave Encounters (2011)

Lance Preston and the crew of "Grave Encounters", a ghost-hunting reality television show, are shooting an episode inside the abandoned Collingwood Psychiatric Hospital, where unexplained phenomena have been reported for years. All in the name of good television, they voluntarily lock themselves ins β€¦ide the building for the night and begin a paranormal investigation, capturing everything on camera. They quickly realize that the building is more than just haunted - it is alive - and it has no intention of ever letting them leave. They find themselves lost in a labyrinth maze of endless hallways and corridors, terrorized by the ghosts of the former patients. They soon begin to question their own sanity, slipping deeper and deeper into the depths of madness, ultimately discovering the truth behind the hospital's dark past...and taping what turns out to be their final episode. (Read More)

Subgenre:
paranormalcult filmmockumentaryfound footagefake documentaryparanormal phenomenaparanormal investigationghost hunting
Themes:
ghostsupernatural powerinsanity
Locations:
bathtubwheelchairtunnel
Story:
ghostshauntedblooddemonsubjective cameraflashlightvideo cameralooking at the cameratalking to the camerascreamingcharacter's point of view camera shotratfirst parthaunted houseladder β€¦male underwearblood on facemental hospitalfoghandheld cameradead manbriefscharacters killed one by oneman cryingabandoned buildingblood on camera lenswoman cryingnight visionreality showwhite briefsfictional reality showelevator shaftlabyrinthtv hostscreaming in fearghost hunterbreaking down a doorhospital gownsevered tonguedemonicscreaming in horrormanic laughtervomiting bloodblood vomitingparanormal investigatorabandoned hospitalevpfalling down an elevator shaftdemonic spiritelectronic voice phenomenagoing in circlesbloody scratchparanormal investigation teamhospital bracelet (See All)

The Haunting (1963)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Haunting (1963)

Dr. Markway, doing research to prove the existence of ghosts, investigates Hill House, a large, eerie mansion with a lurid history of violent death and insanity. With him are the skeptical young Luke, who stands to inherit the house, the mysterious and clairvoyant Theodora and the insecure Eleanor,  β€¦whose psychic abilities make her feel somehow attuned to whatever spirits inhabit the old mansion. As time goes by it becomes obvious that they have gotten more than they bargained for as the ghostly presence in the house manifests itself in horrific and deadly ways. (Read More)

Subgenre:
suspenseparanormal phenomenasupernatural horrorgothic horror
Themes:
ghostdeathsuicidemarriagelesbianismfearobsessionsupernatural power
Mood:
mysterious
Locations:
new england
Characters:
female protagonistsister sister relationshippsychiatristbibleanthropologist
Period:
1960s1940s19th century20th century1870s
Story:
violentspiritsghostsbased on noveldancingvoice over narrationcar accidentmirrorbookhallucinationalcoholorphanflashlightmansion β€¦houselibraryprologuestatuehangingloss of motherhaunted housepsychicgraffitimaniacexperimentfalling down stairsgothicloss of wifecrushparking garageresearchboston massachusettsbalconygateold dark housespiral staircasepsychic powermagnifying glassnoisepoltergeistvoice over inner thoughtscountry estateharpnurseryremadehorror movie remadeinternal monologuedeliberate crueltyparapsychologycontemporary settingovernight in a haunted househarbinger of deathprivate libraryfeeling one is being watchedcarriage accident (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Thir13en Ghosts (2001) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Thir13en Ghosts (2001)

Arthur and his two children, Kathy and Bobby, inherit his Uncle Cyrus's estate: a glass house that serves as a prison to 12 ghosts. When the family, accompanied by Bobby's Nanny and an attorney, enter the house they find themselves trapped inside an evil machine "designed by the devil and powered by β€¦ the dead" to open the Eye of Hell. Aided by Dennis, a ghost hunter, and his rival Kalina, a ghost rights activist out to set the ghosts free, the group must do what they can to get out of the house alive. (Read More)

Subgenre:
supernaturalb moviesurvival horror
Themes:
ghostdeathmurderrevengesurrealismmoneybetrayalmagicsupernatural powerinheritancebook of magic
Mood:
gorehorror movie remake
Locations:
bathtub
Characters:
childrenfamily relationshipsfather son relationshipfather daughter relationshipbrother sister relationshiplawyerwitchsingle father
Story:
ghostsfemale nuditynumber in titlebloodviolenceexplosionchasepistoldigit in titleblood splatterremakerescueslow motion scenesword β€¦rifleaxeimpalementchild in perildouble crossfemme fataleshot in the foreheadlimousinewidowerbaseball batlaptoploss of motherhaunted housesacrificepsychicdismembermentsplattersingle parenteyeglassesrevelationwhat happened to epiloguetape recorderbabysitterlifting someone into the airloss of wifeeccentricfaked deathmillionairedynamitearrowpipe smokinghit with a baseball batjunkyardlast will and testamentmachinescooterflareartifactnaked dead womancollectorintentionally misspelled titlecut into piecessliced in twoghost hunterghost childbroken backdismembered bodymixed alpha numeric titlesword caneovernight in a haunted houseglass house (See All)

Blair Witch (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Blair Witch (2016)

Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try β€¦ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)

Subgenre:
folk horrorsupernaturalsuspensefound footagevideosurvival horrorpsychological thrillerpsychological horror
Themes:
ghostdeathmurderfriendshipkidnappingbetrayalfearescapedeceptionsupernatural powerparanoiaevilpaniccampingnear death experience
Mood:
gorerainambiguous endingmyth
Locations:
woodsforestsmall townnightclubcampfiretunnel
Characters:
boyfriend girlfriend relationshiphostagewitchself mutilationdeath of girlfriend
Period:
2010s
Story:
runningcharacter name in titlebloodviolencesequeltwo word titletitle spoken by characterchasesurprise endingcell phonecorpseblood splatterrescuefalling from heightvomiting β€¦riverf wordsubjective camerasurvivalflashlightdeath of friendimpalementstabbed to deathstabbed in the chestfalse accusationapologyno opening creditsdouble crosscreaturesearchthird parttreelegendcursedangerscreamingcharacter's point of view camera shotmissing persontentknocked outcollege studentlightningactor shares first name with characterdisappearancebasementsuspicionprofanitysleepingfreeze frameheavy rainloss of friendwalkie talkieoverallsvideotapewristwatchyoutubeinterracial friendshipcrushed to deathbroken legtensionmercilessnessescape attemptblack and white sceneinfectionaerial shotattichandheld camerarainstormcharacters killed one by onetripteleportationtracking deviceyellingminimal castvomitold dark houseabandoned housedronenight visionno title at beginningfilm starts with textcabin in the woodsdeath of boyfriendcamcorderparasitewatching a videosymbolpentagrampsychotronic filmtime loopgrindhouse filmleg injuryno endingbanishmentmarylandbarricadefilm studentcamping triploss of girlfriendshaky camlost in the woodsrebootloss of boyfriendcrawlingvomiting bloodhearing noisesriver crossingcentipedetime paradoxmysterious noiselovecraftianbroken footdark forestno cell phone signalrunning in the darkblair witchcrossing a riveropening creditsbootstrap paradoxsleeping in the foresthouse in the woodsblair witch projectmysterious figure (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
paranormalsupernaturalindependent filmcult filmblack comedydark comedypsycho thrilleramerican horrorindependent horror
Themes:
ghostdeathmurdersurrealismdrugstorturepsychopathsupernatural powerdeath of motherinsanitysadismevilamnesia
Mood:
gorerainhigh schoolnightmareslasherdarkness
Locations:
small townairplaneroad trip
Characters:
childrenfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillervillainterrorself mutilationyounger version of characterdeafnessslasher killerserial murderer β€¦german americanevil father (See All)
Period:
1990s1970s1960s1940s1950s
Story:
creepykillseriesf ratedcharacter name in titlebloodviolencesequelflashbackbare chested maletitle spoken by characterknifefirepunctuation in titletitle directed by female β€¦dreamblood splatterrescueslow motion scenefalling from heightapostrophe in titledemoncriminalsubjective cameragood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murdermaniacfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothpsychovictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotchbutcher3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerdark pastabusive fatherbody countkilling spreepsychoticnewspaper clippingpsycho killerposterhit with a baseball batmarijuana jointserial murdervillain played by lead actorpsychopathic killerbad guymadmanstabbed in the handmolotov cocktailohiohuman monsterchild molestationevil spirithomicidal maniacstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathmurder spreeanimal killinghusband murders wifefairghoulbutcherysleepwalkingsheltercreepglovefalling through the floorchild killedpsycho terrormidwestbroken handchild killerrepressed memorywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendoteenage murdererhit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Haunted House (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Haunted House (2013)

In October 2012 a video footage is found at the home of Malcolm Johnson and the recordings are still unexplained. Past this prologue a story in flashback form unfolds. During the summer of 2012, Malcolm and Kisha move in together and start a happy life. One night Kisha notices a few unexplained phen β€¦omena that convince her their house is haunted by ghosts. To allay her fears Malcom hires a camera crew to film inside the house day and night. A few nights later Malcom and Keisha have sex on camera, despite Keisha's protests at being filmed. Upon reviewing the sex tape the next day, Malcom and Keisha notice a few paranormal phenomena caught on tape. Malcom wants to sell the house but the housing market is slow. Therefore, Malcom decides to hire a psychic to come to the house and investigate. After Kisha confesses to making a deal with the devil for a pair of shoes things start to make sense but it doesn't solve the problems caused by the paranormal phenomena. (Read More)

Subgenre:
paranormalsupernaturalfound footage
Themes:
ghost
Mood:
spoofparody
Locations:
swimming poollos angeles california
Characters:
boyfriend girlfriend relationshippriestyounger version of charactersex with a ghost
Period:
year 2012year 1988
Story:
ghostshauntedfemale nudityflashbackmasturbationmale rear nuditybare chested maleinterracial sexpistolbeatingshot to deathshot in the chesturinationface slap β€¦punched in the facebikinisubjective cameravideo cameracocainehit by a carbirthday partycharacter repeating someone else's dialoguecharacter says i love youpsychicfalling down stairskilling an animalkicked in the stomachflatulencerear entry sexswitchbladetitle at the endhousekeeperdemonic possessionwritten by stardead dogmarijuana jointstuffed animalwebcamnight visionanal rapemale rapehamburgerman punching a womanouija boardwoman in a bikiniwoman slaps a manfemale sitting on a toiletbegins with textwriting in bloodsex on a tabletime stamp (See All)

Friday The 13th (1980) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
independent filmcult filmsuspensepsycho thrillerslasher flickteen moviemurder mysteryteen horroramerican horror
Themes:
mysterious deathdeathmurderrevengefearvoyeurismcorruptionpsychopathbrutalityinsanityhumiliationsadismevilcrueltytrauma
Mood:
gorenightslasherdarknessblood and gore
Locations:
woodscarmotorcycleboatwaterrural settingpolice carlaketruck
Characters:
policeteenagerfriendteenage boypolice officerserial killerpolicemanartistkillermothervillainsheriffterrortruck driverslasher killer β€¦mysterious villainserial murderer (See All)
Period:
1970s1950ssummer
Story:
playingkilllow budgetrunningsexfemale nuditynumber in titlemale nudityviolencebare breastsmale rear nuditybare chested malekissfemale rear nuditynipples β€¦three word titlesurprise endingpantiesbeatingcorpsedigit in titleblood splatterfistfightblondeslow motion scenebikinithongbeerdead bodylow budget filmmarijuanahallucinationvoyeurguitarsubjective cameradecapitationbedroombracandleold manaxemassacrestabbingwomanthroat slittingstabbed to deathdineraccidentsnakecultdream sequenceskinny dippingstrippingdangerprologuescreamingfirst of seriesmoaningdeath of childprankinjectionstalkingdeath of sonmurdererfirst partcabinkissing while having sexkillingteenage sexfreeze framegirl in pantiesmaniacrevelationdesirenipples visible through clothingelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainesspsychoswimsuitgrindhousevictimdead womanfull moonrampagebra and pantiesnew jerseystabbed in the throatobesitymercilessnesspower outagemutebutcherpsychotroniclostthunderstormbathingdisembowelmentsurpriseatticperversiondead manslaughterbody countlens flareaxe murderroomcharacters killed one by onekilling spreearrowdeath of loved onetank toppsychoticpsycho killerphysical abuset shirtjoyserial murderpsychopathic killersexual awakeningbeheadingcar troublemysterious manshortsdead animalhuman monstersummer campcanoeadolescencerepressionsexual perversionhomicidal maniacrestroomfemale psychopathslashingjacketdying mandripping bloodrobeactual animal killedday in titlesummer vacationfemale villainshirtmurder witnessevil womanextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoresexual repressionmenacemurderessmultiple murdergame playingbowboard gameknife murderpillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdermurder spreevillain not really dead clichebutcherygrindhouse filmmurder victimcrime spreecurtaintroubled teenblond boybitingmystery killersweateraxe in the headmultiple homicidemistreatmentpsycho terrorfemale serial killerweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementeast coastaxe murdererbad girlcamp counselorcampfire storygruesomejason voorheesunknown killerbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietcamp vacationunstable teenager (See All)

Gok-seong (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gok-Seong (2016)

In the small village Goksung in South Korea, police officer Jong-Goo investigates bizarre murders caused by a mysterious disease. His partner tells a gossip for him that a Japanese stranger that lives in a secluded house in the mountains would be an evil spirit responsible for the illness. Jong-Goo  β€¦decides to visit the Japanese with his partner and a young priest that speaks Japanese. They find an altar with a goat head and pictures of the infected people that died on the walls. However they are attacked by the guard dog and they only can leave the place when the stranger arrives. Jong-Goo finds one shoe of his beloved daughter Hyo-jin in the house of the stranger and soon she becomes sick. His mother-in-law summons the shaman Il-gwang to save her granddaughter while a mysterious woman tells Jong-Goo that the stranger is the responsible. Who might be the demon that is bringing sickness to Goksung? (Read More)

Subgenre:
folk horrorsupernatural
Themes:
ghostdeathmurderrapeinvestigationsupernatural power
Mood:
mysteriousnightmare
Locations:
villagehospitalrestaurantsmall townrural settingpolice stationpolice cargas stationsex in carsex in a carfire truck
Characters:
husband wife relationshippolicefather daughter relationshipteenagermother daughter relationshipdoctorteenage girlzombiepolice officerpolicemanpriestlittle girljapanesedaughter
Story:
male nudityone word titleflashbackdogtwo word titlesex scenecigarette smokingphotographknifewritten by directorvomitingdead bodydemonold manwhite panties β€¦dream sequencedrawinghit by a carritualcursepossessionnosebleedstrangerdead womanfull moonwatching televisionpower outagescissorsthunderstormfat manexorcismlocation in titledead dogserial murderbarking dogdead animalkilling a dogblood stainrumorshoeshamanbaseball capsouth korearainingreading a newspaperdead birddead wifeshrinepsychotronic filmdog attackhouse on firestabbed with scissorswhite coatpolice partnerrearview mirrorrestaurant ownerchild's drawinghaving sex with skirt hiked uppolice protagoniststruck by lightningacupuncturemotorcycle helmethanged womanpolice badgegluttonybiblical quotewashing clothesbloody handjapanese mandriving in the raindead deerscreaming girlwashing a carpower cutfishing rodsleeping on the floorpolice uniformrashwalking in the woodspolice taperolling down a hillphotograph on wallattacked by a dogattacked by dogsleeping on the groundstone throwingthrowing stonesdivinationkorean womanblack dogcross necklacehanging from a treehouse in the woodsbreaking a lockhitting one's head on a rocktest resultthrowing a stonebiblical quotationhearing parents have sexreference to religionsoy sauceburned out housecorner storemysterious figurepouring rainsick girlsouth koreanthrowing rockskorean girlkorean manneck scarremote housescreaming child (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Fog (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (1980)

As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β€¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)

Subgenre:
paranormalindependent filmcult filmcreature featureamerican horror
Themes:
ghostdeathmurderrevengefearescapemonstersupernatural powerevil
Mood:
darkness
Locations:
townbarbeachchurchsmall townwaterrural settingseashipcampfirefishing boatghost ship
Characters:
childrenmother son relationshipboyzombiepriestsingle motherlittle boyvillainsheriffterroremployer employee relationshipcatholic priestmysterious villain
Period:
1980s1970syear 1979
Story:
creepybloodviolencetwo word titleknifechasesurprise endingcorpsesworddead bodydemondecapitationcaliforniastabbingwoman β€¦impalementstabbed to deathchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorkillingundeadrecord playerpirategoldelectronic music scoremass murdergothictape recorderlifting someone into the airmutilationstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagebutcherpsychotronicautopsyfogeye gougingslaughterpierdark pastkilling spreelighthousedjbad guymysterious manliving deadspiral staircasejournalevil spiritblackoutslashingradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulbutcherygrindhouse filmhookradio broadcasttragic villainmistphonograph recorddocksdisturbingmusic score composed by directorstained glass windowdemonicremadedrive in classicbayhorror movie remadefemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All)

A Nightmare On Elm Street 2: Freddy's Revenge (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
paranormalsupernaturalcult filmparanormal phenomenaslasher flickteen horrorbody horroramerican horrorsupernatural horrorurban fantasylgbt horrorcult classichorror b movie
Themes:
mysterious deathghostdeathmurderfriendshiprevengesurrealismkidnappingfearescapemonstervoyeurismpsychopathbrutalitysupernatural power β€¦paranoiasadismevilpanicshower murder (See All)
Mood:
gorerainhigh schoolnightmareslasherdarknesspoetic justice
Locations:
barschoolswimming poolsmall townbusdesertbaseballstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
family relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriendboyfriend girlfriend relationshipbrother sister relationshipteenage girlteenage boyteacher β€¦girlserial killerstudentpolicemanlittle girlkillervillainterrorself mutilationdriverslasher killerserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
newspaper headlineseriesclasscharacter name in titlenuditynumber in titlebloodmale nudityviolencesequelmale rear nuditybondagedogbare chested malefight β€¦cigarette smokingpartyknifechasesurprise endingshowertelephone callfirecryingdreamdigit in titleunderwearblood splatterface slapshotgunslow motion scenewatching tvundressingbikinibare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordsubjective camerafoot chasename in titlemassacrestabbingbasketballimpalementfootballstabbed to deathstabbed in the chestsnakeapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendstabbed in the backscreaminglocker roomperson on firecharacter's point of view camera shotpossessionevil mankicked in the facelightningscreamdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifehaunted houseobscene finger gesturewhippingbare chested male bondageredheadundeadmaniaccoachapplauseidentityteen angstburned alivekilling an animalnipples visible through clothingelectronic music scorewoundmass murderbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malepsychovisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressblood on faceunderage drinkinggash in the facebutcherescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countbriefscellarkilling spreealarm clocktelekinesisnewspaper clippingpsycho killermale objectificationserial murderpsychopathic killertaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spirithomicidal maniacbroken windowfish tankslashingbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlevolleyballbare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shoulderwhite briefsmoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tablemurder spreedragging a bodyvillain not really dead clichebreaking a mirrorbutcherygrindhouse filmsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventpsycho terrorlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandageplaying baseballpossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

Shutter (2004) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Shutter (2004)

A young photographer Thun and his girlfriend Jane discover mysterious shadows in their photographs after fleeing the scene of an accident. As they investigate the phenomenon, they find other photographs contain similar supernatural images, that Thun's best friends are being haunted as well, and Jane β€¦ discovers that her boyfriend has not told her everything. It soon becomes clear that you can not escape your past. (Read More)

Subgenre:
supernaturalasian horror
Themes:
ghostdeathrevengesuiciderapeescapeobsession
Mood:
mysteriousnightmare
Locations:
hospitalfire escape
Characters:
boyfriend girlfriend relationshipgirlphotographerex boyfriend ex girlfriend relationshipgirlfriendbest friendsghost girl
Story:
hauntedbloodone word titleflashbackphotographsurprise endingcorpsecar accidentcamerafalling from heightcollegeaccidentpainscreamspirit β€¦48 hour film projectmental hospitalgang rapeshadowboyfrienddark pasthit and rungraduationcremationlong hairevil spiritpolaroidx raydenialmind gamepharmacywrist slittingdarkroomstairwellstrobe lightyearbookthaihorror movie remadecollege graduationlights outsecret lovercarried on shouldersmultiple suicidepreserved corpse (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Children Of The Corn (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Children Of The Corn (1984)

A boy preacher named Isaac goes to a town in Nebraska called Gatlin and gets all the children to murder every adult in town. A young couple have a murder to report and they go to the nearest town (Gatlin) to seek help but the town seems deserted. They are soon trapped in Gatlin with little chance of β€¦ getting out alive. (Read More)

Subgenre:
folk horrorindependent filmcult film
Themes:
deathmurderlovereligionbetrayalfearsupernatural powerabduction
Locations:
townchurchsmall townfarmgas station
Characters:
childrenboyfriend girlfriend relationshipboygirl
Story:
bloodviolencedogbare chested malekissknifechasesurprise endingfirevoice over narrationblood splatterrescuegood versus evilmassacrethroat slitting β€¦stabbed to deathdinercultdrawinghit by a carcoffeefirst of seriessuitcasedeath of childhairy chestcrosspsychiclifting someone into the airpreacherback from the deadblood on facedead childblood on shirtmurder of a childcrucifixionhuman sacrificecornfieldpoisoningmeat cleaverleaderkiller childcar radiorevolttime loopcornpower strugglebloody body of a childnebraskadesolationbarefoot womansicklechild murders a childworshipdead body in car trunkcrayonchild knocked unconsciousattempted escapemonopoly the board gamechild sacrificechild murders an adultpagan ritualpsychotic childparent killed in front of child (See All)

The Boy (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Boy (2016)

Greta is a young American woman who takes a job as a nanny in a remote English village, only to discover that the family's 8-year-old is a life-sized doll that the parents care for just like a real boy, as a way to cope with the death of their actual son 20 years prior. After violating a list of str β€¦ict rules, a series of disturbing and inexplicable events bring Greta's worst nightmare to life, leading her to believe that the doll is actually alive. (Read More)

Subgenre:
family tragedy
Themes:
mysterious deathdeathmurderescapevoyeurism
Locations:
woodsvillageforestcemetery
Characters:
family relationshipshusband wife relationshipfemale protagonistamerican abroadex boyfriend ex girlfriend relationshipsuicide by drowningamerican in europe
Story:
seriesphotographsurprise endingshowermaskpaintingstabbingon the rungraveportraitdollhaunted housekilling an animalloss of sonplot twist β€¦atticfamily secretnannyface maskstuffed animalold dark housebroken mirrormaking outknocked unconsciousgramophonedeath by drowningsecret roomsex dollabusive relationshiphidden roomlearning the truthgovernessscrewdriverelderly couplereference to johannes brahmsanimate dollgoodbye letterbelief in ghostsrat trapmouse trapcreepy child (See All)

Red Riding Hood (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Red Riding Hood (2011)

Valerie (Seyfried) is a beautiful young woman torn between two men. She is in love with a brooding outsider, Peter (Fernandez), but her parents have arranged for her to marry the wealthy Henry (Irons). Unwilling to lose each other, Valerie and Peter are planning to run away together when they learn  β€¦that Valerie's older sister has been killed by the werewolf that prowls the dark forest surrounding their village. For years, the people have maintained an uneasy truce with the beast, offering the creature a monthly animal sacrifice. But under a blood red moon, the wolf has upped the stakes by taking a human life. Hungry for revenge, the people call on famed werewolf hunter, Father Solomon (Oldman), to help them kill the wolf. But Solomon's arrival brings unintended consequences as he warns that the wolf, who takes human form by day, could be any one of them. As the death toll rises with each moon, Valerie begins to suspect that the werewolf could be someone she loves. As panic grips the town, Valerie discovers that she has a unique connection to the beast--one that inexorably draws them together, making her both suspect...and bait. (Read More)

Subgenre:
folk horrorcult filmcoming of agesuspensetragedyfairy talecreature featurebased on fairy talegothic horror
Themes:
deathmurderlovefriendshiprevengekidnappingbetrayalfeartortureescapedeceptionseductionangerdeath of fathersupernatural power β€¦death of motherparanoiahumiliationunrequited loveexecutionpaniccouragedeath of daughterautism (See All)
Mood:
nightmaredarkness
Locations:
townwoodsvillagechurchforestsnowboatlakecavelog cabin
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipbrother sister relationshipfemale protagonistsoldierpriesthostagesister sister relationshiplove trianglegrandmother granddaughter relationshiphunting party β€¦woodcutter (See All)
Period:
winter
Story:
killf ratedcharacter name in titlebloodviolenceflashbackdancingpartyknifechasethree word titlesurprise endingfirevoice over narrationtitle directed by female β€¦dreamcorpseblood splatterhorseshot in the chestrescueslow motion sceneswordarrestmaskinterrogationcolor in titlesubjective cameragood versus evilsurvivalfoot chaseorphanambushaxemassacremountainarmyimpalementstabbed to deathstabbed in the chestfalse accusationsevered headdouble crossritualflash forwardtreecursedangerstabbed in the backcharacter's point of view camera shotrace against timetragic eventpigloss of fatherwaterfallloss of motherwerewolfcaptainsabotagewolfrevelationgothichelmetjail cellhuntersevered handtorchanimal attackpreacherfull moonrampageshieldvisionbraveryarranged marriagecrossbowhatredrowboatmedieval timesdeath of sisteraerial shotcapturesnowingdark pastfemale directorkilling spreemoral dilemmatelepathyclose up of eyesnarrated by characterface maskhistorical fictionabuse of powerloss of daughtermental retardationshot with an arrowyoung version of characterwhodunithunttaverncabin in the woodsmercy killingpatricidereverendaltered version of studio logoloss of sisterchapeldeath of grandmothertragic pastmatricidemiddle agesblacksmithmind readinganimal killingwrongful arrestglowing eyeshatchetcard trickhorse drawn carriagestagecoachmistsuit of armorcaged humanbasketsilverwood choppingwhite rabbitloss of grandmotherred riding hoodwomen dancing togetherred capebrothers grimmtorture devicetunicthrown from a boatwitch hunterdaughter murders fatherplanetary alignmentwerewolf bitewoodsmanbitten in the handwalking over hot coalsbitten in the armred hoodblood moonbitten in the legmurder of grandmotherrabbit trapwater bucketmonster hunterred moon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Lat Den Ratte Komma In (2008) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lat Den Ratte Komma In (2008)

Oskar, a bullied 12-year old, dreams of revenge. He falls in love with Eli, a peculiar girl. She can't stand the sun or food and to come into a room she needs to be invited. Eli gives Oskar the strength to hit back but when he realizes that Eli needs to drink other people's blood to live he's faced  β€¦with a choice. How much can love forgive? Set in the Stockholm suburb of Blackeberg in 1982. (Read More)

Subgenre:
cult filmcoming of agecreature feature
Themes:
deathmurderfriendshiprevengesuicidedrinkingfeardivorcebrutalitybullyingcrueltychildhoodfalling in lovecourage
Mood:
gorenight
Locations:
woodshospitalbartrainschoolswimming poolforestsnowbathtubtaxiapartmentpolice carlakeschool bullyblood on snow
Characters:
childrenfather son relationshippolicemother son relationshipfriendboyfriend girlfriend relationshipboyteachergirlserial killerpolicemanvampirebullysingle motheralcoholic β€¦ex husband ex wife relationshipdeath of girlfriendvampire girl (See All)
Period:
1980swinter
Story:
newspaper headlineclassreadingnewspaperfemale nuditybased on novelnuditybloodfemale frontal nuditydogbare chested malekisscigarette smokingknife β€¦telephone callfirecorpseunderwearfoodmirrorurinationcatdrinkarrestundressingfalling from heightbookvomitingliebeerdead bodybathroomneighborclassroomswimmingdecapitationflashlightgangthroat slittingbridgeeatingfemale pubic hairsubwaydinnersevered headradiounderwater scenedrowningattempted murdertreesuburblocker roomperson on fireliarringneck breakingtied upthreatened with a knifesevered armwhippingsingle parentrecord playerchainsaweavesdroppinghuggingfalling down stairsburned aliveaddictiongothiclooking at oneself in a mirrorlistening to musictape recorderrecordingloss of friendswimsuitcovered in bloodanimal attackmilkgas maskbarefootswitchbladechild's point of viewattempted suicidewhipchild protagonistgash in the facehit on the headdark heroice skatinginfectionice hockeyblood on shirtmurder of a childsnowinggasolinedead boycellarnewspaper clippingvodka12 year oldcandyhit in the faceimperative in titlepubertyreading alouddead childrenlooking out a windowacidbully comeuppancedisposing of a dead bodyweightliftingclimbing through a windowfemale vampiresolitudemisfitcowboy bootslistening to a radiobitten in the neckdeath penaltydripping bloodscandinaviasense of smellbleedingurinalgurneykiller childdisfigured facegame playingsnowmobilepencilglowing eyesstarvingstockholm swedenhead ripped offbitten in the throatandrogynybloody body of a childblond boyhung upside downsledmultiple murdersscreenplay adapted by authorfrozen bodyrubik's cubefrozen lakelooking in a windowpuzzle solvingraincoatsunlightfinger cutfield tripcold the temperaturevampire bitemorse codedragging a dead bodyband aidearvampire human lovemelting facestampsitting in a treeboys' bathroomclimbing up a walldivorced coupleear bleedingbleeding from eyesolder brotherweather reportcry for helpdangerous friendunderpasshandprintchild vampiretransistor radiobrushing one's teethcat loverdecapitated childtape deckthrown out a windowfunnelsleeping in a bathtubblood drainingwet hairdaughter murders fathergolden eggblindsclimbing up a buildingmislaid truststamp collectionwet pantssneaking intriple child murdercat attacksledgefrench poodlecutting one's handscare involving catbursting into flamesclass tripowning many catscutting the palm of one's handviaductdrained of bloodphysical education classphysical education teacheranimal senses evilbeating with a stickburning womanlistening through the wall (See All)

One Missed Call (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

One Missed Call (2008)

After the death of their friend Shelley, Leann Cole receives a voice mail from the future of the date and time when she would die. On the scheduled day, Leann sees weird things and in the precise informed hour, Leann is attacked by a supernatural force on a footbridge over a train station while talk β€¦ing to her friend Beth Raymond. Beth meets Leann's boyfriend Brian, who also received a call, and witnesses his death on the street. When her roommate Taylor Anthony receives a call, Beth befriends Det. Jack Andrews, who tells her that his sister was the first victim of the phone call. They decide to investigate the connections of Jack's sister and find the name of Marie Layton, who apparently abused of her daughters. Jack and Beth run against time trying to save Beth from her fate. (Read More)

Subgenre:
supernatural
Themes:
mysterious deathghostdeathmurderfuneralinvestigationdeath of fathersupernatural power
Mood:
horror movie remake
Locations:
hospitalpolice station
Characters:
mother daughter relationshipsister sister relationshippolice detective
Story:
talkingbased on novelnumber in titleflashbackexplosionpartyknifechasesurprise endingtelephone callfirecell phonecorpseremakecat β€¦falling from heighthallucinationtelephoneflashlightambulancedeath of friendmontageimpalementchild abusechild in perilpolice officer killeddrowninglibraryscreamingdolldeath of childcollege studentspiritkilling an animallifting someone into the aircrucifixmorguesevered handteddy bearconstruction siteinsecttitle appears in writingdead childdeath of sisterstabbed in the eyeexorcismcandyfish tanktelevision showbody baghanged manpondkiller childdeformitypeep holeabusive motherhit by a traincut armvoice mailtelevision producerasthma attackabandoned hospitalasthma inhalerburned with a cigarettephone terrorremake of japanese filmremake of asian filmtelephone terrorchoke to deathphone videonanny cam (See All)

Hansel & Gretel: Witch Hunters (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Hansel & Gretel: Witch Hunters (2013)

The siblings Hansel and Gretel are left alone in the woods by their father and captured by a dark witch in a candy house. However they kill the witch and escape from the spot. Years later, the orphans have become famous witch hunters. When eleven children go missing in a small village, the Mayor sum β€¦mons Hansel and Gretel to rescue them, and they save the red haired Mina from the local sheriff who wants to burn her, accusing Mina of witchcraft. Soon they discover that the Blood Moon will approach in three days and the powerful dark witch Muriel is responsible for the abduction of children. She intends to use the children together with a secret ingredient in a Sabbath to make the coven of witches protected against the fire. Meanwhile Hansel and Gretel disclose secrets about their parents. (Read More)

Subgenre:
supernaturalmartial artsblack comedyfairy talesword and sorcerysteampunkdark fantasy
Themes:
deathmurdersurrealismkidnappingbetrayalescapemagicdeath of fathersupernatural powerdeath of motherabductionfalling in lovemissing child
Mood:
gore
Locations:
woodsvillageforestsmall towndesertcity
Characters:
childrenpolicebrother sister relationshiphostagetough guyaction herovillainsniperwitchsheriffmayorsniper rifleself inflicted gunshot woundevil witch
Story:
localkillfemale nuditycharacter name in titlenuditybloodviolenceflashbackbare chested malegunfemale rear nudityfightphotographexplosionknife β€¦chasepistolfirevoice over narrationpunctuation in titlebeatingshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headshotgunrescuepunched in the facewritten by directorbattleswordbrawlfalling from heightshowdownrifleheld at gunpointhand to hand combatinterrogationcombatshot in the backf worddecapitationgood versus evilcleavageorphanassassinsword fightambushaxemassacrestabbingimpalementstabbed to deathcolon in titlestabbed in the chestsevered headanti herochild in perilritualpolice officer killedshot in the legfive word titleskinny dippingcursecharacter repeating someone else's dialoguestabbed in the backperson on firemissionrace against timeknocked outtough girlopening action sceneattempted rapefarmershot in the shoulderinjectionexploding bodytrapwaterfallsevered armshot in the armkissing while having sexdismembermentbattlefieldstylized violenceampersand in titlebow and arrowburned aliveflyinghead buttgothicslow motioncatfightstabbed in the stomachwitchcraftbuttocksvillainesscovered in bloodgrindhousemind controlaction heroinefemale killercrushed to deathfull moonhaunted by the pastbloody nosecrossbowfight to the deathmercilessness3 dimensionalpunched in the stomachshot in the facestabbed in the headstabbed in the legexploding headthrown through a windowdungeonwisecrack humortitle at the endbounty hunterhealinglanternpassionate kissdead woman with eyes openpumpkinbonfiredeath of loved oneblack magicfamily secretburned to deathtelekinesisgatling gunshot multiple timesfemale assassinspelltaserold dark househead blown offscene before opening creditsfireballhuman sacrificegun held to headcomic reliefyoung version of characterstabbed in the armdouble barreled shotgunredheaded womanhanging upside downtaverndeputysawed off shotgunkiss on the lipscabin in the woodsman punching a womansunrisepotioncrushed headtrollhanged manbroken nosehit with a shovelsuperhuman strengthexploding housecut into pieceswoman undressingimplied sexanachronismhouse firediabeteswanted postersevered footman hits a womanimmolationlynchinganti heroinephonographovenscrapbookrewardslow motion action scenehung upside downwoman punching a manwoman kills manstun gunsuper speedinvulnerabilitymagic wandanimated opening creditsdiabeticbody torn apartbrass knucklestrackerwoman kills womanhero kills a womanlost in the woodscalling someone an idiotdefibrillationleather pantsforced suicideinsulinminionmissing person posterwitch huntoutnumberedburned at the stakefalling from a treehanged by the neckruseblue eyescoventhrown through a walllairfighting in the airwoman stabbedends with narrationair battleflying broomhead held underwaterritual sacrificeimmunitydemon hunterreflection in waterspontaneous combustionkid outsmarts adulthansel and gretelporridgehead stompself injectionwitch huntermoon shotknocked out with gun butthuntresscalling a woman a whorebroomstickdragged along the groundstomped to deathwitch burninggingerbread househead crushedcensored rape scenethrown from a cliffaccused of witchcraftdeliberate anachronismgood witchsuspected witchwish me luckeating a bugbiting someone's noseblack bloodexploding personaugsburg germanymultiple actresses for one character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ju-on: The Grudge (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ju-on: The Grudge (2002)

In Japan, when the volunteer social assistant Rika Nishina is assigned to visit a family, she is cursed and chased by two revengeful fiends: Kayako, a woman brutally murdered by her husband and her son Toshio. Each person that lives in or visits the haunted house is murdered or disappears.

Subgenre:
supernaturaljapanese horror filmsupernatural horrorasian horror
Themes:
mysterious deathghostdeathmurdersuicidemarriagefearangersupernatural powerparanoiasadismcrueltypanictraumamurder investigation β€¦murder of a police officermissing childpsychological trauma (See All)
Mood:
goredarknessmurder suicide
Locations:
hospitalrestaurantschoolelevatorwheelchair
Characters:
policemother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteacherpolice officerpolice detectiveghost girlmysterious girlghost in mirrorghost boy
Story:
hauntedbloodflashbackphotographshowercorpseremakewatching tvcatbedbedroomhousenonlinear timelinebrunettesearch β€¦old womanpainscreamingpossessionthreatsuspicionfirst parthaunted housearsonmass murderragemutilationdesperationvisitteddy bearhomedead womansufferingsonstairsatticgasolinesocial workerpsychoticvideo surveillanceclosetdark secretlong hairstairwayevil spiritrestroomblood stainpremonitionwrathmysterious womanmultiple murderchapter headingstenantblack catcrime investigationhusband murders wifemurder victimdeeply disturbed personmultiple homicideghost childremadehorror movie remadecatatoniamystery womansakewraithfear of ghostsretired copwoman journalisthomicidalhome care (See All)

Twin Peaks: Fire Walk With Me (1992) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Twin Peaks: Fire Walk With Me (1992)

Essentially a prequel to David Lynch and Mark Frost's earlier TV series "Twin Peaks". The first half-hour or so concerns the investigation by FBI Agent Chet Desmond (Chris Isaak) and his partner Sam Stanley (Kiefer Sutherland) into the murder of night-shift waitress Teresa Banks in the small Washing β€¦ton state town of Deer Meadow. When Desmond finds a mysterious clue to the murder, he inexplicably disappears. The film then cuts to one year later in the nearby town of Twin Peaks and follows the events during the last week in the life of Laura Palmer (Sheryl Lee) a troubled teenage girl with two boyfriends; the hot-tempered rebel Bobby Briggs (Dana Ashbrook) and quiet biker James Hurley (James Marshall), her drug addiction, and her relationship with her difficult (and possible schizophrenic) father Leland (Ray Wise), a story in which her violent murder was later to motivate much of the TV series. Contains a considerable amount of sex, drugs, violence, very loud music and inexplicable imagery. (Read More)

Subgenre:
independent filmcult filmexperimental film
Themes:
mysterious deathdeathmurderlovefriendshipsurrealismrapeinvestigationdeceptionincestseductioncorruptionpsychopathbrutalitysupernatural power β€¦drug usedysfunctional familyredemptionmental illnessmurder investigation (See All)
Mood:
mysteriousgorehigh schoolnightavant gardedarkness
Locations:
townsmall towncanada
Characters:
policefather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipteenage girlprostitutefemale protagonistserial killerbest friendwriter director
Period:
1980syear 1989year 1988
Story:
violentseriessexfemale nudityf ratedbloodviolencefemale frontal nuditycigarette smokingtelephone callfirecryingdreamcorpse β€¦blondesecretbedprostitutionhallucinationtelephonedrug dealercocainenonlinear timelinepantyhosebased on tv seriesscreamingfbipossessionangelmissing personactor shares first name with characterdiaryhigh school studentdarksadnessobscene finger gesturemonkeymoonstrong female characterfemale stockinged legssexual abusefbi agentclubproduced by directorstrong female leadschizophreniacamera shot of feetcrime scenewoman in jeopardydwarfvisionsufferingfemale leadpsychotronicdespairphiladelphia pennsylvanialooking at self in mirrorprequeldead girldoppelgangerinvestigatorevil spiritdouble lifefemale friendshipsplit personalityfoot closeupfriendship between girlslesbian subtextsalvationenigmaviolent deathagoraphobiareturning character with different actordeja vumultiple personalitydoublehigh school friendmental instabilitybased on cult tv seriestraffic lightwashington statepacific northwestroad ragefilicidewhite horsestrong sexual contentcult movie castjealous boyfriendimplied cunnilingusfemale bare feetfemale in lingeriemysterious eventsone armed manpersonality changedeliberate crueltyreference to fred astairereference to j. edgar hooverfemale stockinged solesdual personalityrape of a minorreference to ginger rogersfingernailred curtainsinger actingblue lightwoman putting on makeupinner demonred roomtaking control of someone's bodyabandoned trainhomecoming queenfemale bare legsunintelligible dialogue with subtitleswaitress uniformtalking backwardscult male charactercrazeerratic behaviortelevision smashingcult female charactertragic female character (See All)

In The Mouth Of Madness (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

In The Mouth Of Madness (1994)

With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends  β€¦up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)

Subgenre:
supernaturalindependent filmcult filmblack comedysuspenseparanormal phenomena
Themes:
deathmurdersurrealismsuicidefearescapemonsterinvestigationdeceptionparanoiainsanityapocalypseself sacrificepolice brutalityghost town β€¦end of mankind (See All)
Mood:
mysteriousneo noirnightmare
Locations:
townnew york citybarchurchhotelcarsmall townbusbicycleelevatormoteltunnelnew england
Characters:
policedoctorpolice officerwriterlawyerpsychiatristsecretaryhomeless manself referentialinsurance agentevil monster
Period:
1990s
Story:
creepybloodviolenceflashbackdogguncigarette smokingtitle spoken by characterchasesurprise endingbeatingcorpseshot to deathblood splattercar accident β€¦shot in the chestshot in the headshotgunarrestpaintingbookriflecar crashbathroomdemonhallucinationhandcuffsreference to jesus christrevolvermanhattan new york citysubjective cameragood versus evilfoot chaseaxeambulancebridgedinerweaponnonlinear timelineanti herodrawinghit by a carcreaturenews reportattempted murdersmokingauthorcharacter repeating someone else's dialoguebeaten to deathpay phonecharacter's point of view camera shotmissing personlightningcrossfilm within a filmbasementsuspicionmurderercinemasevered armcult directortypewriterdismembermentkillingriotpickup truckfireplacerevelationelectronic music scoregothicheavy rainlooking at oneself in a mirrormutantragetold in flashbackcrucifixmovie theaternosebleedfraudtorchend of the worldanimal attackschizophreniascamhitchhikingmental institutionmovie theatresevered fingercynicismhit in the crotchtitle appears in writingescape attemptcigarette lighterbookstorerainstormdisfigurementh.p. lovecraftaxe murdermutationasylumriding a bicycleshot multiple timesmedia coverageposteralleytributenovelhomagepublisherportaleditorconfessionaldouble barreled shotguninsane asylumcornfieldreceptionistfantasy worldstrait jacketsleeping in a carmanuscriptchapeldisfigured facepitchforkgodroadalternate dimensionsocial decayburningangry mobdeja vumovie posterparallel worldbluecyclisthomeless womanfantasy becomes realitymusic score composed by directornew hampshirebook burningalternate worldblue eyesmanic laughterblood on mouthinsurance investigatorliterary agentabandoned churchdream within a dreampessimismcursedlovecraftianabandoned hotelpadded cellabandoned cityabandoned theaternewspaper boybook publisherfire axemetafictiontentaclesemergency broadcast systemparallel dimensionchristian crosscovered bridgegoing in circleshorror writerdoberman pinscherpack of dogsend of worldmentally insanebicycle rideschizowriter meets subject (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Goosebumps (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Goosebumps (2015)

First this is all about monsters and any kind of supernatural .After going to a new small town,the teenager boy Zach Cooper (Dylan Minnette) he meets the beautiful girl, Hannah (Odeya Rush), living right next door. But every silver lining has a cloud, and Zach's comes when he learns that Hannah has  β€¦a mysterious dad who is revealed to be R. L. Stine (Jack Black), the author of the bestselling Goosebumps series. It turns out that there is a reason why Stine is so strange... he is a prisoner of his own imagination - the monsters that his books made famous are real, and Stine protects his readers by keeping them locked up in their books. Zach unintentionally unleashes the monsters from their manuscripts and they begin to terrorize the town, it's suddenly up to Stine, Zach, Hannah, and Zach's friend Champ (Ryan Lee) they all do their best to back all of the monsters in the book. (Read More)

Subgenre:
supernatural
Themes:
ghostmonsterdeath of father
Mood:
mysterioushigh school
Locations:
townschool dance
Characters:
mother son relationship
Story:
seriestitle spoken by characterbased on bookno opening creditsclowntypewriterwerewolfferris wheelmanuscriptorchestral music scoreghoulauthor cameoblobventriloquist dummypraying mantis β€¦lawn gnomevice principalabandoned amusement parkbest selling authorcarnivorous plantabominable snowmanhomecoming danceinvisible boy (See All)

The Conjuring 2 (2016)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Conjuring 2 (2016)

In 1977, paranormal investigators Ed and Lorraine Warren travel to London, England, where single mother Peggy Hodgson believes that something evil is in her home. When Peggy's youngest daughter starts showing signs of demonic possession, Ed and Lorraine attempt to help the besieged girl, only to fin β€¦d themselves targeted by the malicious spirits. (Read More)

Subgenre:
paranormalsupernaturalparanormal phenomenaparanormal investigationparanormal activity
Themes:
ghostlovechristmasfeardeception
Locations:
london englandengland
Characters:
husband wife relationshipteenage girlpriestlittle girlsingle mothercatholicterror
Period:
1970syear 2003year 1976
Story:
spiritssequelinterviewbased on true storyshot to deathpaintingsecond partdemonaxehousenunno opening creditschild in periltransformationscreaming β€¦possessiontentchristmas treescreamcrossbasementhauntinghaunted housepsychicrecord playertape recorderrecordingtied to a bedcrucifixnosebleedwatching televisionarchival footagethunderstormchairdemonic possessionteleportationreference to elvis presleynarrated by characterlevitationseancebroken windowcatholicismpremonitionsoccer ballouija boardwoman smokerphonographends with biographical notesstarts with narrationrosaryjumping out a windowsing alongarchival photographscreaming in fearfalse teethmale singerjumping ropebreaking down a doorbased on supposedly true storyvideo recordingstutterconvulsiontalking to the deadspeech impedimentdriving in the rainswing setparanormal investigatorjump scareskepticdenturespsychokinesisvoice recordingsprayed with watercrucifix pendantbite markfalling out of bedblurry visionhiding under the coverslocked in jailwoman screamingbegins with historical notesrosary beadsspecterhavocstuttering charactertelevision statictoy truckchild shot in the backparanormal experthyperventilatingbrick thrown through a windowdownpourflooded basementupside down crossamityvillesitting on a swingzoetropepulled underwaterspeaking in another voiceupside down crucifixflickering lightstalkshow (See All)

The Uninvited (2009) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Uninvited (2009)

After the death of her ill mother in a fire, the young teenager Anna tries to commit suicide and is sent to a mental institution for treatment. Ten months later, Anna still cannot remember what had happened on the night her mother died. Her psychiatric Dr. Silberling, however, discharges her telling β€¦ that she has resolved her issues. Her father and successful writer, Steven, brings her back home in an isolated mansion nearby the coast. Anna finds that her mother's former nurse, Rachel Summers, is her stepmother now. Anna meets her beloved sister, Alex, swimming in the sea. She discovers that Steven has not delivered the letters and CDs that Alex had sent to her. As time moves on, Anna is haunted by ghosts and she believes that Rachel killed her mother. Alex and Anna decide to look for evidence to prove that Rachel is the murderer and Anna discovers the truth about the fire in the boat house. (Read More)

Subgenre:
suspensetragedypsychological thrillerbased on fairy talepsychological horror
Themes:
deathmurderrevengesurrealismfeardrunkennessescapefuneralextramarital affairangerobsessiondeath of motherparanoiamental illnesspanic
Mood:
neo noirnightmarehorror movie remake
Locations:
woodsbeachforestcemeterybathtubpolice stationoceancampfirenew england
Characters:
family relationshipspolicefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipteenage boyfemale protagonistnursewritersister sister relationshiplittle girlpsychiatristsheriff
Period:
1980s2000syear 1986
Story:
newspaper headlineghostshauntedkeybloodflashbackkissfightphotographexplosionpartyknifechasesurprise ending β€¦pantiesfiredreamcorpseremakeslow motion scenewatching tvarrestbikinibrawlfalling from heightvibratorbedsex standing uphallucinationislandsubjective cameracleavagecandlestrangulationstabbingmontagestabbed to deathdinerfalse accusationno opening creditsfemme fatalenecklaceattempted murderauthordangerscreamingwidowercharacter's point of view camera shotproduct placementknocked outscarinjectiontragic eventlaptopsuspiciondirectorial debutloss of motherlove interestchild murderterminal illnesseavesdroppingsupermarketsyringeburned aliverevelationhypodermic needlegothicheavy rainlooking at oneself in a mirrorsociopathcaught having sexcovered in bloodschizophreniamental institutionhaunted by the pastvisionfalling to deathmental hospitalhit on the headaccidental killingdeath of sisteraerial shotatticlipstickshadowblood on shirtgasolinepierdark pastpassionate kissbruisetank topburned to deathsports carnannymemory lossgothgirl in bra and pantiesmental patientapparitiondinner partyblood stainsplit personalityyoung womanbellbeach houseoffscreen killingpearl necklacefemale villainwoman kills a manbody bagloss of sisterevil womanexploding housetragic pastwoman in a bikinioverhead camera shotbutcher knifemainewhite dresshouse on firedelivery boyclimbing out a windowloss of memorytrail of bloodrepressed memorygrave side ceremonyghost childsmall communityburned bodysick motherchalkboardkeyholelooking through a keyholebroken backtranquilizerunreliable narratorgarbage bagseeing dead peopleboathouseseaside townpushed from heightevil stepmotherfemale sociopathhandprintremake of asian filmwatering canhouse explosionunwanted sexual advancesgas lampwrist cuttingslit wristslarge houseblock and tacklemedical kitremake of korean filmdaughter hates father's girlfriendocean front house (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witch (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witch (2015)

New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β€¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)

Subgenre:
folk horrorindependent filmsuspenseconspiracyamerican horrorbritish horror
Themes:
ghostdeathmurderkidnappingreligionfearmagicdeath of fathersupernatural powerdeath of motherredemptionguiltinsanityillnessevil β€¦dyingdevilmadnesswildernessfather love (See All)
Mood:
goreraindarkness
Locations:
woodsvillagechurchforestrural settingfarmenglandcampfirenew englandbackwoods
Characters:
childrenfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipsingerbrother brother relationshipboybrother sister relationshipteenage girlbabysister sister relationshipchristian β€¦reference to godlittle girllittle boyvillainbiblewitchterrorbaby boythe familydeath of boymother loveasking for forgiveness (See All)
Period:
winter17th century1600s
Story:
female nuditynuditybloodmale nudityviolencefemale frontal nuditymale rear nuditydogbare chested malekisssingingknifecryingsongblood splatter β€¦foodhorseundressingsecretlierifledemonhallucinationreference to jesus christprayersubjective cameracandlestrangulationaxestabbingwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickendirectorial debutsleepingtwinwolfmass murdergothiceggwitchcraftcrying womancrying manburialanimal attackgoatapplepromisetensionhypocrisysonhungerbutchershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismslashingwhisperingwhistlingbleedingnewborn babyevil womanravengame playinghymnkiss on the cheekmiserycornbutcherychild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All)

Death Note (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Death Note (2017)

Light Turner, a bright student, stumbles across a mystical notebook that has the power to kill any person whose name he writes in it. Light decides to launch a secret crusade to rid the streets of criminals. Soon, the student-turned-vigilante finds himself pursued by a famous detective known only by β€¦ the alias L. (Read More)

Subgenre:
independent filmblack comedyconspiracy theoryteen horrorsupernatural horror
Themes:
deathmurderrevengesurrealismsuicidekidnappingbetrayalsupernatural powerbullyingpolice investigationnear death experience
Mood:
goreanimehigh schoolcar chasepoetic justice
Locations:
hospitalrestaurantpolice stationpolice carfire truck
Characters:
father son relationshippoliceafrican americanboyfriend girlfriend relationshiptattooteenage girlteenage boypolice officerdetectivepolice detectiveself mutilationsingle father
Story:
newspaper headlinecriminalskillbloodviolencetwo word titlebare chested malegunkissfightphotographtitle spoken by characterexplosionchasesurprise ending β€¦pistolfirecell phoneblood splattermachine guncar accidentslow motion scenepunched in the facefalling from heightheld at gunpointcar crashf wordsubjective camerafoot chasesevered headanti herodisarming someonehit by a carunderwater scenefemme fatalenews reportlimousinehotel roombased on tv seriesfbibased on mangamini skirtproduct placementrace against timeamerican flagexploding bodycharacter says i love youobscene finger gesturelove interestsubtitled sceneheart attacksingle parentfalling down stairshand grenadeelectronic music scoreheavy rainice creamfbi agentexploding buildingcaucasianswat teampress conferencejumping from heightladdermind controlparking garagefollowing someonecameotokyo japanstealing a carconstruction sitestabbed in the throatpower outageplot twistexploding headundercover agentbulletproof vestcellphoneraised middle fingersecret identitynewspaper clippingmoral dilemmaprivate investigatorseattle washingtonmedia coveragetext messagingblood on camera lensvillain played by lead actormysterious manbloopers during creditsnotebookpistol whipold dark houseteenage lovespiral staircasebully comeuppancepocket watchvigilante justiceferris wheeloffscreen killingbased on animefilmed killingrepeated linerighteous ragechild molesterlive actionprivate jetpsychotronic filmabsent motherhostage situationadaptationdutch anglesurprise during end creditsskypecheerleadinghigh school footballgym classteenage angstsex offenderhidden identitynew york statemass deathmass suicideevil laughterevil godstolen police carwoman murders a manstabbed with a forkwaking up from a comadeath in titleblack lives matterfemale sociopathplaying godprom nightvow of silenceseattle space needlechased by policejumping to deathopening creditscomputer roomlive action remake of animeshinigamiten years (See All)

The Blair Witch Project (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Blair Witch Project (1999)

Three film students travel to Maryland to make a student film about a local urban legend... The Blair Witch. The three went into the woods on a two day hike to find the Blair Witch, and never came back. One year later, the students film and video were found in the woods. The footage was compiled and β€¦ made into a movie. The Blair Witch Project. (Read More)

Subgenre:
folk horrorindependent filmcult filmblack comedysuspensemockumentarytragedyfound footagefake documentaryghost storysupernatural horrorfamily tragedy
Themes:
fearsupernatural powerpanicwildernessstarvationcamping in the wilderness
Mood:
student filmdarknessmyth
Locations:
woodsforest
Characters:
boyfriend girlfriend relationshipfilmmakercrying babyevil witch
Period:
1990syear 1994
Story:
localrunningcigarette smokingchasesurprise endingcryingcorpsebooklow budget filmriveralcoholsubjective camerahalloweenflashlightvideo camera β€¦four word titlemaplooking at the cameratalking to the cameralatex glovespainlegendscreamingmissing personscreamactor shares first name with characterdarktrapsleepingloss of friendmonologuewitchcraftblockbusterrampageconfrontationhandheld cameravoodoohysteriafolklorehikingabandoned housemessageautumnfrightgrassscareno endingno survivorsscreaming in fearmarylandpaganviral videobased on supposedly true storylost in the woodssevered tongueloss of boyfriendthree friendsdocumentarianobscurityscreaming in horrorchild murderesscrying childunsolved mysteryno musicactor shares last name with characterhand camerahearing noisesmeadowblack and white and colormysterious noiseaspiring filmmakerparanormal phenomenonfaked footagefriends falling outmass hysteriainterview clipsraw footagestick figureno background scorethe star spangled bannerfriendship conflictmissing manrunning in the darkvideotaping oneselfloss of realitychaos in the darkgovernment filmbloody handprintslocal legendsleeping in the forestpackage of cigarettescity folkloremoral deterioration (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Tale Of Two Sisters (2003) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Tale Of Two Sisters (2003)

Two sisters who, after spending time in a mental institution, return to the home of their father and cruel stepmother. Once there, in addition to dealing with their stepmother's obsessive and unbalanced ways, an interfering ghost also affects their recovery.

Subgenre:
cult filmconspiracytragedyasian horror
Themes:
ghostdeathlovefriendshipsurrealismsuicidebetrayaljealousypoliticsmemorybrutalityobsessionparanoiacancerredemption β€¦guiltinsanitysexualitymental illnesstheatrecrueltydeath of wifepanicvengeancedrug addictionamnesiadeath of daughterstarvationnarcolepsy (See All)
Mood:
rainnightmaredownward spiral
Locations:
villagesmall townbuselevatorwheelchairrooftop
Characters:
childrenboyfemale protagonistnursedancersister sister relationshiplove trianglesuicide by hangingstepmother stepdaughter relationship
Story:
newspaperrunningf ratednumber in titlebloodviolenceinterviewflashbackfightcigarette smokingphotographsurprise endingpunctuation in titlecryinghorse β€¦mirrorremakeliedead bodyhallucinationcolor in titleorphanflashlightstabbingmontagehouseaccidentdream sequencedrowningcoffeebusinessmanuniformdollmanipulationdarkhauntingsuspicionhaunted housecult directorheroinhatechild murderchesssistercoacheyeglassessyringeaddictiontold in flashbackcowboy hatpatientdemonstrationloss of loved onedrug abusecommunityhomehomicidepresumed deadmental institutionreverse footagesevered fingernostalgiamental hospitaldelusionscissorsbribemedicationblack brasibling rivalrydead childdeath of sisterperversionsuspectcomma in titledark pastexistentialismmutationpillcontractsuffocationhysteriaclosetmenstruationoutcastcremationdockcrutchesconfessionalstepmotherslashingblood stainrumorsplit personalityautumnepilogueeyeballsouth koreaquiztelegramdumpsterdead birdfingerprintplant in titlepsychosissleeping on a couchexpressionismgarrotevaccineprocessionguilty consciencecivilizationsanctuarynational guardeffeminacyfirst person perspectivemoral corruptionhoroscopelocked in a closethorror movie remadeblood on the floorvengeful ghosttoothpastedissociative identity disorderdune buggyevil stepmotherstep mothernegligeeprojectile vomitingfolktalewoodpeckerflagellationslit wristspsychotic childschool counsellorland reformvengeful spirit (See All)

The Bay (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Bay (2012)

This "found-footage" film is set in 2009 in the town of Claridge, Maryland on the Chesapeake Bay. During the town's annual 4th of July Crab Festival, townspeople become sick, exhibiting a variety of symptoms, which leads local news reporters to suspect something has infected the water there. No one  β€¦is sure what it is or how it's transmitted, but as people start to behave strangely, and others turning up dead, fear spawns into panic. The town is shut down as government authorities confiscate video footage from every media or personal source they find, in an effort to cover-up the incident. But one local reporter who witnessed the epidemic, was able to document, assemble, and hide this film in hopes that one day, the horrible truth would be revealed . . . (Read More)

Subgenre:
mockumentarytragedyfound footage
Themes:
mysterious deathdeathmurdersuicidedrinkingfearinvestigationbrutalityillnesscrueltypanicenvironmentmadness
Mood:
gorenightmare
Locations:
townhospitalbeachcarsmall townboatwaterpolice carseaocean
Characters:
husband wife relationshippolicedoctorpolice officerpolicemanbabykillerterrormayorfemale scientistout of control
Period:
2000s
Story:
localoutbreakbloodviolenceinterviewflashbackguntitle spoken by charactertelephone callcell phonecorpseshot to deathblood splatterfoodcar accident β€¦shot in the chestshot in the headcomputercameradrinkbikinisecretshootingvomitingliecar crashtelevisiontelephonescientistreportersubjective camerajournalistvideo cameraambulancebridgeeatingweaponinternetaccidentfishnonlinear timelineman with glassesradiounderwater scenenews reportlooking at the cameratalking to the camerapainmicrophonedangerscreamingfactorycover upscreamscene during end creditsamerican flagtragic eventsplit screenthreatunderwaterchickenfreeze framedisastertv newsrevelationdressinjurytouristwoman with glassesdiseasemutilationsecurity camerapatientyoutubedesperationswimsuitaudiencefestivaldead womanhomicideeaten alivedivingecologychaosanxietyinfectionseasidehandheld camerapollutiondead mancellphonepierfemale reportersevered legsurgeontank topcrowdplantt shirtharbortruthtourismdark secretshortscar drivingwebsitewebcamnight visioncameramanhospital roomradio stationmarried couplesicknessdeputypoisoningamputationinternet videoindustrymotorboatemergency roomshirtcrabmaggotfrightparasitemenacetv interviewdead birdfourth of julyriskanguishmedical doctorportscaretelevision reporterwater fountainloss of controlfemale journalistsmartphonecatastrophecontaminationmass mediawaiting roomdigital cameramarylandskypedesolationinterviewercreekhidden truthdead fishblousesevered tongueperilseashoreintoxicationgooglebayenvironmental disastermass deathshorehomeland securityblood vomitingcomputer screenreportpolice radioindependence dayseaside townjeopardytoxinblistercautionary talerashwater pollutioncontaminated watermass hysteriatight pants24 hourslarvalesioncamera operatorecological disasterwashed ashorewater contaminationbig buttfemale patientpoisoned foodboilpoisoned waterfemale tv reporteroceanographerchesapeake bayenvironmental contaminationpolluted environmentcrustaceanfestivitycontaminated foodscientific investigationwikipediaenvironmental pollutionirritationmass panicskin rashcenter for disease control (See All)

Castle Rock (2018)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Castle Rock (2018)

Based on the stories of Stephen King, the series intertwines characters and themes from the fictional town of Castle Rock.

Subgenre:
psychological horrorsupernatural thriller
Themes:
supernatural powerevilchildhoodwritingchildhood trauma
Mood:
mysteriousnightmare
Locations:
townsmall townnew town
Characters:
childhood friendthe family
Story:
familiarstoriesseriesreadingfemale nuditybloodviolencefemale rear nuditytelevisionhousejourneyauthorsisterhomeprison guard β€¦fandark pastmental healthdeath rowteenage daughtertheme parkfacejumpmindvoicechanceorderfansteenagefictional towntroubled pastadoptive mothercoming homeexperienceseasonfilm adaptationcommunity centerred balloonsleight of handcable televisionfan fictioncenterthe doorsoriginal storyroad mapcrashed carcold opencorrectional institutionmaking upface to facemental health issues (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
supernaturalcult filmpsycho thrillerparanormal phenomenaslasher flickteen horroramerican horror
Themes:
deathmurderprisonmonsterpsychopathsupernatural powerinsanityevilmurder of a police officer
Mood:
gorecar chaseslasherdarknessbreaking the fourth wall
Locations:
woodsforestcemeterysmall townboatlakeamerica
Characters:
policeteenagerzombieserial killerkillervillainsheriffterrorslasher killerserial murderer
Period:
1980s
Story:
violentkillsexcharacter name in titlenumber in titleviolencesequelflashbacksurprise endingblood splattermasknumbered sequeldemondecapitationflashlight β€¦massacreambulancestabbingstabbed to deathsevered headchildlooking at the cameradrowningelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattermaniacmass murdergothicmachetelifting someone into the airmutilationpsychovictimback from the deadmasked manrampagenew jerseybutchershovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerpsycho killerserial murderpsychopathic killerbad guybeheadingmadmansummer camphomicidal maniacslashingactual animal killedsixth partstabbed in the facemasked villainknife murderrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdermurder spreevillain not really dead clicheghoulbutcherypaintballhead ripped offreturning character with different actorreanimationpsycho terrorstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceeast coastunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Candyman (1992) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Candyman (1992)

Helen Lyle is a student who decides to write a thesis about local legends and myths. She visits a part of the town, where she learns about the legend of the Candyman, a one-armed man who appears when you say his name five times, in front of a mirror. Of course, Helen doesn't believe all this stuff,  β€¦but the people of the area are really afraid. When she ignores their warnings and begins her investigation in the places that he is rumored to appear, a series of horrible murders begins. Could the legend be true? (Read More)

Subgenre:
cult film
Themes:
ghostrevengekidnappingbetrayalprisonfearescapefuneralartinvestigationseductionangerpsychopathgriefabduction
Mood:
goreslasher
Locations:
townschoolelevatorwheelchairapartmentchicago illinoisslum
Characters:
policeboyfriend girlfriend relationshipserial killerphotographerartistlittle boymotherpsychiatrist
Story:
localseriesrunningfemale nuditycharacter name in titlebloodone word titledogkisscigarette smokingtitle spoken by charactersurprise endingfirebeating β€¦corpsemirrorpaintingcollegetelephonetoiletfalse accusationdrivingcultbathgravelegendstabbed in the backscreamingperson on firegraffitichild murderburned alivenipples visible through clothinggothicslow motionlifting someone into the aircovered in bloodparking garagemental institutionhatredmakeupbathingghettoblack eyedisfigurementcastrationbonfireframed for murdermental patientyellingtaking a photographlevitationneedlefolkloreforced to stripdead animalkilling a dogurban legenddiscoverybeeabandonmentgang violenceframedurban decaykidamputationbeliefmacabrealtarsecret passageaggressionhookbudweiserlifting female in airmuralhidden roomdead babyslide projectorrottweilerpublic restroomtall mandeath of doghousing projectlifting an adult into the airpast lifecheating on wifelynch mobfalse accusation of murderswarmdisbeliefdisembodied voicepolice lineupsociologistapartment complexaccused of murderfilthraw meatkiller beemedicine cabinetviciousnessbathroom mirrorbloody maryafter lifehook for a handhole in a wallabusive policemanloathingrepulsioncandymanloss of penisvacant apartmentdisbelieving authorityburnt hairhypnotized cast (See All)

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
tragedypsycho thrillerslasher flickamerican horror
Themes:
mysterious deathdeathmurdersuicidekidnappingrapetorturepsychopathbrutalitydysfunctional familyinsanitysadismevilhome invasionpolice investigation β€¦murder of a police officer (See All)
Mood:
goreslasherdarknessblood and gore
Locations:
townsmall townstrip club
Characters:
teenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillervillainpsychiatristsheriffterrorslasher killerserial murderer
Period:
1970s
Story:
violentcreepysexfemale nuditybloodmale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifechasepistol β€¦woman on topbeatingcorpseblood splatterremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordsubjective camerastrangulationmassacrestabbingthroat slittingimpalementstabbed to deathstabbed in the chestjokechild in perilcontroversygraveyarddrowningauthorbeaten to deathstabbed in the backattackuniformcharacter's point of view camera shotevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplattermaniackilling an animalelectronic music scoremass murderlifting someone into the airrageloss of friendpsychopsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalbutcherheadphonesperversionmurder of a childdark pastbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerpsycho killerhit with a baseball batpervertmexican americanserial murderpsychopathic killerbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneslashingschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricideknife murderbloody violencebutcher knifeloss of familyfemale victimsadistic psychopathmurder spreedying during sexanimal killingmass murderervillain not really dead clichebutcheryjack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidepsycho terrormidwestweirdomichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witches Of Eastwick (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witches Of Eastwick (1987)

All three previously married but now single, best friends sculptress Alex Medford, cellist Jane Spofford and writer Sukie Ridgemont are feeling emotionally and sexually repressed, in large part due to the traditional mores overriding their small New England coastal town of Eastwick. After their late β€¦st conversation lamenting about the lack of suitable men in Eastwick and describing the qualities they are looking for in a man, mysterious Daryl Van Horne and his equally mysterious butler Fidel arrive in town. Despite being vulgar, crude, brazen and not particularly handsome, Daryl manages to be able to tap into the innermost emotions of the three friends, and as such manages to seduce each. In turn, the three women blossom emotionally and sexually. After an incident involving one of the town's leading citizens, the ultra conservative Felicia Alden, the three women begin to understand how and why Daryl is able to mesmerize them so fully. The three decide to experiment with some powers learned indirectly from Daryl so that they can hopefully regain control of their own lives. (Read More)

Subgenre:
black comedy
Themes:
friendshippregnancymagicseductionsupernatural powerbreak updevilbook of magic
Mood:
mysteriousrainhigh school
Locations:
townschoolchurchswimming poolsmall townbicyclenew england
Characters:
childrenfemale protagonistteachermusicianbabywritersingle motherwitch
Story:
newspaper headlinenewspapersexbased on noveldogbare chested malekisssurprise endingfirefoodfalling from heightsunglassesbedtelephonesubjective camera β€¦bedroomvideo cameramansionsnakeanimalcigar smokingflash forwardargumentumbrellacharacter's point of view camera shotlightningamerican flagchildbirthobscene finger gesturesingle parentoccultfalling down stairsballoonlifting someone into the airoverallswitchcraftblockbusterpoolclassical musicjournalismtennisviolinbroken legcynicismfeministstairsthunderstormsexual harassmentchoirattractiondivorceeblack magicriding a bicycleplaying pianonewspaper clippingpromiscuityviolinistgraduationyellinglevitationcartoon on tvhigh school teacherstereotypebicyclingperformerglasscellochandelierhorninessfeathersome scenes in black and whitebattle of the sexesoverhead camera shothusband murders wifedeal with the devilmagic spellmusic teachersnoringchurch servicemartinitennis courtspinstertantrummusical performancetennis playerplaying violincherrycaught in the rainvoodoo dollgrocery shoppingtennis racketpart stop motiontennis ballfemale musicianman wearing a tuxedostring quartethexvomiting on someoneice cream parlorchauffeured limousineman with a ponytailplaying celloprojectile vomitingslip and fallsoul sellingfood marketschool bandband practicefalling into a poolwoman wearing a one piece swimsuitsculptressconjurersoaking wetbare foot womanclassical concertwind stormmale musicianstemdining al frescoperfect manspoon feedingclay sculpturepink rosehanging from a chandelierhit with a tennis ball (See All)

Dead Silence (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Dead Silence (2007)

Every town has its own ghost story, and a local folktale around Ravens Fair is about a ventriloquist named Mary Shaw. After she went mad in the 1940s, she was accused of kidnapping a young boy who yelled out in one of her performances that she was a fraud. Because of this she was hunted down by town β€¦speople who in the ultimate act of revenge, cut out her tongue and then killed her. They buried her along with her "children," a handmade collection of vaudeville dolls, and assumed they had silenced her forever. However, Ravens Fair has been plagued by mysterious deaths around them after Mary Shaws collection has returned from their graves and have come to seek revenge on people that killed her and their families. Far from the pall of their cursed hometown, newlyweds Jamie and Lisa Ashen thought they had established a fresh start, until Jamie's wife is grotesquely killed in their apartment. Jamie returns to Ravens Fair for the funeral, intent on unraveling the mystery of Lisa's death. Once reunited with his ill father, Edward, and his father's new young bride, Ella, Jamie must dig into the town's bloody past to find out who killed his wife and why. All the while, he is doggedly pursued by a detective who doesn't believe a word he says. As he uncovers the legend of Mary Shaw, he will unlock the story of her curse and the truth behind the threat from a rhyme in his childhood: if you see Mary Shaw and scream, she'll take your tongue. And the last thing you will hear before you die...… (Read More)

Subgenre:
ghost story
Themes:
ghostdeathmurderrevengefuneraldeceptionsupernatural powerdeath of wifemurder of family
Mood:
mysteriousraincar chase
Locations:
towncemeterysmall townapartmentmotel
Characters:
childrenhusband wife relationshipfather son relationshipdetectiveolder man younger woman relationshipstepmother stepson relationshipghost in mirror
Story:
localbloodflashbackphotographsurprise endingfirecorpseshotguncamerafalling from heightflashlightmansionmappolice officer killedtheater β€¦gravelegendcursescreamingclownpuppetwidowerdolldisappearancebasementsuspicionstageunderwaterchild murderpoemshavingfireplacerevelationgothicloss of wifepump action shotgunshovelrowboatdeath of protagonistrosetuxedolooking at self in mirrorlanterndead boydead woman with eyes openmannequinphoto albumclose up of eyesurban legendspiral staircasetombstonefalling into waterwhisperingfilm starts with textswimming underwaterhearsewheelchair boundmacabrefuneral homecoughing bloodclose up of eyeevil clownpackagestraight razorrocking chairmorticiantrail of blooddiscovering a dead bodybegins with textventriloquistpregnant woman murderedgrave side ceremonyextreme closeupsevered tonguedummyimitationmissing person posteroxygen tanktongue cut outfamily portraitdeath of pregnant womandripping waterhiding under the coverstongue rippingfamily photoventriloquismcoughing up blooddeath of expectant motherends with dedicationdeath starewhistling kettledigging up a gravefall through floordripping faucetdigging grave (See All)

The Grudge (2004) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Grudge (2004)

Karen Davis, an American Nurse, moves to Tokyo and encounters a supernatural spirit who is vengeful and often possesses its victims. A series of horrifying and mysterious deaths start to occur, with the spirit passing its curse onto each victim. Karen must now find away to break this spell, before s β€¦he becomes its next victim. (Read More)

Subgenre:
supernaturalpsycho thriller
Themes:
ghostdeathmurdersuicidemarriagejealousyadulteryfearsupernatural powerdating
Mood:
mysteriousgoreneo noirhorror movie remakemurder suicide
Locations:
hospitalcemeterybathtubbuselevatorjapanpolice caroffice
Characters:
family relationshipshusband wife relationshippolicemother son relationshipboyfriend girlfriend relationshipbrother sister relationshipfemale protagonistteacherpolice officernursedetectivelittle boysecurity guardjapanesepolice detective β€¦professorterroramerican (See All)
Story:
seriesflashbackmale frontal nuditytwo word titlephotographsurprise endingshowercell phonecorpsecomputercatfalling from heightstabbingnonlinear timelineritual β€¦old womandrowningstalkercursemissing persondiaryneck breakingfirst parthaunted housearsonwaitergothicragemorguecrime scenetokyo japanvisionsonhousewifeatticbalconysocial workerbuddhismloss of husbandgothreal estate agentvideo surveillanceclosetelderlymailshockmurder of wiferealtorpet catsurveillance footagevcrvideo cassettestairwellghost childfilicideinter culturalsinkspider webcarecatatoniaremake by original directorwraithremake of japanese filmdrowning someonebroken electronic workssevered jaw (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

An American Werewolf In London (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An American Werewolf In London (1981)

Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β€¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)

Subgenre:
supernaturalcult filmblack comedysuspensetragedypunkfish out of watercreature featuremonster movie
Themes:
deathmurderfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalitysupernatural powerparanoiapanichomelessness β€¦murder of a police officermurder of family (See All)
Mood:
goresatirenightmaremurder of a boy
Locations:
woodsvillagehospitaltrainforestcemeterybuslondon englandtaxirural settingapartmentpolice carenglandtrucktaxi driver β€¦laboratorysex in shower (See All)
Characters:
policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β€¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All)
Period:
1980s
Story:
newspaper headlinelocalsexfemale nuditynuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditymale rear nuditydogbare chested malesex scene β€¦female rear nuditycigarette smokingknifechasesurprise endingshowertopless female nuditydreamcorpseshot to deathblood splattermachine guncar accidentshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedcar crashvoyeurtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmpremarital sexsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubundeadmonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorcomared dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All)

It (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It (2017)

In the Town of Derry, the local kids are disappearing one by one, leaving behind bloody remains. In a place known as 'The Barrens', a group of seven kids are united by their horrifying and strange encounters with an evil clown and their determination to kill It.

Subgenre:
supernaturalamerican horror
Themes:
deathmurderfearmonstermemoryracismpsychopathbrutalitysupernatural powersadismbullyingabductionhomophobiacrueltychildhood β€¦cannibalismmadnessmissing childunlikely friendshipschool bullyingsupernatural powers (See All)
Mood:
gore
Locations:
schoolforestsmall townbicyclesewernew boy in town
Characters:
childrenpoliceteenagerzombieserial killerbullylittle boyvillainjewchildhood friendbar mitzvahboy in underwearevil father
Period:
1980ssummeryear 1989year 1988
Story:
localkillnewspaperbased on novelbloodviolenceone word titleflashbackkisstitle spoken by characterblood splattercatbattlepaintingbook β€¦bathroompianodemongay slurchild abusechildcoffinchild in perilcreaturelibraryclownmissing persondeath of brotherbasementbrothermurdererfirst partsevered armkillinggaragesplattermaniacsistereyeglassesballoonstreetsexual abusemutilationoverallspsychocovered in bloodinterracial friendshipeaten aliveswitchbladebraverystabbed in the throatbutcherpedophilemurder of a childturtleabusive fatherbroken armcellarkilling spreeloss of brotherpsycho killerheroismunderdogpervertspittingpsychopathic killerbad guygirl in bra and pantiesoutcastwoodabandoned housebicyclinghomicidal maniacwellpharmacybare chested boypatricideparentraininggraphic violencejumping into watercleaningchild molesterfourth of julystutteringbloody violenceteenage girl in underwearpool of bloodreference to michael jacksonoverbearing mothersadistic psychopathold houseghoulglowing eyesevil clowncreepsidewalkdeeply disturbed personarm ripped offchild swearingchild killeddutch angleflickering lightkiller clownscreaming in fearpocket knifechild killercamaraderiemonsterschild murdererdisturbinghypochondriachit with a rockmissing person posterscreaming in horrorsinkserial child killerfamily lifechild smoking cigaretteimplied incestadultererbitten in the facehell on earthinhalertraumatic childhoodviolence against a childeaster eggstorm drainslideshowdark killerheadless corpseleperplaster castreference to metallicaserial teen killerarm in a casthiding in a bathroomprojectortraumatic childhood experienceblood oathson kills fatherred balloonsadistic killerchildhood crushserial child murderevil creaturefear of clownscutting own hairmissing boystuttering characterthrowing stonesserial child murdererserial killerssexual child abuseslut shamingboy wearing glassesclosed doorreference to clark kentbullying victimfloating in the airpainting comes to lifecutting one's own hairdisappearance of a childflooded basementkilling a sheepreference to molly ringwaldthrown down a wellcutting the palm of one's handpaper boatreference to lois lanereference to new kids on the blockarm bitten offcarving into human fleshchild eaterchild rapistclown dollcursessheep farm (See All)

Searching For Sugar Man (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Searching For Sugar Man (2012)

In the early 1970s, Sixto Rodriguez was a Detroit folksinger who had a short-lived recording career with only two well received but non-selling albums. Unknown to Rodriguez, his musical story continued in South Africa where he became a pop music icon and inspiration for generations. Long rumored the β€¦re to be dead by suicide, a few fans in the 1990s decided to seek out the truth of their hero's fate. What follows is a bizarrely heartening story in which they found far more in their quest than they ever hoped, while a Detroit construction laborer discovered that his lost artistic dreams came true after all. (Read More)

Themes:
drugschristmasmoneypoliticsfearmemoryracismpovertyparanoiadrug useprejudicerevolution
Mood:
archive footage
Locations:
barsnowairplanelos angeles californialondon englandairporturban settinginner city
Characters:
husband wife relationshipfather daughter relationshiptattoosingerdetectivemusicianartistreference to godamericanmayorgrandfather grandson relationshipstepfather stepson relationship
Period:
1980s1970s2010syear 1968year 1997year 1996year 1998year 1973year 1971year 1970
Story:
newspaper headlineinspirationreadingnewspaperinterviewbare chested malephotographsingingtelephone callsongslow motion scenewatching tvsunglassesreference to jesus christguitar β€¦telephonereportersubjective cameragay slurbandconcertsearchpainlimousinemicrophoneprotestlightningdisappearancerock 'n' rollisolationsadnessreunionelectionpoetwhat happened to epiloguelistening to musicfamerecordinghappinessguitaristworking classhollywood californiarehearsalrebelaudiencehome moviesouth africapresumed deadcensorshipnicknamethunderspanishsong in titlefogsongwritersnowingcontractmexican americanreference to elvis presleyoppressionoutcastdrifterconstruction workerurban legenddetroit michiganautographamsterdam netherlandsmusic industrypaparazzicdhollywood signepilogueafrikaansnickname in titleapartheidcomebacksinger songwritericonprophetmusic historyspotlightoverhead shotreference to madonnamusic storemusic businessmusic producerreference to the rolling stonesbig ben londoninterviewerblue collarprivacyreference to bob dylanreference to sherlock holmesreference to james deanreference to jimi hendrixcd playeryear 1955bass guitarlyricsanti establishmentboycottcity councilopening a windowpeace signcarpentrymusic tourdark glassesfolk singerfan the personbootleggingbuilding demolitionreference to stevie wonderrecording artistanthemmodestyreference to nazi germanyreference to californiastage namestreet demonstrationbricklayerlosing a jobfailed artistgold recordreference to marvin gayereference to woodstocklp recordingwebpagemusic productionsinging idolmusic censorshipdemo recording (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Fido (2006) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fido (2006)

In an Earthly world resembling the 1950s, a cloud of space radiation has shrouded the planet, resulting in the dead becoming zombies that desire live human flesh. A company called Zomcon has been able to control the zombie population. Zombies can be temporarily neutralized by being shot, but can onl β€¦y be permanently neutralized by their brain being destroyed. Their ultimate disposal is through cremation, or burial, the latter which requires decapitation with the head being buried separately from the body. Conversely, Zomcon has created the domestication collar, when activated and placed on a zombie makes the zombie controllable and thus an eternally productive creature within society. Because all dead initially become zombies, the elderly are viewed negatively and suspectly. And all people, adult or child, learn to shoot to kill to protect society. Zomcon is the go to organization for all things zombie. In the town of Willard, the Robinsons - father Bill, mother Helen, and adolescent son Timmy - are one family who don't own a zombie as a domestic since Bill is afraid of zombies, as, when he was a child, he had to shoot his own zombie father, who tried to eat him. Bill has thus become fascinated with funerals to see zombies put away permanently. But Helen feels pressured to get a zombie when Zomcon's new head of security in Willard, the officious Jonathan Bottoms, moves into the neighborhood with his family. Never having had to deal with a zombie directly, Timmy is initially wa… (Read More)

Subgenre:
cult filmblack comedy
Themes:
deathmurderfriendshippregnancyfuneralmonsterexploitationcrueltycannibalismfirst loveunlikely hero
Mood:
goresatirespoofmurder of a boy
Locations:
towncemeterykitchen
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipboyfriend girlfriend relationshipboyzombiewarriorbully
Period:
1950s
Story:
newspaper headlinekillrunningcharacter name in titleone word titlekisscigarette smokingchasemachine gunshot in the chestshot in the headslow motion scenewatching tvdead bodyneighbor β€¦classroomdecapitationsevered headcoffinhit by a carcreatureold womanshot in the foreheadbeaten to deathsuburbscreamsevered armeaten aliverampageremote controltarget practicechild's point of viewchild protagonisthousewifemurder of a childsiegedead boysevered legneighborhood12 year oldfenceacidpeer pressurehazingunplanned pregnancykiller childzombie violencedelivery manevil corporationzombie attackgrave diggingevil childconformitytied to a treechild with a gunchild killerzombie childnext door neighborleashmass destructionwalkercanuxploitationreal life mother and daughter playing mother and daughterloud shirtchild as main characterchild uses a gunmultiple monsterswashing a carlawn mowingboy in perilboy dog relationshipbb guncrossing guardboy in dangerbloodthirstylove slaveemotionally unavailable (See All)

The Fog (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (2005)

The inhabitants of Antonio Island, off the coast of Oregon, are about to unveil a statue honoring the four men (Castle, Wayne, Williams and Malone) who founded their town in 1871. Nick Castle is one of the descendants of the men, and owns a fishing charter company, using his vessel, the Seagrass, fo β€¦r tourism. When his girlfriend Elizabeth Williams returns to the island after spending six months in New York, a bizarre series of events begin to occur, including several gruesome deaths and the presence of a mysterious fog. When Elizabeth slips in Nick's boathouse and falls into the sea, she finds an old journal from 1871, written by Patrick Malone, one of the town's founders. It tells how a man named Blake bought half the island for use as a leper colony. While bringing his people to Antonio Island in their clipper ship, the Elizabeth Dane, Blake is betrayed by Castle, Wayne, Williams and Malone. The four men locked Blake and his people in the vessel, stole their money and possessions, and then set fire to the ship, killing everyone aboard. In the present day, the ghosts of Blake and his crew have risen from their watery grave to seeking revenge on the descendants of the four men. (Read More)

Themes:
ghostdeathmurderrevengefearsupernatural powergriefwealth
Mood:
mysterioushorror movie remake
Locations:
townhospitalbeachcemeterysex in showerfishing boatship on fire
Characters:
mother son relationshipmother daughter relationshipafrican americanboyfriend girlfriend relationshippolice officerpriestsingle motherlittle boymayor
Story:
ghostsseriesflashbackbare chested maledancingphotographknifepantiesdreamcorpsecar accidentremakewatching tvcomputerheld at gunpoint β€¦tearscar crashislandflashlightvideo cameraambulancestabbed to deathfishwhite pantiesfishingmicrophoneperson on firestorytellingstatuescreamcharacter says i love youunderwaterrecord playerburned alivelifting someone into the airmorgueheadphonesrowboatthrown through a windowfogstabbed in the eyepiercharacters killed one by onelighthousecar troublefire extinguisherapparitionjournallighterwebcamwatchradio stationparamedicbellhit by a truckstretcherartifactfilmed killingoregonmetal detectordisc jockeywoman in a bikinimonumentdeath by drowningghoulradarfootprintsailing shipmarinabedriddenpower failurephonograph recordstealing moneyoathdinner tableoil lamptwin sisterscaught in a netgoogleanchorremake of cult filmradio broadcastingexhibitleprosytown hallbeer canlost at seaweathermanknife in the headdeath by firejeopardyfoundationreflection in eyeleperstabbed with glassturntablecar falls into waterseaweedpower stationthrown from a boatthrown into waterfounding fatherstrapped in a careyes sewn shutradio disc jockeyweighing scalesisolated townhallmark (See All)

Odd Thomas (2013)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Odd Thomas (2013)

Small-town fry cook Odd Thomas ('Anton Yelchin' (qv)) is an ordinary guy with a paranormal secret: he sees dead people, everywhere. When a creepy stranger shows-up with an entourage of ghostly bodachs - predators who feed on pain and portend mass destruction - Odd knows that his town is in serious t β€¦rouble. Teaming up with his sweetheart Stormy ('Addison Timlin' (qv)) and the local sheriff ('Willem Dafoe' (qv)), Odd plunges into an epic battle of good vs evil to try to stop a disaster of apocalyptic proportions. Based on the best-selling thriller by Dean Koontz. (Read More)

Subgenre:
paranormalsupernaturalindependent filmblack comedyconspiracyparanormal phenomena
Themes:
ghostdeathmurderrevengesurrealismkidnappingfearescapeheroinvestigationdeceptionmemorysupernatural powerterrorismparanoia β€¦redemptionsurveillancehome invasionpanicpolice brutalitynear death experienceafterlifeunlikely hero (See All)
Mood:
neo noirnightmaredarknesspoetic justice
Locations:
townhospitalrestaurantchurchswimming poolsmall townbathtubdesertwheelchairapartmentpolice carmotelsinging in a carcar bombdesert town
Characters:
husband wife relationshippolicemother daughter relationshipboyfriend girlfriend relationshipdoctortattooprostitutepolice officernursepolicemanhostagetough guywarriorsingle motherwaitress β€¦security guardsheriffpolice shootoutdeath of girlfriend (See All)
Period:
seeing the future
Story:
localcreepycharacter name in titlebased on novelbloodviolenceflashbackdogtwo word titlekissfightcigarette smokingphotographtitle spoken by characterexplosion β€¦partyknifechasesurprise endingpistolfirevoice over narrationcell phoneshootoutbeatingdreamcorpseshot to deathblood splatterfistfightmachine gunhorsecar accidentshot in the chestshot in the headrescueslow motion scenepunched in the facecomputerwritten by directorarrestgunfightbrawlsecretshowdownheld at gunpointbombcar crashdemonhandcuffsrevolvershot in the backgood versus evilfoot chasebound and gaggedcaliforniaterroristmassacremontagedinerexploding carfalse accusationsevered headcultno opening creditsbirddisarming someoneone man armychild in perilhit by a cardouble crosscreaturepolice officer killedvanattempted murderlimousinecursedangerscreamingperson on fireuniformproduct placementrace against timecover upknocked outbaseball batopening action sceneshot in the shouldermanipulationexploding bodymanagercharacter says i love yousevered armshot in the armlas vegas nevadasilencerpsychiccorrupt copfreeze framesingle parenttwenty somethingprivate detectiveeavesdroppingburned aliverevelationeggslow motionsociopathice creamcooksecurity cameraloss of loved onespiderskullcarnivalfateanimal attackpicnicmasked mancrime scenedamsel in distressstealing a carvisionexplosivesevered fingershot in the faceshopping mallm 16police officer shotescape attemptframe uptime lapse photographybutterflyassault riflewisecrack humorblood on shirtbulletproof vestrefrigeratorbarbecuedemonic possessionterrorist plotfortune tellerkilling spreedeath of loved oneburned to deathowlnewspaper clippingframed for murdershot multiple timesprivate investigatorbullet timehit with a baseball batshot through a windownarrated by characterinvisibilitymysterious manterrorist grouppickpockettimebombfountainold dark housecockroachevil spiritpolice chiefportaldisposing of a dead bodyyoung version of charactermalltrailer homescootercheering crowdhearing voiceselvis presleyflybody in a trunkhit by a truckdeputybowling alleypremonitionman kills a womanoffscreen killingpool partyshot point blankbullet woundmeteorbomberpart computer animationtragic lovehiding under a bedexploding housewoman in a bikinitragic endingcarouselanimal killingvillain not really dead clichelocketinnocent person killedclairvoyantgas explosionpoltergeistwater fountainpancaketoothmusic storetime bombice cream conefingerdecomposing bodyrunning for your liferescue attemptchild killerloss of girlfriendjumping from a carcamel toerottweilersatanic culttiredevil worshipgas chamberblowing a kissclairvoyancestartledable to see the deadbirdcagechased by a dogdomestic terrorismfictional townmilkshakesatanicseeing dead peoplewalking on waterdead body in a bathtubice cream parlorstorm drainpushed into a swimming poolexploding trailerhouse explosioncoitus interruptuscontemporary settingbarbecue grillsevered toesweethearthomemade explosiveseeing ghostscamera shot of a woman's legshotwiringshort order cookabandoned prisonice packwoman wearing a little black dressbody in a car trunkbreak door incar truck crashbluetoothdevil worshiperfalling into swimming poolvehicular accidentchurch towerdriver shotdriving licensevan explosionreloading a gunfortune telling machinehorse rideshot in facetruck car collisionabandoned restaurantsupernatural ability (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Ginger Snaps (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Ginger Snaps (2000)

Is becoming a woman analogous, in some deep psychological way, to becoming a werewolf? Ginger is 16, edgy, tough, and, with her younger sister, into staging and photographing scenes of death. They've made a pact about dying together. In early October, on the night she has her first period, which is  β€¦also the night of a full moon, a werewolf bites Ginger. Within a few days, some serious changes happen to her body and her temperament. Her sister Brigitte, 15, tries to find a cure with the help of Sam, a local doper. As Brigitte races against the clock, Halloween and another full moon approach, Ginger gets scarier, and it isn't just local dogs that begin to die. (Read More)

Subgenre:
independent filmcult filmcoming of ageblack comedydark comedycreature feature
Themes:
deathmurdersuiciderapepregnancydrinkingtorturedrunkennessobsessionsupernatural powerdrug usecancerphotography
Mood:
goresatirehigh schoolnightmaresocial satire
Locations:
woodsschoolforestbathtubschool nurse
Characters:
policefather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipboyteenage girlteenage boyfemale protagonistteachernursestudentdancerphotographersister sister relationship β€¦witchgirl fightself cutting (See All)
Story:
deeplocalclassrunningsexf ratedcharacter name in titlebloodviolencemasturbationdoggunkissfightcigarette smoking β€¦dancingphotographpartyknifepantiesbeatingcorpseblood splatterurinationwatching tvcameradrinkcondomvomitingshowdowndead bodymarijuanaclassroomhalloweenflashlightcandlestabbingdrug dealerthroat slittingimpalementtoilethit by a carvanlatex glovespaincursevirginsuburblocker roomfirst of seriespoisonmissing personbaseball batflowershanginginjectionexploding bodybasementfirst partobscene finger gesturefireworksredheadgaragechainsawwerewolffalling down stairspot smokingwolfloyaltywoundhypodermic needlegothicinjuryvirusstabbed in the stomachwatching a moviecovered in bloodburialanimal attackmilkdrug dealingfull moonpromisejanitorsevered fingerplaygroundstabbed in the throatkickingshovelinfectionswingfamily dinnerbroken armdead boymutationhalloween partydead dogdead girlgothporn magazinemenstruationhairkilling a dogpubertypolaroidbeast16 year oldurinepiercinggreenhousewormsense of smellbleedingbiologyteethloss of sistermicroscopecureclawbechdel test passedpitchforkshapeshiftingcoughing bloodgoth girlbludgeoningx rayed skeletonbitten in the throatslide showfurdrugstoretamponflickering lighthuman becoming an animallawn moweroathdrinking bloodface ripped offdark heroineslide projectorhowlingroadkillsuicide pacttea partysilverfake bloodfake suicidefield triptailhockey stickschool lockercanuxploitationentrailsguidance counselorlearning to driveneon lightlycanthropyvowwatching a movie on tvmenarchepactlaxativerocking horsesilver bulletboys' bathroomstdfemale werewolfsupernovableachgirls' bathroomdetoxtesticular cancerfingernaillycanthropespilled milkbelly button piercingpmslocked in a bathroomsandboxaccidental stabbinggasoline cannavel piercingcheckout clerkpicket fenceeating a wormraking leavesspinestreet hockeysuspected paedophilecrampteaching someone how to drivecanadian gothicfield hockeyhomeopathykicking a dogovulationathletic fieldmetabolismsanitary napkingrowing marijuanawhite blood cellhair curlerinjection into one's neckpawclaw markdeep freezerobsessed with deathurinating bloodbitten by an animalblood sisterdiet pillshit with a hockey stickscrewdriver the toolwolfsbane (See All)

The Fearless Vampire Killers (1967) is one of the best movies like Sideworld: Damnation Village (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fearless Vampire Killers (1967)

The elderly bat researcher, professor Abronsius and his assistant, Alfred, go to a remote Transylvanian village looking for vampires. Alfred falls in love with the inn-keeper's young daughter Sarah. However, she has been spotted by the mysterious count Krolock who lives in a dark and creepy castle o β€¦utside the village... (Read More)

Subgenre:
gay interestcult filmhorror spoofgothic horrorvampire comedy
Themes:
kidnappingmonsterincestabduction
Mood:
mysteriousspoofgay vampire
Locations:
villagesnowbathtubrural settingcastle
Characters:
husband wife relationshiphomosexualfather daughter relationshipvampireteacher student relationshipmaidprofessorreligious art
Period:
winter19th century
Story:
creepymirrorbedroomanti herocoffinbathspankingwritten and directed by cast membercountrysideundeadgothiccrucifixhammercannonwoman in jeopardy β€¦damsel in distressdark humorimmortalityballfallskiingsnowingaristocratirreverencebatfolklorehomagefreakfemale vampirecostume partyinnsnowmanvampire hunterfamous linecrypthunchbackvampire slayertransylvaniastaketalismaninnkeepergarlicsleighlooking through a keyholebreakfast in bedkicked in the buttbloodsuckerbumblersexy female vampirenoblefrozen corpsecostume horrorlecherysauerkrautassistance (See All)

Men (2022)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Men (2022)

In the aftermath of a personal tragedy, Harper retreats alone to the beautiful English countryside, hoping to find a place to heal. But someone β€” or something β€” from the surrounding woods appears to be stalking her, and what begins as simmering dread becomes a fully-formed nightmare, inhabited b β€¦y her darkest memories and fears. (Read More)

Subgenre:
folk horrortragedybody horror
Themes:
deathlovesuicidepregnancyfearmonsternatureangersupernatural powergriefhome invasiontrauma
Mood:
gorerainnightmaresurreal
Locations:
townwoodsvillagechurchbathtublondon englandrural settingkitchentunnelcar theftkitchen knife
Characters:
husband wife relationshipteenage boyfemale protagonistpolice officerpolicemanreference to god
Story:
playingcreepyserieskeynuditybloodmale nudityviolenceone word titleflashbackmale full frontal nudityknifetelephone call β€¦cell phonecar accidentslow motion scenepunched in the facewritten by directorfalling from heightmaskdead bodyhallucinationhandcuffsmale pubic hairf wordsubjective camerabedroomstabbingmontagewidowhouseapologyhit by a carflash forwardstalkerscreamingvacationsuitcaseattempted rapepianistcountrysidecrosschildbirthhauntingpolicewomanreference to william shakespearepubteacrying womancovered in bloodhomeapplepromisethunderlaughterintruderloss of husbandclonesymbolismabandoned buildinggiving birthpresentnudename callinglooking out a windowstabbed in the arminterracial marriagehusbandepiloguecountry househandopen endedfemale police officertormenttextingtext messagenakedman hits a womanhatchethide and seekquestionscreaming womancrossword puzzleflickering lightbloody facegender rolesgrievingvicarfemalelooking in a windowlost in the woodsstained glass windowpenis slurwoman in a bathtubheavy breathingdead deerechoafrican anglonaked manvisualdreadhorror filmelectric toothbrushapple treereflection in a mirroreating an applemale pregnancyvideo calldandelionmalebrushing one's teethimageryspousal abusegraphic nuditylocking a doorlondon bridgegender in titlefacial maskb wordfeelingreference to ulyssesford fiestahandcuffed mansound designsilent screamthreaten to killforce of natureanglican priestblack anglohouse tourmusic video directorreligious imagerywearing a maskbloody bodyout of reachvacation gone wrong (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Sideworld: Damnation Village?
<< FIND THEM HERE! >>