Best popular movies like Sleepaway Camp:

Do you need specific genre & keyword selection to find films similar to Sleepaway Camp?
<< FIND THEM HERE! >>

Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sleepaway Camp (1983)

After a horrible boating accident kills her family, Angela, a shy and sullen young girl, moves in with her eccentric aunt Martha, alongside her protective cousin Ricky. One summer, Martha sends the kids to Camp Arawak. Soon after their arrival, a series of bizarre and increasingly violent accidents  β€¦begins to claim the lives of various campers. Who is the twisted individual behind these murders? The disclosure of the murderer's identity is one of the most shocking climaxes in the history of American cinema. (Read More)

Subgenre:
psycho thrillerlgbt horrorindependent horroramerican horrorb horrorb moviecult filmindependent film
Themes:
wildernesstraumaevilhumiliationinsanitydeath of fatherbrutalitypsychopathcorruptiondancefearmurderdeath
Mood:
darknessslashernight
Locations:
boat accidentbackwoodsbaseballlakekitchenwoodswaterbeach
Characters:
mysterious villainslasher killermysterious killeraunt nephew relationshipcousin cousin relationshipterrorsheriffvillainfemale protagonistteenage boyteenage girlpolice
Period:
1980s
Story:
psycho terrorscalded facebee attackbee stingcapture the flagwhite briefsshot with an arrowsexual perversionpsycho killercamp vacationhomicidal maniacsexual attractionsummer vacationplaying baseballevil woman β€¦female villainbaseball gameaxe murderboys' bathroomhot waterwater balloonboiling waterwater skiingfemale psychopathman in underwearmurdered in a showerfemale in showersmothered to deathreference to burt reynoldsbee's nestmen sharing bedteenage murdererdramatic ironycurling irontubesocksscaldedcult favoritesee through clothesupstate new yorkunknown killerfriendship between teensscufflearchdegenerationcamp counselorsailing boatbad girleast coastsummertimeends with freeze framemurder of a nude womanburned bodymurder spreefemale serial killerknife murdermystery killerhostilitychild swearingsleeping baggrindhouse filmdepravitybutcheryloss of familychild molestersexual repressionsitting on a toiletlifeguardmurderessmenacepotmotorboatvolleyballboy with glassesserial murderslashinglaundromatbeesummer campshot in the neckcanoeshortspsychopathic killershynessflagpractical jokesuffocationpervertarrowdark pastbriefsattractionperversiondead childpedophileitalian americanbutchermercilessnesssandaccidental deathpsychomass murdercowboy hatnipples visible through clothingsurvivorteen angstidentitytransvestitemaniacobscene finger gesturedirectorial debutfirst partcabindeath of childhairy chestscreamcharacter's point of view camera shotvacationfirst of seriesstabbed in the backdrowningcontroversyscantily clad femalesevered headsnakestabbed to deathstabbingaxeflashlightsubjective cameracleavagedecapitationbathroomlow budget filmvomitingsecretbrawlbikiniblondeblood splatterunderwearbeatingshowersurprise endingmale full frontal nuditybare chested malemale rear nudityfemale nuditytwo word titlebloodkissflashback (See All)

Friday The 13th (1980)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (1980)

One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspenseslasher flickteen moviemurder mysteryteen horror
Themes:
traumaevilhumiliationinsanitybrutalitypsychopathcorruptionfeardeathmurderrevengevoyeurismsadismcrueltymysterious death
Mood:
darknessslashernightgoreblood and gore
Locations:
lakewoodswatercarmotorcycleboatrural settingpolice cartruck
Characters:
mysterious villainslasher killerterrorsheriffvillainteenage boypoliceteenagerfriendpolice officerserial killerpolicemanartistkillermother β€¦truck driverserial murderer (See All)
Period:
1970s1950ssummer
Story:
psycho terrorsexual perversionpsycho killercamp vacationhomicidal maniacsummer vacationevil womanfemale villainaxe murderfemale psychopathunknown killercamp counselorbad girleast coastmurder spree β€¦female serial killerknife murdermystery killergrindhouse filmbutcherysexual repressionmurderessmenaceserial murderslashingsummer campcanoepsychopathic killershortsarrowperversionbutchermercilessnesspsychonipples visible through clothingmaniacfirst partcabindeath of childfirst of seriessnakestabbed to deathstabbingaxesubjective cameradecapitationlow budget filmbikiniblondeblood splatterbeatingsurprise endingbare chested malemale rear nudityfemale nuditykisssexnumber in titlemale nudityviolencebare breastsfemale rear nuditynipplesthree word titlepantiescorpsedigit in titlefistfightslow motion scenethongbeerrunningdead bodymarijuanahallucinationvoyeurguitarbedroombracandleold manmassacrewomanthroat slittingdineraccidentcultdream sequenceskinny dippingstrippingdangerprologuescreamingmoaningprankinjectionstalkingdeath of sonmurdererkissing while having sexkillingteenage sexfreeze framegirl in pantiesrevelationdesireelectronic music scoredressjeepgothicheavy rainmachetehatstabbed in the stomachhammervillainessswimsuitgrindhousevictimdead womanfull moonrampagebra and pantieslow budgetnew jerseystabbed in the throatobesitypower outagemutepsychotroniclostthunderstormbathingdisembowelmentsurpriseatticdead manslaughterbody countlens flareroomcharacters killed one by onekilling spreedeath of loved onetank toppsychoticphysical abuset shirtjoysexual awakeningbeheadingcar troublemysterious mandead animalhuman monsteradolescencerepressionrestroomjacketdying mandripping bloodrobeactual animal killedday in titleshirtmurder witnessextreme violencefamous scoreanthropologydisfigured facegraphic violenceorchestral music scoremultiple murdergame playingbowboard gamepillowbloody violencesole survivortraumatic experiencefemale victimsadistic psychopathwet clothesgrudgeoff screen murdervillain not really dead clichemurder victimcrime spreecurtaintroubled teenblond boybitingsweateraxe in the headmultiple homicidemistreatmentweirdoawakeningdate in titledead teenagerdisturbinglost in the woodsraincoatobese womanvillainess played by lead actressblousegiallo esqueremadesadisticdark and stormy nightdrive in classicmutilated corpsedeath by impalementaxe murderercampfire storygruesomejason voorheesbody mutilationfriday the thirteenthatonal music scoremachete mutilationmonopoly the board gamepsycho filmknife through the neckserial teen killercanoeingtrailer narrated by don lafontainekilled with an arrowfemale victimsstormy nightscore employs electronic instrumentsnaked bathingwoman taking off pantsemotionally disturbed personwessex county new jerseycrystal lake new jerseyjerseyelectrical generatorkilled with machetevoice impressionistquietunstable teenager (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: The Final Chapter (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: The Final Chapter (1984)

Thought to be killed by the sole survivor of the last massacre at Camp Crystal Lake, Jason Voorhees kills his way back to the camp to once again murder its inhabitants. This time, has Jason met his match in the little boy Tommy Jarvis?

Subgenre:
psycho thrillerindependent horroramerican horrorcult filmbody horrorsadistic horror
Themes:
evilinsanitybrutalitypsychopathmurderdeathtorturesupernatural powersadism
Mood:
slashergorebreaking the fourth wallblood and gore
Locations:
hospitalsex in showersex in a bathroom
Characters:
mysterious villainslasher killermysterious killerterrorvillainteenage boyteenage girlbrother sister relationshipserial killerkillerserial murderer
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniacsexual attractioneast coastmurder of a nude womanmurder spreeknife murdergrindhouse filmbutcheryserial murderslashingsummer camppsychopathic killerbutcher β€¦psychosurvivormaniacobscene finger gesturecabincharacter's point of view camera shotstabbed in the backsevered headstabbed to deathsubjective cameradecapitationlow budget filmblood splatterunderwearsurprise endingmale rear nudityfemale nuditybloodsexnumber in titlemale nudityviolencebare breastssequelfemale frontal nuditymasturbationfemale rear nuditypantiescorpsemaskstrangulationimpalementchild in perillooking at the cameraskinny dippingevil manstalkingpremarital sexmurdererloss of motherkillinglifting someone into the airragemutilationmorguefourth partgrindhousetowelback from the deadmasked manrampagerednecknew jerseyhit in the crotchstabbed in the neckstabbed in the headdisembowelmentslaughterdisfigurementbody landing on a carbody countcharacters killed one by onekilling spreemasked killerbad guycar troublemadmanmysterious manstabbed in the handkillhuman monstershot in the eyehillbillymeat cleavernaked dead womanextreme violencegraphic violencestabbed in the facemasked villainbloody violencedeformitylunaticsadistic psychopathvillain not really dead clichedisturbed individualcrime spreedeeply disturbed persondisturbinghockey masklifting a female into the airruraltorturergiallo esquesequel to cult filmstabbedboogeymandrive in classicskull crushinggory violencegruesomejason voorheeshead shavingcorkscrewmutilated bodyfriday the thirteenthaxe in the chestmachete mutilationknife through the neckserial teen killertrailer narrated by don lafontainesadistic killerdeformedtwin actresses for twin sisterswessex county new jerseycrystal lake new jerseynose pushed into brainserial teen murdererslaughteredmurder in a shower (See All)

Friday The 13th Part 2 (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part 2 (1981)

Months after Alice beheaded psycho killer/mother Pamela Voorhees at Camp Crystal Lake, survivor Alice is still traumatized because of the murders. But there is one problem. Mrs. Voorhee's son Jason never drowned and died.So he saw Alice behead Mrs. Voorhees. Jason finds Alice soon and murders her. F β€¦ive years later a camp counselor in training program begins at Campanack Lodge. Right near Jason's home.Camp Crystal Lake. As teenagers in the program start snooping around Camp Crystal Lake, they start getting killed violently one by one. (Read More)

Subgenre:
psycho thrillerindependent horroramerican horrorb horrorcult filmsuspense
Themes:
evilinsanitybrutalitypsychopathfearmurderdeathexploitation
Mood:
darknessslashergore
Locations:
backwoodslakewoodswheelchairpolice carcampfirerunning through the woodschase in the woods
Characters:
mysterious villainslasher killermysterious killerterrorvillainteenagerboyfriend girlfriend relationshipserial killerkillerserial murderer
Period:
1980ssummeryear 1984
Story:
psycho terrorpsycho killerhomicidal maniaccamp counseloreast coastmurder of a nude womanmurder spreeknife murdermystery killergrindhouse filmbutcheryserial murderslashingsummer camppsychopathic killer β€¦butcherpsychomass murdernipples visible through clothingsurvivormaniacobscene finger gesturecharacter's point of view camera shotcontroversysevered headsubjective cameradecapitationbikiniblondeblood splattersurprise endingfemale nuditybloodflashbackkisssexnumber in titleviolencesequelfemale frontal nudityfightnipplespantiestelephone callcorpsedigit in titleslow motion scenecatmasksecond partdead bodynumbered sequelswimmingbrastrangulationmassacrethroat slittingimpalementjokeskinny dippingstalkerprologueevil manopening action sceneconvertiblestalkingmurdererlove interestkissing while having sexkillingsplatterchesschainsawfireplacespeargothicmachetelifting someone into the airragemutilationvillainessphone boothgrindhousevictimmasked manrampageredneckbra and pantiesnew jerseyhit in the crotchpsychotronicstabbed in the headslaughterbetrefrigeratorbody countlens flarecharacters killed one by onekilling spreepsychoticmasked killernude swimmingbad guycar troublemadmanmysterious manreturning character killed offhuman monsterfreakskirtsexual violencewetting pantshillbillyday in titletow truckparaplegicorchestral music scoremultiple murdermasked villainpitchforkbloody violencesole survivorlunaticsadistic psychopathpsychotronic filmdying during sexvillain not really dead clichecrime spreecreepkilled during sexshackmultiple homicideweirdodisturbinglifting a female into the airtrailtorturerhanged boygiallo esquesadisticsequel to cult filmboogeymandrive in classichorror movie remadesickolost dogice pickcampfire storygruesomejason voorheesdouble impalementbad jokefriday the thirteenthatonal music scoreurinating in fearmachete mutilationtea kettleviolentbrutaltrailer narrated by don lafontainegarrottingtoasting marshmallowssymphonic music scorewessex county new jerseycrystal lake new jerseychild psychologyfade to whitesack maskscare involving catserial teen murdererkilled by machetemenstrual cycledefy authorityfalse scarehand on shoulder scarelatex mask (See All)

High Tension (2003) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

High Tension (2003)

Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap β€¦s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)

Subgenre:
independent horrorb horrorb movieindependent filmsuspensesadistic horrorpsychological horrorfrench horrorhorror b movie
Themes:
evilinsanitydeath of fatherbrutalitypsychopathfeardeathmurderfriendshipsurrealismkidnappingrapetorturedeath of mothersadism β€¦unrequited lovehome invasionexploitationdeath of wifemadnessmurder of fathermurder of husbandmurder of mothermurder of brothermurder of son (See All)
Mood:
darknessslashernightgorenightmarecar chaseblood and gore
Locations:
backwoodswoodshospitalforestbathtubrural settingroad tripfrancetruckgas stationsinging in a carback country
Characters:
mysterious villainslasher killermysterious killerterrorvillainfemale protagonistteenage girlpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipfriend β€¦boybrother sister relationshipserial killerstudentbest friendkillerfrenchbest friendsserial murdererdeath of boy (See All)
Story:
psycho killerhomicidal maniacevil womanfemale villainaxe murderfemale psychopathbad girlfemale serial killermurder spreegrindhouse filmbutcherymurderessserial murderslashingpsychopathic killer β€¦suffocationpervertperversionbutcherpsychomass murdersurvivoridentitymaniacdeath of childscantily clad femalesevered headstabbingaxeflashlightsubjective cameradecapitationbathroomlow budget filmblood splattershowersurprise endingfemale nudityflashbackbloodf ratedviolencebare breastsfemale frontal nuditymasturbationdogguncigarette smokingphotographknifelesbian kisschasetelephone calldreamcorpsecar accidentmirrorurinationshot in the headshotgunslow motion sceneshootingriflesunglassesbedcar crashdead bodyneighborvoyeurtelephoneshot in the backsurvivalbound and gaggedmassacrethroat slittingimpalementstabbed in the chesthousevanon the rundollevil mandeath of brotherpursuitstalkingdeath of sondeath of husbandmurderersleepingeuropekillingblood spattersplatterchild murderchainsawfireplacekilling an animallistening to musicmutilationstabbed in the stomachsevered handgrindhousestrangerrape victimfollowing someonerapistfemale killerrampagerednecktensionsurveillance cameramobile phonegash in the facebroken glassmental hospitalplot twistmurder of a childslaughterswingclassmatebody countsexual assaultcharacters killed one by onekilling spreeparrotdead dogbeing followedblood on camera lenstaking a showerbarbed wirevideo surveillancebad guyearphonesmadmanclosetnecrophiliaminimal castkillkilling a doghuman monsterfarmhouselistening to a radiocornfieldpiercinggreenhouserazor bladeurinalexamextreme violencemurder of wifefilling stationgraphic violencestabbed in the facecar radiohiding under a beddeath of familyfeetcut into pieceslesbian subtextbloody violencebutcher knifefemale victimsadistic psychopathvineyardchainsdriving at nightdisturbed individualbludgeoningwalkmanexploitation filmcrime spreestraight razorcreepbloody body of a childdeeply disturbed personserial rapistsexual predatorgas station attendantplastic bagweirdocircular sawpadlockbreaking a car windowdoor bellmultiple personality disordergiallo esquepolice vanpsychiatric wardgory violencesickoaxe murdererpreyambient musicunreliable narratorfemale murdererjumpsuitshower curtainnecrophiliacvision of the futureaxe in the cheststabhead in a toiletstabbed with glasskeychainsex with the deadfrench shock cinemapierced belly buttonsadistic killersouthern francefemale victimsfrench cinemalesbian lead charactergas pumpslashed to deathearplugsrear ending a carpsychotic killerserial rapesolarisationfrench manserial killing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Friday The 13th: A New Beginning (1985)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th: A New Beginning (1985)

Five years after killing the goalie hockey-masked killer Jason Voorhees, Tommy Jarvis has grown up in various mental hospitals unable to get over the nightmares about Jason's return. When Tommy is sent to a rural halfway house in New Jersey for mentally disturbed teenagers, a series of grisly murder β€¦s begin anew as another hockey-masked killer begins killing off all people at and around the residence. Has Jason returned from the dead to re-start his killing spree? Has Tommy decided to take over the reign of Jason, or has someone else? (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent film
Themes:
evilinsanitybrutalitypsychopathfearmurderdeathrevengesadismexploitationpolice investigation
Mood:
darknessslashernightgorerainnightmare
Locations:
backwoodswoodscemeterysmall townamerica
Characters:
mysterious villainslasher killermysterious killerterrorsheriffvillainpolicemother son relationshipteenagerbrother brother relationshipserial killerkillerserial murderercountry boy
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniacaxe murdereast coastmurder of a nude womanmurder spreeknife murdergrindhouse filmbutcheryserial murderslashingsummer camppsychopathic killeritalian american β€¦butcherpsychomaniacobscene finger gesturecharacter's point of view camera shotaxesubjective cameradecapitationlow budget filmblood splattersurprise endingfemale nuditykissbloodsexnumber in titleviolencebare breastssequelfemale frontal nuditydancingchasepantiesdigit in titledead bodynumbered sequelsword fightmassacrethroat slittingimpalementchild in perilgravestalkerevil mandeath of brotherstalkingdeath of sonmurdererkissing while having sexchainsawmachetelifting someone into the airmutilationbarnstabbed in the stomachgrindhousevictimmasked manmental institutionrampagerednecknew jerseypsychotroniceye gougingslaughterstabbed in the eyebody countcharacters killed one by onefifth partsequel to cult favoritepsychoticmasked killerbad guycar troublemadmanmysterious manlaundrydefecationhuman monstercomic relieftombstonehillbillyeyeballmeat cleavercrushed headextreme violencegraphic violenceorchestral music scorestabbed in the facemasked villaincut into piecesbloody violencefemale victimlunaticsadistic psychopathpsychotronic filmdisturbed individualdeath of grandfathercrime spreereturning character with different actorstabbed with scissorsfatchopping woodaxe in the headmultiple homicideweirdosmall town sheriffbreakdancingdate in titlehockey masksequel to cult filmdark and stormy nightdrive in classiccandy barclotheslinegory violencesource musicgarden shearsjason voorheesimposterjumpsuitpopular musicfriday the thirteenthgrave robbermachete mutilationserial teen killercopycattrailer narrated by don lafontaineattempted child murdermale victimwessex county new jerseycrystal lake new jerseycopycat killervertigo shotserial teen murdererlifting a woman into the airspike in the head (See All)

Jason Lives: Friday The 13th Part Vi (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jason Lives: Friday The 13th Part Vi (1986)

Tommy Jarvis returns to the graveyard to make sure Jason Voorhees is dead and accidentally brings him back to life. Now it's up to Tommy to stop Jason's mindless killing and put him back where he belongs.

Subgenre:
psycho thrilleramerican horrorcult filmsupernaturalparanormal phenomenaslasher flickteen horror
Themes:
evilinsanitypsychopathmurderdeathprisonmonstersupernatural powermurder of a police officer
Mood:
darknessslashergorecar chasebreaking the fourth wall
Locations:
lakewoodsforestcemeterysmall townboatamerica
Characters:
slasher killerterrorsheriffvillainpoliceteenagerzombieserial killerkillerserial murderer
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniaceast coastmurder spreeknife murderbutcheryserial murderslashingsummer camppsychopathic killerbutcherpsychomass murdermaniac β€¦drowningsevered headstabbed to deathstabbingflashlightdecapitationblood splattersurprise endingflashbacksexcharacter name in titlenumber in titleviolencesequelmasknumbered sequeldemonmassacreambulancechildlooking at the cameraelectrocutionevil manstalkingneck breakingmurdererunderwatersevered armdismembermentkillingundeadblood spattersplattergothicmachetelifting someone into the airmutilationvictimback from the deadmasked manrampagenew jerseyshovelstabbed in the headslaughterbody countsevered legsequel to cult favoritekilling spreebloodbathmasked killerbad guybeheadingmadmankillactual animal killedsixth partstabbed in the facemasked villainrecreational vehiclecut into piecesbloody violenceheart ripped outfemale victimsadistic psychopathoff screen murdervillain not really dead clicheghoulpaintballhead ripped offreturning character with different actorreanimationstruck by lightningdead teenagerhockey masklifting a female into the airdemonicdark and stormy nightdrive in classicgrave robbinggory violenceunderwater fightjason voorheesdouble impalementmutilated bodyfriday the thirteenthstabcamaromachete mutilationpsycho filmviolentbrutalcomic drunkwessex county new jerseycrystal lake new jerseycut to piecespolice officer crushedstabbing a police officerserial teen murdererkilled by machete (See All)

Henry: Portrait Of A Serial Killer (1986)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Henry: Portrait Of A Serial Killer (1986)

Loosely based on serial killer 'Henry Lee Lucas' (qv), the film follows Henry and his roommate Otis who Henry introduces to murdering randomly selected people. The killing spree depicted in the film starts after Otis' sister Becky comes to stay with them. The people they kill are strangers and in on β€¦e particularly gruesome attack, kill all three members of a family during a home invasion. Henry lacks compassion in everything he does and isn't the kind to leave behind witnesses - of any kind. (Read More)

Subgenre:
psycho thrillerindependent horroramerican horrorcult filmindependent film
Themes:
evilinsanitybrutalitypsychopathdeathmurderdrugsrapetortureincestexploitationmurder of family
Mood:
slashergore
Locations:
chicago illinois
Characters:
mysterious villainslasher killerterrorvillainbrother sister relationshipprostituteserial killerkillerserial murderermurder of a prostitute
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniacmurder of a nude womanmurder spreeknife murdergrindhouse filmbutcheryserial murderslashingpsychopathic killerpervertperversionbutcherpsycho β€¦maniaccontroversysevered headstabbed to deathstabbingdecapitationlow budget filmblood splattersurprise endingfemale nuditybloodcharacter name in titlenudityviolencebare breastsgunshot to deathshot in the chestmarijuanacriminalbisexualstrangulationvideo cameradrug dealerstabbed in the chestchild abusepantyhosestalkerevil manattempted rapestalkingneck breakingdismembermentkillingsplatterfemale stockinged legsragemutilationstabbed in the stomachrapistrampagelow budgetdark humorpsychotronicmurder of a childslaughterstabbed in the eyeabusive fatherbody countkilling spreevillain played by lead actorbad guymadmanmysterious mankillhuman monstersexual violencenaked dead womanextreme violencevideo footagematricidecut into piecessadistic psychopathoff screen murderchild rapebroken neckdisturbed individualexploitation filmcrime spreecreepdead woman on floorwoman's neck brokenbased on supposedly true storydead prostitutesadisticsickofemale hitchhikermurderer duotwo killersmutilated bodygraphic rapesex maniaclead actor's first filmdead woman on toiletdead woman wearing lingerie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween II (1981) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween II (1981)

In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.

Subgenre:
psycho thrilleramerican horrorcult filmsuspenseslasher flickholiday horror
Themes:
traumainsanitybrutalitypsychopathfearmurderdeathjealousytorturevoyeurismmemoryseductionobsessionparanoiablindness β€¦madnessmurder investigationmurder of a police officerpsychological trauma (See All)
Mood:
darknessslashernightgore
Locations:
hospitalcarsmall townwheelchairpolice carhospital fire
Characters:
slasher killerterrorsheriffvillainteenage girlpoliceteenagerboyfriend girlfriend relationshippolice officerserial killernursedetectivepolicemankillerserial murderer
Period:
1970syear 1978
Story:
psycho terrorscalded facepsycho killerhomicidal maniacsexual attractionhot waterboiling watermurder spreeknife murdergrindhouse filmbutcheryserial murderslashingpsychopathic killerdark past β€¦butchermercilessnesspsychocowboy hatmaniacscreamcharacter's point of view camera shotstabbed in the backstabbed to deathstabbingflashlightsubjective camerasecretbrawlblondeblood splattermale rear nudityfemale nuditytwo word titlekissbloodsexnuditynumber in titlemale nudityviolencebare breastssequelfemale rear nuditycigarette smokingnipplesexplosionknifechasetelephone callfirecryingcar accidentshot in the chestwatching tvkissingmaskshootingsecond partneighborvoyeurrevolvergood versus evilhalloweenold manstrangulationambulancethroat slittingaccidentbrunettepart of serieshit by a carbathsearchpantyhosenews reportold womannecklaceattempted murderstalkerstrippingbeaten to deathprologuescreamingperson on fireuniformpoisonproduct placementcollege studentinjectionstalkingglasseswitnesstrapmurderersplattertv newssyringedestructionelectronic music scorehypodermic needlelifting someone into the airmutilationwalkie talkiestabbed in the stomachhammerhidingbuttockscaucasianpoolgrindhousepsychologistbuttdriving a cardead womantowelback from the deadhomicidemasked manpresumed deadcamera shot of feetrampagestabbed in the throatmanhuntmutebroken glasscigarette lighterhit on the headfrustrationautopsyaccidental killinghot tubshadowdead maneye gougingslaughterdisfigurementstabbed in the eyebody countcharacters killed one by onedead woman with eyes opennude woman murderedlightneighborhoodbloodbathsmokemasked killerflat tirefemale stockinged feetdead girlbad guyconfusioncar troublemadmanmysterious manstoreneedlemedical masksurgical maskdark secretbandagehuman monsterlighteralonesuit17 year oldearringnurse uniformdental maskblood stainclinicburnt faceparamedicshot in the eyestethoscopeadult actress playing teenage girlscalpelcigarettehand over mouthkiss on the lipsglassdripping bloodrobebleedingmurder witnessextreme violenceflamegraphic violencelighting a cigarettenurse outfitmurder attemptmultiple murdermasked villainroman numbered sequelbloody violencebutcher knifeman on firepool of bloodfemale victimsadistic psychopathscarenude bathingsilhouettevillain not really dead clichezippo lighterdying wordssinisterescaped mental patientburningdeeply disturbed personcutearringsboom boxpassing outnurse hatcuriosityset on firemultiple homicidemidwestsmall town sheriffsearchingmichael myersdisturbingcalling someone an idiotfragments of glasstorturerdemonicsequel to cult filmboogeymandrive in classic21 year oldfienddeath by strangulationdouble murderyelling for helpcar won't startchildhood flashbackmelting facewoman stabbedjumpsuitlocked upsecurity guard killedsmoking a cigarettemultiple stabbingstore roomsleeping womanclosing eyes of dead persondark killerpsycho filmserial teen killertemperaturepolice officer throat slitpush buttonbath towelhidelighting a cigarette for a womanlighting someone's cigaretteblood draininghittingscaldinghospital patientneedle in eyeoctoberslipping and fallingstalking victimsliphomicidalteenager in dangerhit on the head with a hammeropening creditsexsanguinationlighting cigarette for womanserial teen murderervulnerablehead dunked in watermurdered with a hammerlighting a cigarette for someonerecap segmentscalding waterdead nurseself survivalcharred bodyhand on shoulder scaresleeping girlstabbed with a scalpelstalking by nightdead doctorwalking through a glass door (See All)

Friday The 13th Part Viii: Jason Takes Manhattan (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part Viii: Jason Takes Manhattan (1989)

The graduating class of the local high school is going on a luxury cruise with Jason Voorhees as a stowaway. The heroine Rennie Wickham believes she was almost drowned by Jason as a child. Jason eventually sinks the boat and kills many of the students on it, but many of them escape to Manhattan. A l β€¦ong battle with Jason ensues until Jason is washed away in the New York sewers by a midnight flooding of toxic waste. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmparanormal phenomenaslasher flickteen horror
Themes:
evilpsychopathdeathmurderrevengemonstersupernatural powerdrug addictionmurder of a police officer
Mood:
slashergorerainhigh school
Locations:
woodsnew york cityboatseacityamericasewer
Characters:
mysterious villainslasher killerterrorvillainteenage boyteenage girlzombiepolice officerserial killerkillerteacher student relationshipserial murderer
Period:
1980s
Story:
psycho terrorpsycho killerhomicidal maniaceast coastmurder of a nude womanmurder spreeknife murderbutcheryserial murdersummer camppsychopathic killerdead childbutcherpsychomaniac β€¦character's point of view camera shotdrowningstabbed to deathstabbingaxeflashlightdecapitationblood splatterbare chested malefemale nuditybloodcharacter name in titlenumber in titleviolencesequelexplosionpantiesmirrornumbered sequeldemonhallucinationguitarmanhattan new york citygangnew yorkstrangulationvideo camerathroat slittingimpalementsubwaywhite pantiesexploding carnecklaceon the runblack pantieselectrocutionevil manattempted rapeunderwaterundeadhypodermic needlelifting someone into the airmutilationback from the deadmasked manmale underwearrampagenew jerseyblack bradisembowelmentslaughterstabbed in the eyebody countcharacters killed one by onesequel to cult favoritemasked killerbad guybeheadingmadmanaccidental shootingstatue of liberty new york citycrushed headdisembodied headcruise shipmasked villaintoxic wastedeformitylunaticsadistic psychopathmetrooff screen murdermass murdererghoulbody paintblond boyeighth partpolice officer knocked unconsciousstruck by lightningharpoondead teenagerhockey masklifting a female into the airtwin towerstrailer narrated by percy rodriguezlifeboatspear gunjason voorheesmutilated bodyfriday the thirteenthkilled with a forkhit with a guitarwessex county new jerseycrystal lake new jerseyjerseyserial teen murdererbig applegirl strangling (See All)

Friday The 13th (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th (2009)

A group of young adults set up tent near the abandoned summer camp where a series of gruesome murders are said to have taken place back in 1980. The perpetrator was a grieving mother, driven insane by the drowning of her child, Jason, whom she believed was neglected by the camp counselors. As legend β€¦ has it, the last survivor of the attacks beheaded the woman. But then Jason came back, and now he is a vengeful and inexorable killer, wielding crossbows, swords, axes and other sharp instruments. The legend proves horribly true, as these campers quickly discover. Six months later, the brother of one of those campers distributes posters of his missing sister. The police believe she took off with her boyfriend; but he knows better. The brother crosses paths with an uptight young rich guy who is having his girlfriend and friends over at his parents' cabin. The brother ends up at the cabin himself just before his sister's attacker sets upon them all. (Read More)

Subgenre:
psycho thrillerslasher flick
Themes:
evilbrutalitypsychopathmurderdeathrevengetorturedrunkennessdeath of mothermurder of a police officer
Mood:
darknessslashergorehorror movie remake
Locations:
backwoodslakewoodswaterforestmotorcycleboatbathtubbicyclepolice carcampfiretunnelschool bussex in a tent
Characters:
mysterious villainterrorsheriffvillainteenage girlpoliceafrican americanboyfriend girlfriend relationshiptattoobrother sister relationshipasian americanserial murdererblonde girlgirl nudity
Period:
1980s
Story:
psycho terrorshot with an arrowpsycho killerhomicidal maniacaxe murderwater skiingfemale psychopathcamp counselorfemale serial killerknife murdersleeping bagmurderessserial murderslashingsummer camp β€¦canoepsychopathic killerarrowperversionpsychosurvivormaniaccabinstabbed in the backdrowningscantily clad femalesevered headstabbed to deathstabbingaxeflashlightdecapitationblondeblood splattersurprise endingbare chested malefemale nuditybloodnuditynumber in titleviolencebare breastsfemale frontal nuditymasturbationdogsex scenefemale rear nuditynippleschasepistoltelephone callfiretopless female nuditywoman on topcorpsedigit in titleurinationremakeshot in the headbare buttmaskdead bodymarijuanahallucinationalcoholswimmingbracandlestrangulationtoplessmassacrevideo cameradeath of friendthroat slittingimpalementstabbed in the chestcultbreast fondlingskinny dippingstalkerprologuescreamingmini skirtmoaningmissing persontentevil manopening action scenedisappearancestalkingpremarital sexsuspicionlove interestkissing while having sexpot smokingfireplacebow and arrowburned aliveelectronic music scoremachetescene during opening creditsmutilationcaptivewalkie talkiebuttockscampcovered in bloodmasked manrampagerear entry sexgrocery storenew jerseybackpackstabbed in the throatpower outageconvenience storenipplestabbed in the headstabbed in the leghit on the headjumping through a windowcellphonedisfigurementbody landing on a carstabbed in the eyebody countsevered legcharacters killed one by oneburned to deathpsychoticmasked killermannequinplantvillain played by lead actorbad guybeheadingporn magazinestabbed in the handbonghuman monsterstaircaseabandoned houserear nuditydisposing of a dead bodyloud sexno title at beginningbroken mirrorblood stainnude girlbaseball capheld captivedripping bloodday in titletopless girlcowgirl sex positionhanged manhead cut offburnt bodycountry housesole black character dies clichebra removinggraphic violenceopen endedcheating boyfriendmasked villainspitting blooddeformitytelevision setpool of bloodfemale victimsadistic psychopathold housenakedsilhouettestupid victimvillain not really dead clichejerklocketpsychosissex from behindwoman in dangerleg woundcreepbudweiserfalling through the floorgpsbear trapwoman moaning from pleasurewoman moaningsevered earmoaning womanfreezerstabbed in the footbutt nakeddrinking from the bottleremake of american filmscrewdrivernaked buttweirdowoman's bare buttdrinking gameteenager fighting adultbreaking glassgirl toplesshockey maskkitschvideotaped sexmissing person posterhockey stickheavy drinkingtouching someone's breastsdeath by impalementgirl in brasource musictouching breastsremake of cult filmsickounderwater photographylake housefemale bare footstabbed through the chesthearing noisescampfire storymissing sisterfireplace pokersummer housepower cutshower curtainunderground tunneldisobediencehands covering breastsleg cut offbouncing breastsmutilated bodyfriday the thirteenthleg ripped offatonal music scoreaxe in the chestcampgroundmachete mutilationhead chopped offhickremoving a braman and woman naked in bedtaking off braglow sticktouching breastcowgirl sexnaked woman in bedtopless swimmingwoodchipperaxe in the backbug zappermale with earringdoggie style sex positionstabbed through backwoman on top sexdo not disturb signboat dockwessex county new jerseycrystal lake new jerseywakeboardingarrow through the headblood bathimpaled through the headnude female silhouettebleeding headserial teen murdererbreasts bouncingbroken chairkilled by machetewoman covering nudity with her handswoman removes her bracreaking doorwoman covering breastsreference to macgyver (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspensesupernaturalparanormal phenomenaslasher flickcanadian horror
Themes:
traumaevilinsanitydeath of fatherbrutalitypsychopathfearmurderdeathrevengesuicidekidnappingghosttorturedrunkenness β€¦supernatural powerdeath of motherabductionfear of water (See All)
Mood:
slashergorerainhigh schoolnightmarebreaking the fourth wallblood and gore
Locations:
lakeforestcemeterysmall townpolice stationschool nurse
Characters:
mysterious villainslasher killerterrorsheriffvillainteenage boyteenage girlfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipzombieserial killerlittle girlkiller β€¦serial murderer (See All)
Period:
2000s
Story:
psycho terrorpsycho killerhomicidal maniaccamp counseloreast coastmurder spreebutcheryserial murderslashingsummer camppsychopathic killerbutcherpsychomass murdermaniac β€¦cabindeath of childcharacter's point of view camera shotdrowningsevered headstabbingdecapitationbrawlblood splattershowersurprise endingflashbackbloodcharacter name in titleviolencesequelphotographexplosionpartypistolfirevoice over narrationdreamcorpseslow motion scenefalling from heightmaskcar crashdemonfoot chaseimpalementdream sequencechild in perilunderwater scenevanskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncover upevil mandeath of brotherhigh school studentstalkingneck breakingpremarital sexmurderersevered armdismembermentkillingundeadsplatterchild murderburned aliveheroinemachetelifting someone into the aircomaragemutilationsevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingpsychotronicmedicationmurder of a childalternate realityeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingtorso cut in halfblood on camera lensbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiolockerevil spiritsexual violencestonerdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormass murderervillain not really dead clicheghoulchild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partmidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violencelucid dreamsatanicgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Halloween H20: 20 Years Later (1998) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween H20: 20 Years Later (1998)

On Halloween in 1963, Michael Myers murdered his sister, Judith. In 1978, he broke out to kill his other sister, Laurie Strode. He killed all of her friends, but she escaped. A few years later, she faked her death so he couldn't find her. But now, in 1998, Michael has returned and found all the pape β€¦rs he needs to find her. He tracks her down to a private school where she has gone under a new name with her son, John. And now, Laurie must do what she should have done a long time ago and finally decided to hunt down the evil one last time. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmslasher flickteen horror
Themes:
evilinsanitypsychopathdeathmurderdrugsparanoiaabductionalcoholism
Mood:
slasherhigh schoolnightmare
Locations:
kitchenschoolsmall townelevatortruck
Characters:
mysterious villainslasher killerterrorvillainteenage boyteenage girlpolicefamily relationshipsmother son relationshipteenagerboyfriend girlfriend relationshipbrother sister relationshipgirlserial killernurse β€¦policemansecurity guardalcoholicsecretary (See All)
Period:
1990syear 1998
Story:
psycho terrorpsycho killerhomicidal maniacaxe murdercult favoritemurder spreeknife murderserial murderslashingpsychopathic killerpsychosurvivormaniaccharacter's point of view camera shotstabbed in the back β€¦severed headstabbed to deathstabbingaxeflashlightsubjective cameradecapitationbloodnumber in titleviolencesequelknifechasepistolcar accidentfalling from heightmaskbirthdaydead bodyneighborhallucinationtelephonegood versus evilhalloweenwinecandlecaliforniaambulancedeath of friendthroat slittingtoiletstabbed in the chestweaponattempted murderstalkerprologuekeyuniformmistaken identityevil manactor shares first name with characterstalkingreunionflowersplatterbreaking and enteringheroinelifting someone into the airrageloss of friendhidingvictimfaked deathmasked manrampagetrappedunderage drinkingdelusionstabbed in the legboarding schoolknife throwingbody countcharacters killed one by onedivorceesecret identitypumpkinmasked killernewspaper clippinghockeyreflectionstolen caranniversarybad guybeheadingcar troublemadmanmysterious manfire extinguisherreturning character killed offhiding in a closetgatebody baggraphic violencestabbed in the facehiding placemasked villainbloody violencebutcher knifefemale victimsadistic psychopathvillain not really dead clichesittingseventh partmichael myersdead teenagerdoor belllifting an adult into the airsadisticboogeymanlifting a male into the airjumpsuitsequel with unusual numberaxe in the chesthead chopped offgarbage disposalserial teen killertrailer narrated by don lafontainewhite maskhome intruderevil uncleschool counselor (See All)

Deep Red (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Deep Red (1975)

A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl β€¦osely. (Read More)

Subgenre:
cult filmsuspenseparanormal phenomenaitalian horrorchristmas horrorpsychological horrorcult classic
Themes:
traumainsanitydeath of fatherbrutalitypsychopathcorruptiondeathmurdersurrealisminfidelityrapechristmasghostjealousydrinking β€¦drunkennessfuneralinvestigationangerparanoiablackmailillnesssadismhome invasiontheatrepanicdyingclaustrophobiachristmas past (See All)
Mood:
darknessslashernightgore
Locations:
kitchenwaterhospitalbarrestaurantschoolcarcemeterybathtubbicycleelevatorwheelchairaustraliapolice stationpolice car β€¦cityitalytruck (See All)
Characters:
mysterious villainslasher killerterrorvillainpolicehomosexualfather son relationshipmother son relationshipfather daughter relationshipboyfriend girlfriend relationshipdoctorsingerboygirl β€¦serial killerpolicemanmusicianactresskillerpsychiatristmaidprofessorjewgermangay friendserial murdererself pity (See All)
Period:
1970s
Story:
homicidal maniacevil womanfemale villainhot waterfemale psychopathcult favoriteunknown killerbad girlfemale serial killermurder spreemystery killergrindhouse filmbutcherymurderessmenace β€¦serial murderslashingpsychopathic killerdark pastbutchermercilessnessmaniacstabbed in the backdrowningsevered headstabbed to deathstabbingaxeflashlightsubjective cameradecapitationbathroomvomitingsecretblood splatterbeatingsurprise endingtwo word titleflashbackbloodkissviolenceguncigarette smokingphotographsingingknifechasetelephone callfiresongshootoutcorpsemirrorface slapwatching tvcameradrinkshootingpaintingbookrunningdead bodycafeneighborpianohallucinationcolor in titlerevolvertelevisiontelephonereportersurvivalgay slurnewspaperbedroomjournalistbandold manstrangulationimpalementdinerhousejokebrunettedrivingbirddrawinghit by a carsearchgraveyardold womannecklacepainattempted murderlibraryvirgindangerprologuescreamingpuppetprotestkeydollstatuechristmas treeskeletonhangingpianiststalkingthreatwitnessdarkbasementtrapsuspicioncult directorpsychiceuropekillingarsonrecord playertv newsfireplacedesirebreaking and enteringstreetdressgothictape recorderrome italymagicianstabbed in the stomachtoyarchitectpsychologycomposerdesperationgrindhousedriving a carhomeviolindead womanfemale killerembarrassmentwatching televisionrampagewhiskeycrime scenecouchpaststabbed in the neckmutebroken glassmental hospitalshoveltheatre audiencestairshit on the headenglishbutterflyfrustrationshadowdead maneye gougingslaughterdisfigurementbody countfemale reportergay stereotypeliving roomcharacters killed one by onedead woman with eyes openkilling spreevoodoolightplaying pianopsychotictelepathycrowclose up of eyesdead girldrumsmysterious manapparitiondark secretkillgloveslong hairhuman monstermen's bathroomtwist endingfencestaircasejazz musicskirtstreet markettelevision newslizardbitternesswhodunitblood staintheatre productiontape recordingburnt facemessagemind gamejacketgreenhousehit by a trucksaxophonefallingglassdisappointmentdripping bloodeyeballlocked doormeat cleavercrushed headhallwaystabbed in the shouldertrumpetmurder witnessburnt bodyclueextreme violencefamous scoremacabrepsychic powerbourgeoisiegraphic violencedesksilencedead birdarm wrestlingbutcher knifedogfightgiallopool of bloodfemale victimsadistic psychopathpsychotronic filmhouse firehouse on fireclose up of eyefingerprintsilhouettehatchetsecret roomcurtainlebanonwater fountainloss of controldead woman on floordeeply disturbed personengineeringhidden roompick axepinball machinemistreatmentboomerangblack glovesextrasensory perceptionchild's drawingexposed breastdisturbingraincoatsteamwife murders husbandfalling out a windowfragments of glassitalian cinemapiano teachertorturercrawlingblowing a kissdead woman on groundclairvoyancejazz bandvoodoo dolldrive in classichearing aidprogressive rockfigurinechildren's musicvideo nastywitness to murderreference to leonardo da vincicleavercognacmad womanmelting facegruesomenewsroomcarrying a dead bodysplit headfireplace pokertromboneskylightlocked upmutilated bodyattacked from behindknife in backforeignparapsychologyproletarianleather glovesbrutalchildren's songpush buttonscene based on paintingstatuettecanary islandspiano duetwoman murders a womancradlesadistic killerhouse for salesit inanimate dollblack gloved killersweaty faceaxe in the backbloody knifedrawing on a wallknitting needlemusic conservatorypantingcomposingholding someone's head underwaterblackbirdoverflowing bathtubwater faucetflooded roomhit with a clubseeing father murderedslidingbashing someone's head into a wallbathroom sinkdragged by a truckmummified bodytearing a page from a bookgraveside ceremonyitalian flagwindow screenpsychology professor (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

I Spit On Your Grave (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

I Spit On Your Grave (1978)

The film follows Jennifer, a writer who is working on a new novel and needs to get out of the city to finish it. She rents a riverside cabin in upstate New York to work on her novel, attracting the attention of a number of rowdy male locals. They catch Jennifer one day and strip her naked for the vi β€¦llage idiot (Matthew) and rape her. Jennifer is later attacked and raped a further two times by the four degenerates, and her novel is also destroyed. But Jennifer recovers, and in her now-twisted, psychotic state, she begins to seek revenge on the men. (Read More)

Subgenre:
american horrorb moviecult filmindependent filmvideosadistic horrorhorror b movie
Themes:
evilhumiliationbrutalitypsychopathfeardeathmurderrevengekidnappingrapetorturevoyeurismseductionangersadism β€¦exploitationcrueltyvengeancerape and revengerevenge murder (See All)
Mood:
slashergore
Locations:
lakewaternew york citychurchforestcarsmall townbathtubbicyclegas stationcountry
Characters:
villainfemale protagonistgirlserial killerwriterkillerlustserial murdererself justicesex with a stranger
Period:
1970s
Story:
sexual perversionpsycho killerfemale villainaxe murderfemale psychopatheast coastmurder spreefemale serial killergrindhouse filmmurderessmotorboatserial murdercanoepsychopathic killerpervert β€¦perversionmercilessnessnipples visible through clothingcabindrowningcontroversyscantily clad femaleaxecleavagelow budget filmbikinibeatingmale full frontal nuditybare chested malefemale nuditybloodmale nudityviolencebare breastsfemale frontal nuditymale frontal nuditygunfemale rear nudityfemale full frontal nuditycigarette smokingnipplesknifeleg spreadingpantiesfondlingcryingmirrorvoyeurmale pubic hairriveralcoholtelephonenewspapergangnew yorkfemale pubic hairwhite pantiesdrivingman with glassesjeanspublic nudityone against manysmokinggraveauthorscreamingunderground filmevil manhangingfemale removes her clothesglassesthreatmurdererhandgunvigilantekillingrecord playereyeglassesclaim in titleinjurysexual abuseragemutilationdesperationgrindhousevictimrape victimrapistfemale killerredneckwoman in jeopardylow budgetdeath threatdark herosexploitationpanties pulled downgang rapecastrationbody countbruisecharacters killed one by onekilling spreemisogynywoman in bathtubkillviolence against womenvigilantismmisogynisthuman monsterfemale removes her dressmental retardationsexual violenceloserharmonicadegradationanal rapebubble bathheld captivewhite trashwrathcarnageatrocitywoman wearing only a man's shirtbleeding to deathhammockextreme violencegraphic violencesmall breastsfemale prisonerfemale victimshared bathsadistic psychopathone woman armyviolent deathdelivery boynoisesexual humiliationsuspendersfemale writersex on the floorgenital mutilationdeath by hangingmultiple homicidemistreatmentconnecticutdebaucherysexual sadismcreepysexual crueltybanned filmdisturbinghanged boysadisticdrive in classiceye candyinfamygory violencemisandryvideo nastyfemale murderergruesomelasciviousnessreference to coca colawoman murders a manoral rapefemale vigilantereading in bedrevenge killingextreme filmman forced to stripturning the tableswriter as protagonistmaking lovewoman haterpredator turns victimcut off penisderanged manpredator becomes preyrapist comeuppancetorture threatjean jacketsexy legsunpunished crimeforced fellatiopucciniloss of peniswoman's revengewoman on all foursbag of groceriesbottle rapemale genital mutilationrepetitive rape victimdisgusting (See All)

Friday The 13th Part III (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Friday The 13th Part III (1982)

Jason Voorhees, having barely survived a wound to his shoulder from his own machete, is back to revenge on all that visit "his" woods. A new group of friends come over to party at an area close to the campsite. This time, Jason will be stronger than ever, and getting a hockey mask from one of those  β€¦friends. (Read More)

Subgenre:
american horrorcult filmslasher flick
Themes:
psychopathdeathmurderabductionexploitation
Mood:
darknessslashergore
Locations:
lakewoods
Characters:
slasher killermysterious killerterrorvillainteenage boyteenage girlteenagerboyfriend girlfriend relationshipserial killerkillerserial murdererlow self esteem
Period:
1980s
Story:
psycho killerhomicidal maniaccult favoriteeast coastmurder spreegrindhouse filmserial murderslashingpsychopathic killerpsychomass murdermaniaccabincharacter's point of view camera shotaxe β€¦subjective camerabikinishowerbloodsexnuditynumber in titlesequeldigit in titlemasknumbered sequelimpalementthird partevil manmurderersevered armdismembermentsplattermachetelifting someone into the airragebarnroman numeral in titlesevered handgrindhousemasked manstupidityrampagenew jerseystabbed in the throat3 dimensionalconvenience storepsychotronicslaughterstabbed in the eyecharacters killed one by onesequel to cult favoritekilling spreemasked killertorso cut in halfbad guycar troublemadmandefecationhuman monstersexual violenceshot in the eyehillbillyeyeballhammockextreme violencefamous scoremasked villainknittingpitchforksole survivordeformitysadistic psychopathpsychotronic filmbiker gangmass murdererdisturbed individualcrime spreelifting female in airsliced in twopregnant woman murdered3 ddate in titledisturbinghockey maskgiallo esquesequel to cult filmyo yodrive in classicskull crushinggory violencegruesomejason voorheesdorkfriday the thirteenthserial teen killerbrutalhead crushing3d sequel to 2d filmtrailer narrated by don lafontainewessex county new jerseycrystal lake new jerseykilled with machetesack maskpopcorn making (See All)

Wolf Creek (2005) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wolf Creek (2005)

Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm β€¦are after the backpackers find a way to escape. (Read More)

Subgenre:
cult filmindependent filmsuspenseslasher flickaustralian horrorsadistic horror
Themes:
evilinsanitybrutalitypsychopathfeardeathmurderkidnappingrapedrinkingtorturedrunkennessescapesadismabduction β€¦exploitationcruelty (See All)
Mood:
darknessslashernightgorecar chaseblood and gore
Locations:
beachbarrestaurantswimming poolcarhelicopterairplanedesertaustraliaroad triptruckcavegas stationcampfireroad movie β€¦australian outbackcar on fireshed (See All)
Characters:
mysterious villainslasher killermysterious killerterrorvillainhusband wife relationshipdoctorsingerserial killerhostagekilleraustralianself mutilationserial murderer
Period:
year 1999
Story:
psycho terrorpsycho killerhomicidal maniacmurder spreeknife murdergrindhouse filmbutcheryserial murderslashingshot in the neckpsychopathic killerpervertperversionbutchermercilessness β€¦psychomaniacobscene finger gesturefirst partstabbed in the backcontroversystabbed to deathstabbingflashlightbathroomlow budget filmvomitingblood splattertwo word titlekissbloodviolencedogguncigarette smokingphotographtitle spoken by characterexplosionsingingpartyknifechasebased on true storysongcorpseshot to deathcar accidentmirrorshot in the chesturinationshot in the headshotgunslow motion scenedrinkrifleheld at gunpointsunglassesdead bodycafevoyeurguitarshot in the backf wordswimminggay slurbound and gaggedmassacrevideo cameraimpalementfalse accusationvanpainflash forwardattempted murderdangerprologueumbrellaon the roadstorytellingtentevil manattempted rapepursuitcountrysidetragic eventautomobileisolationpigmurdererdismembermentufokillinggaragepickup truckwolfwoundtouristscene during opening creditsmutilationloss of friendcaptivedesperationflatulencestrangervictimhome movierapisthomiciderampagerednecksufferingsevered fingergunshot woundbroken glassfallblood on shirtrainstormslaughtercapturecliffminetied feetbody countopening a doorsexual assaultcharacters killed one by onekilling spreebloodbathdrugged drinkreflectionbad guybarking dogcar troublemadmanmysterious mancrucifixionparalysisjunkyardhead woundpostcardscene before opening creditsfirearmhuman monstersydney australiastrandedhikingoutbackvery little dialoguefemale friendshipsexual violenceplaying guitarmind gamefilm starts with textnihilismepiloguesunrisefinger cut offsurfboardlying on bedauto mechanicstation wagoncar set on fireextreme violencemeteorcamcorderfilling stationgraphic violenceoverturning carbriton abroadcaravantied up while barefootwaking upbloody violencesole survivorfemale victimsadistic psychopathkangaroocar rollovermass murdererdriving at nightvillain not really dead clichedisturbed individualexploitation filmsoutherncaptivitycreepguard dogends with texttauntingdeeply disturbed personcaged animalcamperserial rapisteclipsedecomposing bodyscreaming in feardesolationwatching someoneoxygen maskbeing watchedwoman driverextreme closeupsolar eclipsespiked drinkabandoned minemobile homeburning carbackpackingmutilated corpsebackpackergory violencetrackingburpsickocratervolkswagen busbritish womancampfire storyrotting corpsehunting knifesavagerybroken down carhelplessnessvandalizing a carsex maniacviolentbrutalshooting a horsegas canhikerpit bullremote locationsadistic killersleeping on a beachemuregaining consciousnessbloody knifebuying a carslashed to deathgun sightunidentified flying objectbushmanmale victimpsychotic killerroad mapserial rapemining campused car lottire blow outsevered spinespree killerbegging to be killedboogie boardclimbing down a cliffmad dogstripped cardesert roadfriendly strangermurder by a knifeserial killingtorturerertowing (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Halloween (1978)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (1978)

The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want β€¦s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmslasher flickteen movieteen horrorholiday horror
Themes:
evilpsychopathcorruptionfearmurderdeathparanoiamurder of family
Mood:
slashernighthigh school
Locations:
carsmall towncar theftkitchen knife
Characters:
slasher killerterrorvillainfemale protagonistteenage boyteenage girlhusband wife relationshipteenagerboygirlserial killerlittle girlkillerlittle boypsychiatrist β€¦doctor patient relationshipserial murderer (See All)
Period:
1970s1960syear 1963year 1978
Story:
psycho terrorpsycho killerhomicidal maniacmurder spreeknife murdergrindhouse filmserial murderpsychopathic killermercilessnesspsychoteen angstmaniacfirst partcharacter's point of view camera shotfirst of series β€¦stabbed to deathstabbingsubjective cameralow budget filmblood splattersurprise endingfemale nuditynudityviolenceone word titledogguncigarette smokingtitle spoken by characterknifeshot to deathshot in the chestwatching tvfalling from heightmaskrunningmarijuananeighbortelevisiontelephonegood versus evilhalloweenstrangulationthroat slittingchildgunshotattempted murderprologuesuburbpay phoneevil manhalloween costumelong takestalkingmurdererhandgunkillingpot smokingbulletelectronic music scorebabysitterlifting someone into the airmutilationstabbed in the stomachblockbustergrindhousedead womanmasked manwatching televisionwoman in jeopardycouchunderage drinkingburglarymanhunttvtitle at the endbody countdead woman with eyes openkilling spreepumpkinnude woman murderedphonemasked killerdead doggothbad guymental patientmadmanyellingclosethiding in a closetkillhuman monstersuit and tiefence17 year oldcigaretteautumnwoman wearing only a man's shirtkiller childfamous scorebabysittingcarpentermasked villainknittingbutcher knifefemale victimsadistic psychopathoff screen murderwetnessvillain not really dead clicheescaped mental patientno endingpayphonelight bulbmidwestghost costumeweirdowoman smoking cigarettecreepysmall town sheriffmichael myerstrick or treattalking on phonedead teenagerheadstonemusic score composed by directorwoman strangled to deathfalling out a windowchild murders a childdemonicphone conversationcuttingboogeymandrive in classic21 year oldpumpkin carvinghorror movie remadelifting a male into the airwoman stabbedlaundry roomcarrying a dead bodyjumpsuitsmoking a cigarettesororicidepsycho filmescaped killerreturn to hometownindestructibilitysmashed pumpkinurban gothicautumn leavesknitting needleoctoberhouse of horrorsteenager in dangergiant pumpkinteenager murdered (See All)

Psycho (1960)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Psycho (1960)

Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to  β€¦take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsuspensepsychological horror
Themes:
insanitypsychopathfearmurderdeathmarriagemoneyfuneraldeceptionvoyeurismdivorcetheftguiltdatingmental illness β€¦unrequited lovemadness (See All)
Mood:
darknessslasherrainbreaking the fourth wall
Locations:
churchhotelsmall townbathtubdesertrural settingpolice carmotelcar in water
Characters:
slasher killerterrorsheriffvillainfamily relationshipsmother son relationshipfriendserial killerpolicemansister sister relationshipthiefkillerpsychiatristsecretaryserial murderer
Period:
1960syear 1960
Story:
psycho terrorpsycho killerhomicidal maniacmurdered in a showerfemale in showercult favoritemurder of a nude womanmurder spreeknife murdergrindhouse filmbutcheryserial murderslashingpsychopathic killerbutcher β€¦psychomaniacfirst partscreamcharacter's point of view camera shotfirst of seriesstabbed to deathstabbingsubjective camerabathroomsecretunderwearshowersurprise endingbare chested malebloodflashbackbased on novelviolenceone word titleinterviewphotographtelephone callvoice over narrationcorpsearrestundressingjailhallucinationvoyeurgood versus evilnewspaperbracaliforniadisguisewomanwidowtoiletstabbed in the chestbirdbathold womanstalkerwidowermistaken identitymissing personlong takefemale removes her clothescountrysidewitnessbasementtrapmurdererthreatened with a knifecross dressingkillingprivate detectiveeyeglassesfemale stockinged legsfalling down stairsbreaking and enteringlooking at oneself in a mirrorfaintinglifting someone into the airmutilationblockbusterimpersonationphone boothgrindhousevictimskulldriving a carpeeping tomapartment buildingcamera shot of feetimpostorgash in the facedeath threatblack braswamparizonarainstormbody countextortionnervous breakdowncharacters killed one by onecellardead woman with eyes openmeetingdead motherphonebloodbathpsychoticfemale stockinged feetimpotencevillain played by lead actorbad guymadmanmysterious mandirector cameoold dark househuman monsterfemale removes her dresstwist endingabandoned housestolen moneytemptationdisposing of a dead bodydomineering mothersplit personalityfoot closeuphearing voicesflyrole reversalmurder suspectnaked dead womansleeping in a carloss of sisterbra removingfamous scoreembezzlementoverhead camera shotrealtormatricidebloody violencefemale victimreclusesadistic psychopathsilhouettefade to blackpeep holedisturbed individualcrime spreeidentity crisiscurtainmysterious strangerred herringworking outstairwelldead woman on floorenvelopehardware storedeeply disturbed personsafe sextalking to oneselfwife leaves husbandbroken engagementthreat to killhidden moneyscreaming in fearphoenix arizonawoman in braloss of girlfriendweirdotaxidermylooking in a windowstabbed with a knifeneon signdisturbingfollowinglifting a female into the airlifting an adult into the airbad mothermissing womanremadescreaming in horrordrive in classicdragging a dead bodydriving in the rainfalse accusation of murderhorror movie remadeslip the undergarmentlicense plateseclusionlooking through a windowcarrying a dead bodydissociative identity disorderrotting corpseshower curtainnight drivinghighway patrolmutilated bodyalimonyjealous manmotel clerkfamous opening themehidden corpsemurder weaponoedipal complexpsycho filmirony of fatejealous womanbased on ed geinspurned womaninsanevictim invited to dinnercleaning upposing as husband and wifestopped by policeslashed to deathmislaid trustfemale in brahouse of horrorsboothused car dealerbloody corpsemotel owneralone in housecovering a dead bodyarizona desertfamous twistlistening to classical musicpsycho next doorbedridden mothersweeping floor (See All)

Halloween (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloween (2007)

The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w β€¦ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)

Subgenre:
psycho thrilleramerican horrortragedyslasher flick
Themes:
evilinsanitybrutalitypsychopathdeathmurdersuicidekidnappingrapetorturedysfunctional familysadismhome invasionpolice investigationmurder of a police officer β€¦mysterious death (See All)
Mood:
darknessslashernightgoreblood and gore
Locations:
small townstrip club
Characters:
slasher killerterrorsheriffvillainteenagerafrican americanboyfriend girlfriend relationshipboyserial killerhostagekillerpsychiatristserial murderer
Period:
1970s
Story:
psycho terrorpsycho killermurder spreeknife murderbutcheryloss of familyserial murderslashingpsychopathic killerpervertdark pastperversionbutcherpsychomass murder β€¦maniaccharacter's point of view camera shotstabbed in the backdrowningcontroversystabbed to deathstabbingsubjective camerablood splatterbeatingfemale nuditybloodsexmale nudityviolencefemale frontal nudityfemale rear nudityfemale full frontal nudityphotographtitle spoken by characterknifechasepistolwoman on topcorpseremakeshot in the headfalling from heightmaskdead bodytelevisionstrippershot in the backf wordstrangulationmassacrethroat slittingimpalementstabbed in the chestjokechild in perilgraveyardauthorbeaten to deathattackuniformevil manbaseball bathangingshot in the shoulderstalkingpremarital sexmurdererloss of motherprofanitykillingteenage sexblood spattersplatterkilling an animalelectronic music scorelifting someone into the airrageloss of friendpsychologistvictimhome moviebroken legmasked manrampagecrime scenetensionmanhuntshot in the facemental hospitalheadphonesmurder of a childbody countbroken armduct tapecharacters killed one by onekilling spreepumpkinbloodbathpsychoticswearingmasked killerhit with a baseball batmexican americanbad guymadmanporn magazinedead animalhuman monstertrick or treatingabandoned housesexual violencetombstoneschool principalautumnstrong languagewhite trashdripping bloodbloody body of childpalm treecarnagenaked dead womanloss of sisterkiller childpsychiatric hospitalextreme violencedisfigured facegraphic violencemultiple murdermasked villainmatricidebloody violencebutcher knifefemale victimsadistic psychopathdying during sexanimal killingmass murderervillain not really dead clichejack o'lanterncrime spreedying wordscreepescaped mental patientdeeply disturbed personchild killedthroat rippinghigh school friendmental asylumforkmultiple homicidemidwestweirdocreepymichael myersdisturbingdeath of petlifting a female into the airloss of boyfriendtorturerchild murders a childhanged boysadisticboogeymanreference to charles mansongun storepsychiatric wardskull crushinggory violencesatanicsickocontroversialcarrying a dead bodymurder of a policewomanjumpsuitclosing credits sequencesororicidebritish manmutilated bodychoked to deathempty swimming poolpsycho filmmultiple versionsviolentbathroom stallbrutalteen sexdisturbed childinsanekilled with a forkmonster as victimsadistic killeranimal mutilationslashed to deathwhite maskabusive childhoodthroat slitinstitutionalizationaluminum baseball batslaughteredinstitutionalizedchild as murdererfake skeleton (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 2: Freddy's Revenge (1985) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 2: Freddy's Revenge (1985)

A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f β€¦ear. (Read More)

Subgenre:
lgbt horroramerican horrorcult filmsupernaturalparanormalparanormal phenomenaslasher flickteen horrorbody horrorsupernatural horrorurban fantasycult classichorror b movie
Themes:
evilbrutalitypsychopathfeardeathmurderfriendshiprevengesurrealismkidnappingghostescapemonstervoyeurismsupernatural power β€¦paranoiasadismpanicmysterious deathshower murder (See All)
Mood:
darknessslashergorerainhigh schoolnightmarepoetic justice
Locations:
baseballbarschoolswimming poolsmall townbusdesertstormgay barschool busbus driverabandoned factoryschool bus driver
Characters:
slasher killerterrorvillainteenage boyteenage girlfamily relationshipshusband wife relationshiphomosexualfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipfriend β€¦boyfriend girlfriend relationshipbrother sister relationshipteachergirlserial killerstudentpolicemanlittle girlkillerself mutilationdriverserial murderergay teacher (See All)
Period:
1980syear 1985
Story:
psycho terrorwhite briefspsycho killerhomicidal maniacplaying baseballmurder spreegrindhouse filmbutcheryvolleyballserial murderslashingpsychopathic killerbriefsbutcherpsycho β€¦mass murdernipples visible through clothingteen angstidentitymaniacobscene finger gesturescreamcharacter's point of view camera shotstabbed in the backsnakestabbed to deathstabbingsubjective camerabikiniblood splatterunderwearshowersurprise endingbare chested malemale rear nuditybloodcharacter name in titlenuditynumber in titlemale nudityviolencesequelbondagedogfightcigarette smokingpartyknifechasetelephone callfirecryingdreamdigit in titleface slapshotgunslow motion scenewatching tvundressingbare buttsunglassessecond partplace name in titledead bodyneighbornumbered sequeldemonhallucinationvoyeurclassroomcriminalf wordfoot chasename in titlemassacrebasketballimpalementfootballstabbed in the chestapologydream sequencebirdchild in perilcreaturespankingtransformationbartenderpublic nuditylegendscreaminglocker roomperson on firepossessionevil mankicked in the facelightningdiaryconvertiblegymhigh school studentexploding bodybasementratmurderercharacter says i love youthreatened with a knifeclasshaunted housewhippingbare chested male bondagenewspaper headlineredheadundeadcoachapplauseburned alivekilling an animalelectronic music scorewoundbeer drinkinggothicgay characterlooking at oneself in a mirrorlistening to musiclifting someone into the airjoggingmutilationmousestabbed in the stomachbarefoot malevisitcovered in bloodgrindhousesadomasochismteenage protagonistcrying mans&mback from the deadmale underwearfull moonrampagedamsel in distressseriesblood on faceunderage drinkinggash in the faceescape attempthit on the headmurder of a childrainstormdisfigurementraised middle fingerhomoeroticismsuspectbarbecuebody countcellarkilling spreealarm clocktelekinesisnewspaper clippingmale objectificationtaking a showerbad guybarking dogmadmanhigh school teacherstuffed animalohiocafeteriaurban legendassumed identitysecond in seriesevil spiritbroken windowfish tankbroken mirrorbus stopsplit personalityburnt facepush upshearing voicesnewspaper articlebare chested boyjock strapteenage sexualitymale name in titlelocked doorbreaking a windowpool partykicked in the headstabbed in the shouldermoving inmurder suspectcrotch grabreading a newspaperawkward situationjumping into watershape shifterclawwoman in a bikinidance sceneheatriding a bikedead birdundressing someonesadistic psychopathpsychotronic filmwet clothesbaseball teambreaking through a doorfeet on tabledragging a bodyvillain not really dead clichebreaking a mirrorsleepwalkingplant in titlearms tied overheadleg injuryidentity crisisdomineering fatherno endingglovecaged animalcrying maleshower roomwagontalking to oneselfboom boxbad dreampassive aggressive behaviortoastercut armsecretly observinghand injuryrepeated eventlifted by the throatlocked inchild killerjumping ropechild murdererhand through chestgym classinvisible mansocial outcastblood on handsgay subtextgym teacherplace in titlescarred facedemonicstreet in titleboiler roomsadisticsequel to cult filmclassmate classmate relationshipgarden partykidnapped girlpower plantdrive in classichorror iconburnt handtaking off shoeswalking in the rainhomoerotic fightserial child killertennis racketcoors beerfurnacescreaming mantaking off pantsgory violencemale in a showernursery rhymetennis ballsleep deprivationwatching someone sleeplong tonguemelting facelifting a male into the airexposed brainhand bandagehell on earthmale bare buttmysterious eventburn scarcaged birdkidnapped womanobscene gestureshape shiftingskin rippingarm injuryscience teacherbaseball coachoverweight manteen sexualityfreddy kruegerjumping into a swimming poolnightmare becomes realitybird in a cageraw meatpossessed manclimbing a laddermale female fightsleeping shirtlessbad guy winsbiology teacherbiting someonegrillgroundedspurting blooddragging someoneattempted child murderescape out a windowclothes torn offpet birdsleep disorderclothes ripped offlocking a doorunpunished antagonistcracked mirrorhigh school coachkidnapped boymurder of a nude manscore employs electronic instrumentsserial child murdertaking off socksurban gothicbarred windowelm streetopen endingslashed to deathspringwood ohiothrowing something at someonehit on the head with a ballsleeping in classactor reprises previous rolebloody footprintcrying for helpmale bondagemistaken belief that someone is deadrunning barefoottrampled to deathdomineering husbandschoolmate schoolmate relationshipserial child murderercar over a cliffexploding animalleather barmale antagonistbandaged armescape by the windowface injuryhomophobic remarkreference to jack kerouacsleeping in underwearwrapped in a blanketbiology classburned handfalling asleep in classreading someone's diaryschool gymserial teen murdererarm bandagebroken doorhijacked busleg bandagepossessed boys&m clubsadistic teacherscar tissuecrotch grabbingdrinking coffeeface scarkilled in a showerlying on the floorripped off clothestowel snappingburning oneselffemale voyeurkidnapped manlocked in a carquestioning sexualitybiting legcutting someonedriving off roadhead rippingintroverted boymass panicmurder in a showerpassive aggressive manpouring rainsleeping fully clothedbossy fathergrabbing one's crotchscreaming boytalking with one's mouth full (See All)

The People Under The Stairs (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The People Under The Stairs (1991)

The People Under the Stairs is the story of a young boy (Fool) from the ghetto and takes place on his 13th birthday. In an attempted burglary (along with two others) of the home of his family's evil landlords, he becomes trapped inside their large suburban house and discovers the secret of the "chil β€¦dren" that the insane brother and sister have been "rearing" under the stairs. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmblack comedydark comedysurvival horror
Themes:
evilinsanitypsychopathdeathmurderkidnappingdeceptionincestmental illnesssadismhome invasiongreedcannibalismwealthstarvation β€¦claustrophobia (See All)
Mood:
darknessslashergoresatiresocial satire
Locations:
los angeles californiaslum
Characters:
terrorvillainpolicefather daughter relationshipmother daughter relationshipafrican americanbrother sister relationshipkiller dog
Period:
1990s
Story:
psycho terrorpsycho killerhomicidal maniacfemale psychopathbad girlmurder spreefemale serial killergrindhouse filmmurderessserial murderslashingpsychopathic killerpervertperversionpsycho β€¦maniacdeath of childflashlightsecretblood splatterbloodviolencedogcigarette smokingtitle spoken by characterknifepistolcorpseshot to deathshot in the chestface slapshotgunbirthdaymansionimpalementhousechild abusechild in perilvanracial slurcharacter repeating someone else's dialoguesuburbelectrocutiondollevil manskeletonbasementcharacter says i love youcult directorterminal illnessfalling down stairsfireplacekilling an animalbreaking and enteringgothicscene during opening creditsragemutilationstabbed in the stomachspidersevered handgrindhouseskullsadomasochismmasked manrampagesevered fingerstabbed in the throathit in the crotchcannibalchild protagonistdynamiteghettobooby trapatticmurder of a childsoulbody countdead boycellarlasersightlandlordgothbad guymadmanhiding in a closetold dark houseschemeevictionhuman monsterlighterclimbing through a windowanimal abusebayonetslingshotpondfuneral homeroofexploding housecrowbardeformitytrapdoorwhite dresswoman slaps a mansadistic psychopathdisturbed individualstarvingdeeply disturbed personmissing girltarot cardchild with a gunfalling off a roofmoney falling through the airgold coinbitten handshot through a wallsecret passagewayhidden doorrobbery gone awryrottweilersevered tonguesick motherhidden treasureanthropophaguschild murderessnameless characterfurnacedragging a dead bodysickoabused childpitbullmute childtenementmutilated bodyhung by wristsbreaking through a wallfire pokerbible belttrapped in a housecrawling through an air shafthit with a brickscared to deathstepping on someone's footeyes gougedhouse of horrorscrawl spacebondage equipmenthuman eaten by a dogscalding waterskull ring (See All)

The Devil's Rejects (2005)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Rejects (2005)

In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house β€¦ and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)

Subgenre:
psycho thrillercult filmindependent filmblack comedysadistic horror
Themes:
evilhumiliationinsanitydeath of fatherbrutalitypsychopathfeardeathmurderfriendshiprevengesuicidekidnappingrapebetrayal β€¦tortureescapedeceptionseductionangerdeath of motherparanoiasadismexploitationcrueltycannibalismvengeanceself sacrificepolice brutalitymadnessmurder of a police officernear death experiencemurder of family (See All)
Mood:
gorenightmareambiguous ending
Locations:
barbathtubpolice stationfarmroad tripmotelgas stationtexasbrothel
Characters:
terrorsheriffvillainpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshiptattoobrother brother relationshipbrother sister relationshipprostitute β€¦police officerserial killernursehostagetough guymaidpolice shootoutpimpaunt niece relationshipsuicide by copmurder of a prostitute (See All)
Period:
1970syear 1978
Story:
homicidal maniacfemale villainaxe murderfemale psychopathfemale in showerfemale serial killermurder spreeknife murdergrindhouse filmbutcheryserial murdershot in the neckpsychopathic killerpervertbutcher β€¦mercilessnessmass murdercowboy hatmaniacobscene finger gesturestabbed in the backstabbed to deathaxelow budget filmvomitingblood splatterbeatingshowerbare chested malemale rear nuditybloodflashbackviolencesequeldogsex scenefemale rear nudityfemale full frontal nuditycigarette smokingphotographtitle spoken by characterexplosionknifechasepantiespistolfireshootoutwoman on topdreamcorpseshot to deathmachine gunhorseshot in the chestface slapshot in the headshotgunrescueslow motion scenepunched in the facewritten by directorarrestgunfightsex in bedbare buttshowdownrifleheld at gunpointbeersecond partdead bodyinterrogationmarijuanajailhandcuffsrevolvercriminalshot in the backf wordsurvivalfoot chasegay slurbound and gaggedambushstrangulationdeath of frienddrug dealerthroat slittingimpalementcocainestabbed in the chestfemale pubic hairtied to a chairwhite pantiescultdream sequenceanti herochild in perildouble crosspolice officer killednews reportcigar smokingshot in the legshot in the foreheadracial sluron the runbeaten to deathscreamingclownelectrocutionpay phonefugitiveevil manknocked outopening action sceneattempted rapefarmershot in the shouldermanipulationdeath of brothersplit screendeath of sonpigbasementneck breakingmurdererthreatened with a knifechickenprofanityshot in the armwhippingcult directorcowfreeze framestylized violencehead buttlooking at oneself in a mirrorscene during opening creditsragestabbed in the stomachkicked in the stomachphone boothcovered in bloodgrindhouserapistfemale killerinterracial friendshipmasked mangas maskwatching televisionrampageredneckcrime scenestealing a carstabbed in the throathatredhit in the crotchcannibalstabbed in the neckescape attemptreference to satancigarette lighterstabbed in the legdeath of protagonistpunched in the chestjumping through a windowthrown through a windowwisecrack humorblood on shirtone daybounty hunterslaughterhighwaybulletproof vesttough copdisfigurementknife throwinggasolinebarbecuebody countranchsexual assaultsevered legkilling spreedeath of loved onenewspaper clippingmedia coveragesouthern accentclose up of eyesnews reportershot through a windowgothmarijuana jointreference to elvis presleyprayingbad guymadmanface maskreturning character killed offstabbed in the handnecrophiliaforced to stripspit in the facehomagepistol whipmisogynisthuman monstersexual violencestandoffvulgaritytrailer homefilm starts with texthit by a truckdeputyman kills a womantrailer parkman punching a womansole black character dies clichemacabreshot in the throatcarjackinggraphic violenceexploding housedeath of familyreference to star warsbutt slappsychological torturecross countryfilm criticfemale victimcocaine snortinghouse on firemass murdererevil clownbilingualisminnocent person killedcrime spreereturning character with different actorknife in the chestserial rapistslow motion action sceneno survivorssouthdutch anglemodern westernsuit of armorcult figurerunning out of gaskiller clownwriting in bloodred light districtmultiple homicidecmnfsexual torturepossebody armorman punches a womantrailer trashpolice vigilantismblockadegas grenaderoadkillreference to jack the rippersevered faceclown makeupentrailssatanicroadiereference to mark twainviolence against a womannail through handoral rapecattle prodmutilated bodynecrophiliacpig maskderanged womanreference to groucho marxderanged manblood bathforced nudityrape with a gun barrel (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Collector (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Collector (2009)

When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h β€¦eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)

Subgenre:
independent horroramerican horrorindependent filmsuspensesadistic horrorslasher horrorhorror b movie
Themes:
evilinsanitybrutalitypsychopathdeathmurdertortureescapesadismhome invasionexploitationcrueltymurder of a police officer
Mood:
slashernightgoreblood and gore
Locations:
strip clubtrying to escape
Characters:
mysterious villainmysterious killerterrorvillainteenage girlhusband wife relationshipfather daughter relationshipteenagermother daughter relationshipserial killerhostagethiefkillerself mutilationtalking to oneself in a mirror β€¦the familykiller dogdirector of photography (See All)
Story:
psycho killerhomicidal maniacmurder spreemystery killergrindhouse filmbutcheryserial murderslashingpsychopathic killerperversionbutchermercilessnesspsychomaniacfirst part β€¦screamscantily clad femalestabbed to deathstabbingflashlightblood splatterbeatingsurprise endingtwo word titlefemale nuditybloodflashbackcharacter name in titleviolencebare breastsfemale frontal nudityfightcigarette smokingnipplesknifelesbian kisspistolcorpsemirrorshotgunslow motion scenepunched in the faceshowdownheld at gunpointcar crashdead bodyhandcuffsgood versus evilsurvivalfoot chasegay slurimpalementstabbed in the chesthousetied to a chairchild in perilhit by a cardangerscreamingelectrocutiondebtevil manactor shares first name with characterisolationneck breakingtrapthreatened with a knifeex convictblood spattercrime bossfalling down stairskilling an animallooking at oneself in a mirrortape recordermutilationhammerhidingspiderdesperationcovered in bloodvictimteddy bearhomeanimal attackhomicidemasked maneaten aliverampagewoman in jeopardyburglartrappedsevered fingermobile phoneburglarygash in the facepsychotronicescape attemptscissorsscene after end creditsdisembowelmenttitle at the endslaughterknife throwinggasolinestabbed in the eyebody countboxcharacters killed one by onebloodbathpsychoticmasked killerdead dogfemale female kissinterrupted sexblood on camera lensintestinesbarbed wirebad guymysterious manwifestabbed in the handset upconstruction workerpistol whiphuman monsterlightervery little dialogueacidclimbing through a windowself defensehead bashed incigarettepredatorbowling alleyman kills a womanheld captivechandelierfinger cut offretrocarnageex conmacabrebloodshedmasked villaindead cattrickcut into piecesjewelsadistic psychopathpsychotronic filmcut handhouse on firedragging a bodyviolent deathex wifeexploitation filmcrime spreecaptivitydeeply disturbed personclothes rippingbear traphung upside downthroat rippingsliced in twobandaged handmultiple homicideblack glovesgutsexterminatordeadlineheld hostagewaspgiallo esquetea partydark and stormy nightburnt hand911 calllock pickpreylasciviousnesscaptive womancold blooded killerear bleedingteeth knocked outtrip wiremutilated bodydead body in a bathtubman murders a womanmouth sewn shutstabbed in the earbotoxobjectificationtrapped in a houseblouse rippingpolice officer neck brokenblack gloved killerevil doginsane manslashed to deathdisturbed personcut to piecesfalling through a staircaseisolatedhome intruderfemale in perilfish hookhidden safelaundry chuteboarded up windowburned handknife through handhung by a hookpick lockduct tape over eyeskept in a boxruthless killer (See All)

The Texas Chain Saw Massacre (1974) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Texas Chain Saw Massacre (1974)

40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE β€¦ terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)

Subgenre:
psycho thrillerindependent horroramerican horrorcult filmindependent filmblack comedysuspensetragedyslasher flicksurvival horrorteen horror
Themes:
evilinsanitybrutalitypsychopathfearmurderdeathfriendshipkidnappingtortureescapeparanoiadysfunctional familysadismexploitation β€¦paniccannibalisminheritancemadnessnear death experience (See All)
Mood:
darknessslasheravant gardeambiguous ending
Locations:
kitchencarcemeterywheelchairfarmroad triptruckgas stationtexascountryback country
Characters:
slasher killerterrorvillainteenage boyteenage girlfamily relationshipsteenagerboyfriend girlfriend relationshipbrother brother relationshipbrother sister relationshipserial killerhostagekillerself mutilationtruck driver β€¦serial murdererself inflicted injury (See All)
Period:
1970syear 1973
Story:
homicidal maniacsummer vacationsummertimemurder spreegrindhouse filmbutcheryserial murderslashingpsychopathic killerbutchermercilessnesspsychomaniacdirectorial debutfirst part β€¦hairy chestfirst of seriescontroversyflashlightdecapitationlow budget filmvomitingblondeblood splatterbeatingsurprise endingbloodviolencephotographknifechasevoice over narrationcorpseurinationcamerawritten by directorfalling from heightsunglassesrunningcollegesurvivalfoot chasebound and gaggedambushmassacredeath of friendimpalementstabbed in the chesttied to a chairdinnerman with glassesradiodouble crossvangraveyardnews reportfive word titlegravebeaten to deathdangerscreamingattackproduct placementevil manknocked outskeletonscardeath of brothercountrysidetragic eventstalkingglassespigmurderertied upthreatened with a knifechickengrandmothercult directorcross dressingcowkillingsplatterfreeze framepickup truckchainsawropegothiclifting someone into the airgroup of friendsmutilationbarnloss of friendcookvandalismbeardhammerspiderblockbustercovered in bloodgrindhousevictimproduced by directorskullhitchhikerhitchhikingmasked manfull moonrampageredneckwoman in jeopardydamsel in distresstensionlow budgetgrandfatherhippiecannibaldark humormutepsychotronicescape attemptcigarette lighterhit on the headjumping through a windowone dayvegetarianswingbarbecuebody countlens flarelaughingcharacters killed one by onekilling spreetank toploss of brotherbloodbathmasked killersouthern accentclose up of eyesbad guycar troublehysteriamadmanyellingface maskminimal castvomithead woundold dark houseurban legendscene before opening creditshuman monstermeatestatetexanabandoned housefarmhouseanimal crueltycar washfilm starts with texthit by a truckhillbillyoffscreen killingheld captiveeyeballdeath of boyfriendwheelchair boundwindmillmacabrefacial scarmasked villainslaughterhousepsychological tortureshrineradio newsbloody violencehit with a hammersole survivorpolaroid camerafemale victimpsychotronic filmsledgehammercut handclose up of eyeastrologyfurniturebonedisturbed individuallifting person in airsocial decaybludgeoningextreme close upwoman in dangerleg injuryscreaming womansinisterstraight razorcryptcreepman in a wheelchairbroomno endingtoothcaged animalwrenchstate name in titlejumping out a windowsouthbird cagegas station attendantdecomposing bodyrunning out of gaswriting in bloodcut armscreaming in feardinner tablefrozen bodypocket knifeskinweirdocreepybanned filmdead teenagerdisturbinggeneratorstate in titleboneslifting a female into the airruralhuman skulltorturergrave diggermidnight moviehenremadesadisticscreaming in horrordrive in classicfinger cutbirdcagetroubled productionanthropophagushand woundsouthern gothicreference to draculagrave robbinghoroscopemalletevil laughterhorror movie remadehypothermiascream queenyelling for helpsickoburning a photographeating human fleshcontroversialpolaroid photographinbreedinggruesomehell on earthman eatermeat hookrotting corpseporch swingarmadillochainsaw murderdreadatonal music scoredesecrationmeat grindermisdirectionpsycho filmfrozen alivedisorientationpower toolbrutalleatherfacebased on ed gein18 wheelervictim invited to dinnercontemporary settingfarmlandrolling down a hillheadlightspower generatorshot in sequencehuman bonemad familybell bottomscut fingerpenknifewearing human skinbroomstickhead traumahouse of horrorsreference to zorroevil smilehaving picture takengroup of fivehit on the head with a hammerdesolateeighteen wheelersoda machinesucking bloodflashbulbfood trayforeshadowstrapped to a tablecutting the palm of one's handhit with a broomrolling downhillscreen doorblowing a raspberrycannibal familycut legevil familytool in title (See All)

A Nightmare On Elm Street (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street (1984)

On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save β€¦ you? (Read More)

Subgenre:
independent horroramerican horrorcult filmindependent filmslasher flickteen movieteen horror
Themes:
evilpsychopathmurderrevengesurrealismfuneralsupernatural power
Mood:
slashergorehigh schoolnightmareavant garde
Locations:
cemeterybathtubpolice station
Characters:
mysterious villainslasher killerterrorvillainteenage girlhusband wife relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboyfriend girlfriend relationshipserial killerkilleralcoholicpolice chaseself mutilation β€¦serial murdererpolice lieutenant (See All)
Period:
1980s
Story:
psycho terrorhomicidal maniacgrindhouse filmbutcheryserial murderpsychopathic killerbutcherpsychomaniacfirst partcharacter's point of view camera shotfirst of seriessubjective camerablood splattersurprise ending β€¦bare chested malebloodviolencecigarette smokingdreamcorpsemirrorface slapslow motion scenearrestfalling from heightbeddemonjailclassroomtelephonegood versus evilfoot chasestrangulationdeath of friendstabbed in the chesthousecoffeeperson on fireevil manhangingstalkingdeath of sonpremarital sexcharacter says i love youreference to william shakespearecult directorstrong female characterfalling down stairsburned aliveelectronic music scoregothiclifting someone into the airhatcrucifixgrindhousevictimstrong female leadseriesswitchbladesevered fingerheadphonesbooby trapdisfigurementbody countcharacters killed one by onecellaralarm clockbad guymadmanvigilantismloud sexclimbing through a windowburnt face15 year olddripping bloodfinger cut offbody bagdeath of boyfriendgraphic violencemaggotopen endedclawreference to shakespeare's hamletpillowsadistic psychopathsledgehammerbreaking through a doorfamous linevillain not really dead clicheplant in titlecreepglovetrail of bloodhit with a chairface ripped offchild killerchild murdererdead teenagerdisturbinghanged boydemonicsevered facestreet in titleboiler roomremadeevil deaddrive in classicserial child killerbroken backfurnacehorror movie remadelucid dreamsatanicsleep deprivationburn scarshared dreamfreddy kruegernightmare becomes realitysleep overserial teen killerserial child murderbarred windowelm streetspringwood ohioreference to shakespeare's julius caesarserial child murdererunplugged electronic worksfemale stuck in sticky substancefalling asleep in classscar tissuecult male character (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Last House On The Left (1972)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (1972)

On the eve of her seventeenth birthday, Mari Collingwood tells her parents that she is going to the concert of underground band Bloodlust in New York with her friend Phyllis Stone. She borrows the family's car and heads with her friend to a dangerous neighborhood in the city. Meanwhile, the sadistic β€¦ and cruel escapees Krug Stillo and Fred 'Weasel' Podowski are hidden in a hideout with their partners Sadie (Jeramie Rain) and Krug's addicted son Junior Stillo (Marc Sheffler) after killing two guards and one shepherd in their runaway. The two girls seek marijuana near the theater and meet Junior that offers some Colombian grass to them. They go to his apartment and are subdued by the criminals that rape Phyllis. On the next morning, they hide the girls in the trunk of their convertible and head to Canada. However, they have a problem with the car's rod and they stop on the road close to Mari's house. When Phyllis tries to escape, the gang stabs her to death and shots Mari after humiliating and raping them. They seek shelter in Mari's home, but during the night, her mother overhears a conversation of the criminals telling that they have killed her daughter. She tells her husband and they plot a scheme to revenge the death of their princess. (Read More)

Subgenre:
american horrorcult filmindependent filmsadistic horror
Themes:
evilhumiliationinsanitybrutalitypsychopathdeathmurderrevengesuicidekidnappingrapetortureescapeinvestigationvoyeurism β€¦seductionsadismabductioncrueltyvengeancemadnessrape and revengerape and murder (See All)
Mood:
slashernightgorehigh schoolnightmare
Locations:
lakeswimming poolforestcemeteryrunning through the woods
Characters:
slasher killerterrorsheriffvillainteenage girlpolicefamily relationshipsfather son relationshipserial killerreference to godkillerserial murdererself justice
Period:
1970s
Story:
sexual perversionhomicidal maniacfemale villainfemale psychopathfemale in showerbad girlfemale serial killerchild molesterserial murderpsychopathic killerpervertperversionpedophilenipples visible through clothingmaniac β€¦directorial debutstabbed in the backcontroversyscantily clad femalestabbed to deathstabbingblood splattershowerfemale nuditybloodviolencefemale frontal nuditydoggunfemale rear nudityfightfemale full frontal nudityknifepantiesshot to deathurinationremakeshootingbeerbirthdaymarijuanavoyeurfoot chasebound and gaggedgangconcertthroat slittingtoiletfemale pubic hairwhite pantiesbathcigar smokingnecklacelatex glovespublic nuditydrug addictscreamingsuburbelectrocutionevil manringconvertiblefemale removes her clothesmurdererchickensevered armhandgunbased on filmcult directordismembermentbralesschainsawbeer drinkingmachetesexual abuseice creammutilationgrindhousevictimrape victimrapistpeeping tomfemale killerhitchhikingwoman in jeopardyswitchbladerock concertsufferingcynicismhippiepet dogjunkiedisembowelmentmurder of a childcastrationducksexual assaultbloodbathshot multiple timesdead girlprayingbad guymadmancannabisforced to striprunning awayspit in the facemisogynisthuman monsterphysiciansexual violenceelectronic musicdegradationdouble barreled shotgunescaped convictwetting pantsfilm starts with textparentheld captiverazor bladecarnageatrocitystation wagonshot through the mouthgraphic violencereading a newspaperbloody violencesadistic psychopathbakingdisturbed individualstreamlong haired maleserial rapistbitingpaybacksexual predatorstabbed multiple timesrunning out of gasrunning for your lifemistreatmentescaped prisonerperson in a car trunkpocket knifebased on supposedly true storysexual crueltypokiesbanned filmdisturbingsex offenderforced suicidesadisticstabbed in the bellydrive in classichands tied behind backrefugeserial child killerinfamybloody handmutilated corpsecheckershorror movie remadevideo nastysickocandlelight dinnerpsychological tormentcaged birdreference to j. edgar hoovertrip wiregraphic raperotten teethserial teen killerlocked in a car trunkescaped killerlive chickenhair curlersfemale victimsengine troublereference to the grand canyonserial child murdererplaying checkersstuffed in a car trunkbaking a cakeprison escapeewoman smoking a cigarmedical gownserial teen murdererice cream barsmoking in bathtubwoman in a trunkremake of swedish film (See All)

Halloweenviii: Resurrection (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Halloweenviii: Resurrection (2002)

Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo β€¦d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)

Subgenre:
american horrorcult filmindependent filmslasher flickteen horror
Themes:
evilpsychopathfearmurderdeathrevengedeceptionsurveillancemurder of a police officer
Mood:
slashergoresatire
Locations:
kitchenwoodsforestwheelchairrooftopfire truck
Characters:
slasher killervillainteenage boyteenage girlserial killernursekillersecurity guardpsychiatristcoroner
Period:
2000s
Story:
homicidal maniacaxe murderserial murderpsychopathic killermaniacobscene finger gesturecharacter's point of view camera shotstabbed in the backsevered headstabbed to deathaxeflashlightsubjective cameradecapitationbrawl β€¦blood splattersurprise endingfemale nuditytwo word titleflashbackbloodviolencesequelfightknifechasefirecell phonecorpsefistfightmirrorwatching tvcomputercameraundressingfalling from heightmaskshowdownf wordgood versus evilhalloweenfoot chasestrangulationambulancemontagethroat slittingimpalementstabbed in the chestinternetpolice officer killednews reportelectrocutionproduct placementevil mankicked in the facecollege studentlightningskeletondisappearanceneck breakingmurdererthreatened with a knifesevered armkillingchainsawheavy rainlifting someone into the airsecurity cameraloss of loved onemorgueskullfatebroken legmasked manmental institutionrampagestabbed in the throatstabbed in the headblack brae mailrainstormraised middle fingergasolinebody countcasual sexcharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinghalloween partytext messaginginterrupted sexvideo surveillancebad guyreturning character killed offhiding in a closetold dark househuman monsterabandoned housewebcamclimbing through a windowwhodunithanging upside downlocked doorbreaking a windowjockbody baghanged manhead cut offfilmed killingmurder attemptbutcher knifeman on firesadistic psychopathlocked in a roombreaking through a doorpeep holestupid victimbreaking a mirrorx rayed skeletonsecret roomcrime spreeleg woundcamera focus on female buttimpersonatoreighth partmichael myersdead teenagerlifting a female into the airboogeymandeath by electrocutionskull crushingjumpsuitsee you in hellcult film referencedecomposed bodybutt grabserial teen killerclown maskpolice officer throat slitovernight in a haunted housereality tv productioneyes wide openwhite maskair hornreal movie shown in fictional situationcord (See All)

Split (2016) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Split (2016)

When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.

Subgenre:
psycho thrilleramerican horrorblack comedysuspensesuperherotragedysurvival horrorteen horrorpsychological thriller
Themes:
insanitydeath of fatherbrutalitypsychopathfearmurderdeathfriendshipsurrealismkidnappingrapebetrayalescapefuneralmonster β€¦deceptionvoyeurismparanoiamental illnesssurveillancepaniccannibalismhuntingcampingnear death experienceobsessive compulsive disorderself harm (See All)
Mood:
slashergoreneo noir
Locations:
kitchenwoodstrainforesttaxiapartmentpolice cartaxi drivermuseumtunneltrain stationart museum
Characters:
slasher killerterrorvillainteenage girlfather daughter relationshipteenagerafrican americandoctorpolice officerserial killerhostagekillersecurity guardpsychiatristuncle niece relationship β€¦serial murdererpolice dog (See All)
Period:
2010s
Story:
psycho terrorpsycho killerhomicidal maniaceast coastchild molesterserial murderpsychopathic killerdark pastpedophilemercilessnesspsychomaniaccharacter's point of view camera shotflashlightsubjective camera β€¦surprise endingbare chested maleflashbackbloodviolenceone word titlesequeldogdancingtitle spoken by characterpartyknifechasepantiescell phonecorpseshot to deathshot in the chestshotgunrescuewatching tvcomputerwritten by directorpaintingrifleheld at gunpointsecond partbirthdayneighborvoyeurriversurvivalorphanbedroomambulancedeath of frienddinernonlinear timelinechild abuseman with glassesanimaldisarming someonedrawingdouble crossbirthday partynews reportold womannecklacetransformationtrainingattempted murderstalkerdangermissing persontentevil manknocked outbaseball batflowersscarinjectiontragic eventhigh school studentstalkingbasementlaptoploss of fathersuspicionmurdererkillingrevelationhypodermic needleheavy rainlooking at oneself in a mirrorcagesociopathrageloss of friendsecurity cameracaptivewalkie talkiehuntercaucasiantherapisteccentricpart of trilogyvictimrapistschizophreniainterracial friendshipcrushed to deatheaten alivegas maskrampagepump action shotgunwoman in jeopardydamsel in distresscameohaunted by the paststealing a carcannibalpower outagezooshopping mallsuper villainescape attempte mailcapturedeertigerphiladelphia pennsylvaniafemale doctorlonerbody countcharacters killed one by onekilling spreechloroformtorso cut in halfhit with a baseball batvillain played by lead actorbad guymental patientdirector cameopedophiliaforced to stripmental breakdownscene before opening creditshuman monsterspiral staircasetwist endingchild molestationjournallockerhuman sacrificeworld dominationmegalomaniacyoung version of charactersuper powersbeastsplit personalitykidnapperpearl necklaceguardiansole black character dies clichemacabreopen endedsuperhuman strengthtragic pastbloody violencesole survivorwhite brafemale victimsadistic psychopathschizophreniclocked in a roommolestationchild rapefade to blackdisturbed individualsinistercreepabusive motherboom boxvideo diarysexual predatorhit with a chairbritish actor playing american characterflower shopskypeconferencepower drillpepper sprayweirdoflesh eatingdead teenagerdisturbingcaged humancrawlingkidnappedmultiple personality disorderman dressed as a womananthropophagusair venteating human fleshblood on mouthlispvirtualitydissociative identity disorderlocked in a cageclimbing up a walldrawingsstereodreadzookeeperdisturbed childhoodsuperhuman speedcrawlspacereference to skypebookshelfviolentvideo conferencingvideoconferencingcoat hangerfemale victimsvillain escapeswrist cuttinggauzeteleconferencingunder the bedchild rapist (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Evil Dead (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Evil Dead (1981)

Five college students take time off to spend a peaceful vacation in a remote cabin. A book and audio tape is discovered, and its evil is found to be powerful once the incantations are read out loud. The friends find themselves helpless to stop the evil as it takes them one by one, with only one surv β€¦ivor left with the evil dead and desperately tries to fight to live until morning. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedydark comedystop motion animationslasher flickdark fantasygross out comedysupernatural horror
Themes:
evildancemurderdeathrapeghostsupernatural powersadismsupernatural rapebook of evil
Mood:
slashergoreone night
Locations:
woodsforestcarsinging in a car
Characters:
teenage boyteenage girlfriendboyfriend girlfriend relationshipbrother sister relationshipstudentself mutilationself cannibalism
Period:
1980s
Story:
grindhouse filmsurvivordirectorial debutfirst partcabincharacter's point of view camera shotvacationfirst of seriesstabbed in the backsevered headsnakestabbed to deathstabbingaxesubjective camera β€¦decapitationlow budget filmblood splattersurprise endingfemale nuditykissbloodviolencethree word titlefireremakeshot in the headshotgunwritten by directorshootingbookcollegedemonriverbridgeanti heronecklacepaingravetreestalkerkeypossessionisolationbasementhauntingcult directordismembermentchainsawoccultspiritfireplacedestructionsexual abusegroup of friendsmutilationcaucasianblockbustersevered handgrindhouseblack humorburialreverse footagetrappeddark humorpsychotronicstabbed in the legfogdead maneye gougingh.p. lovecraftsiegedemonic possessionsexual assaultroomsevered legcharacters killed one by onecellardeath of loved onetripplaying cardsclose up of eyesdead girlblood on camera lensbeheadinglevitationviolence against womenevil spirittelling someone to shut upvery little dialoguesexual violencestabbed in the armtape recordingtennesseekiss on the lipscabin in the woodsamputationbased on short filmmichiganhandextreme violenceflametragic lovebloodshedstressfemale victimtongue in cheektapepsychotronic filmsevered footcardsno endingcult figuredecomposing bodystabbed in the footlifted by the throatshaky camdead teenagergrandfather clockobject in vaginaabsurd violencecult movie castevil deadover the topnecronomiconevil laughdecapitated headpixelationhorror movie remadepart stop motionvideo nastycar won't startjump scaremelting faceincantationporch swingpossessed womanunusual sex actburying a dead bodygraphic rapeanimate treepossessed manstabbed with a pencilabuse against womenancient bookbook of the deadcharacter says go to hellsex with a foreign objectmockingspirit worldkilled with an axeancient cityfighting with selfgiant plantpoked in the eyeattacked by a plantgroup of fivelocked in a cellardemonic undeadpendulum clockperverse sexthrown across a roomshovel through headpretending to be asleepraped by treessaying boosumerianunnatural phenomenonjewelry as giftsumer (See All)

Maniac (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Maniac (2012)

Just when the streets seemed safe, a serial killer with a fetish for scalps is back and on the hunt. Frank is the withdrawn owner of a mannequin store, but his life changes when young artist Anna appears asking for his help with her new exhibition. As their friendship develops and Frank's obsession  β€¦escalates, it becomes clear that she has unleashed a long-repressed compulsion to stalk and kill. (Read More)

Themes:
insanitybrutalitypsychopathfearmurderdeathtorturelonelinessobsessiondepressiondrug usesadismunrequited lovephotographychildhood trauma β€¦psychological trauma (See All)
Mood:
slashergoreneo noir
Locations:
restaurantlos angeles californiasex in public
Characters:
mysterious villainterrorvillainhomosexualmother son relationshiptattooprostitutephotographer
Period:
1980s2010s
Story:
sexual perversionmurder of a nude womanmurder spreeknife murderserial murderslashingpsychopathic killersuffocationdark pastmaniacstabbed in the backstabbed to deathsubjective camerabathroomvomiting β€¦blood splatterbloodflashbackviolenceone word titlethreesomefemale rear nudityphotographknifecell phonecorpseurinationremakecomputercameracar crashneighborhallucinationvoyeurfoot chasebound and gaggedwinestrangulationcocainestabbed in the chestsubwaychild abusehit by a carbreast fondlingvannews reportlooking at the cameranecklacetalking to the cameracharacter repeating someone else's dialogueevil mankicked in the facetragic eventstalkingthreatened with a knifesevered armdismembermentlooking at oneself in a mirrorscene during opening creditsragemovie theatervictimart galleryschizophreniaapartment buildingrampagepillsrejectiondeath of protagonistdisembowelmentwedding dresstied feetnervous breakdownsevered legdead woman with eyes openmisogynymannequinwoman in bathtubvillain played by lead actorbad guyconfusionstabbed in the handhiding in a closethuman monstersubway stationbroken mirrorwoman in bra and pantiesballerinadripping bloodtattooed womanmeat cleaverextreme violencetied up while barefootfemale victimstrangled to deathschizophrenicbreaking through a dooronline datingdisturbed individualbreaking a mirrorarm ripped offexhibitiondrugstorestabbed in the mouthtalent agentremake of american filmstabbed in the sidegutsdead woman on bedreference to frankensteinwoman strangled to deaththrown through a windshieldscalpingsevered faceoedipus complexstabbed through the chinmigraineleg ripped offpharmaceuticalsachilles tendon cutbased on ed geinbridal gowninner monologuebug spraystabbing a womanreflection in a car mirrorhiding under a carmirror above bedlip piercingnasal spray (See All)

Freddy's Dead: The Final Nightmare (1991)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy's Dead: The Final Nightmare (1991)

In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig β€¦in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)

Subgenre:
psycho thrillerindependent horroramerican horrorcult filmindependent filmblack comedysupernaturaldark comedyparanormal
Themes:
evilinsanitypsychopathdeathmurdersurrealismdrugsghosttorturesupernatural powerdeath of mothersadismamnesia
Mood:
darknessslashergorerainhigh schoolnightmare
Locations:
small townairplaneroad trip
Characters:
slasher killerterrorvillainfamily relationshipsfather son relationshipfather daughter relationshipteenagerteacherserial killerkillerself mutilationyounger version of characterdeafnessserial murderergerman american β€¦evil father (See All)
Period:
1990s1970s1960s1940s1950s
Story:
psycho terrorpsycho killerhomicidal maniacteenage murderermurder spreebutcheryserial murderpsychopathic killerdark pastbutcherpsychomaniacsubjective camerablood splatterbare chested male β€¦bloodflashbackf ratedcharacter name in titleviolencesequeltitle spoken by characterknifefirepunctuation in titletitle directed by femaledreamrescueslow motion scenefalling from heightapostrophe in titledemoncriminalgood versus evilstrangulationimpalementstabbed in the chestboxingmapchild abusedrawingchild in perilshot in the legcharacter repeating someone else's dialoguebeaten to deathstatueevil manknocked outkicked in the facescene during end creditsexploding bodymurdererkillingundeadchild murderfalling down stairsburned alivekilling an animalhead buttgothicscene during opening creditssexual abuseragemutilationkicked in the stomachtherapistphone boothvictimorphanagerapistback from the deadrampagecameosevered fingercrossbowkicked in the crotch3dexploding headthrown through a windowparachutemurder of a childslaughterdisfigurementknife throwingraised middle fingerabusive fatherbody countkilling spreepsychoticnewspaper clippingposterhit with a baseball batmarijuana jointvillain played by lead actorbad guymadmanstabbed in the handmolotov cocktailkillohiohuman monsterchild molestationevil spiritstonerburnt facecameo appearancekidnapperplaying a video gamefinger cut offchild kidnappingpunching bagsleeping in a carkiller childsixth partclawfamily mandeath of title characterbloody violencelunaticsadistic psychopathanimal killinghusband murders wifefairghoulsleepwalkingsheltercreepglovefalling through the floorchild killedmidwestbroken handchild killerrepressed memorycreepywater towerchild murdererman punches a womanadopted childdisturbingreference to friedrich nietzschehit by a bustorturerboiler roomsadisticsequel to cult filmabusive stepfatherboogeymandrive in classicburnt handhearing aidhit with a frying panserial child killergreen bloodfear of heightsdream worldgory violencesleep deprivationfilm starts with quotethrown through a wallfalling down a hillgruesomedream within a dreamear bleedingshared dreamdisturbed childhoodfreddy kruegernightmare becomes reality3d glasseschoked to deathserial teen killerstabbed in the ear3d sequel to 2d filmtrailer narrated by don lafontainetroubled childhoodpipe bombanimal mutilationdaughter murders fatherflashback sequenceloud noiseserial child murderelm streetspringwood ohioabusive childhoodserial child murdererspikesreference to nintendohit with a beltthrown from an airplanefingernails on chalkboardchild as murderer (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Cabin Fever (2002) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Cabin Fever (2002)

The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc β€¦ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)

Subgenre:
b moviecult filmindependent filmblack comedysuspenseabsurdismsurvival horrorpsychological thrillerbody horror
Themes:
insanitybrutalityfearmurderdeathfriendshiprevengedrinkingdrunkennessescapeparanoiaguiltillnessunrequited lovehome invasion β€¦exploitationpanicpolice brutalityhuntingcamping (See All)
Mood:
goreraincar chaseambiguous ending
Locations:
backwoodslakewoodswaterhospitalforestbathtubbicyclefarmtruckcavegas stationcampfireshed
Characters:
sheriffpolicefather son relationshipafrican americanboyfriend girlfriend relationshipdoctorpolice officerself mutilationhomeless mankiller dog
Period:
2000s
Story:
canoeobscene finger gesturedirectorial debutcabinvacationstabbed in the backscantily clad femalesevered headstabbed to deathaxecleavagedecapitationlow budget filmvomitingbrawl β€¦bikiniblondeblood splatterbeatingshowersurprise endingbare chested malefemale nudityflashbackbloodviolencefemale frontal nuditymasturbationdogsex scenefemale rear nuditycigarette smokingfingeringphotographpartyknifechasepantiespistolfirecell phonewoman on topcorpseshot to deathhorsecar accidentshot in the chesturinationshot in the headshotgunslow motion scenepunched in the facewritten by directorbare buttrifleheld at gunpointbeerdead bodymarijuanahallucinationrevolverguitarshot in the backf wordswimmingsurvivalfoot chasegay slurambushmassacreambulancedeath of friendimpalementstabbed in the chesttied to a chairbrunettefalse accusationradiohit by a carshot in the legshot in the foreheadlatex glovesracial slurskinny dippingbinocularsblack pantiesbeaten to deathkaratescreamingperson on fireproduct placementstorytellingknocked outbaseball batcollege studentscene during end creditsisolationpigpremarital sexthreatened with a knifesevered armshot in the armvigilantecult directorcowdismembermentcorrupt copblack americanpickup truckeavesdroppingfireplaceburned aliveshot in the stomachgroup of friendsdiseasevirushuntereccentriccovered in bloodgrindhousetorchanimal attackpeeping tomeaten alivesexual desireredneckreverse footagetensionstealing a carunderage drinkingstabbed in the throatstabbed in the neckconvenience storerowboatescape attemptmedical examinationstabbed in the headstabbed in the legscene after end creditspunched in the chestdisembowelmentinfectionracistslaughterdeerdisfigurementranchsevered legcharacters killed one by oneflat tiresouthern accenttorso cut in halfwoman in bathtubhit with a baseball batdead dogmarijuana jointdirector cameopromiscuous womandrifterdead animalhomagehead blown offepidemicmental retardationabandoned houseraftsquirreldouble barreled shotgunaccidental shootingdeputyhillbillybowling alleycabin in the woodsmercy killingoffscreen killingn wordfevercorrupt policeburnt bodymacabrequarantinehit with a shovelspitting bloodhit with a hammerdog attackimprovised weaponhermitanimal killingsevered footstupid victimcamera focus on female buttblond boyno survivorsbanjodecomposing bodystabbed in the footbitten handposseskatergeneral storeleft for deadlemonadeclicheblood vomitingcampfire storymarshmallowporch swingkilled with a hammerreservoirinfectious diseasecontaminated waterstabbed in the eardead pigstabbed with a screwdrivertoasting marshmallowsrabbit suitreference to shirley templeburning bodyleg shavingball peen hammerhit with a guitarwild dogno cell phone signalbitten in the handdumb copgroup of fivebitten in the armstabbed with a stickhuman eaten by a dogflesh eating virusreference to smokey the bear (See All)

Gothika (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Gothika (2003)

Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape β€¦d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)

Subgenre:
psycho thrillersuspensesupernaturalparanormal
Themes:
evilinsanitypsychopathfearmurderdeathsuicidekidnappingmarriagerapeghostprisontortureescapememory β€¦supernatural powerparanoiadrug usemental illnesssurveillanceunrequited lovepanicdeath of daughtermissing childescape from prisonthe devilmurder of husbandrape and murder (See All)
Mood:
darknessslashernightgorerainneo noirnightmare
Locations:
hospitalswimming poolcarbathtubtaxipolice stationpolice car
Characters:
slasher killerterrorsheriffvillainfemale protagonistpolicefamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipdoctortattooserial killernurse β€¦policemanlawyerreference to godkillersecurity guardpsychiatristself mutilationdoctor patient relationshipstepfather stepdaughter relationshipserial murdererself immolationself cuttingsuicide by jumping off a bridge (See All)
Story:
psycho terrorpsycho killerhomicidal maniacaxe murderserial murderslashingpsychopathic killerpsychomaniacaxeflashlightsubjective camerablood splattershowersurprise ending β€¦bare chested malefemale nuditykissbloodflashbacksexf ratedviolencefemale frontal nudityinterviewgunfightphotographexplosionknifechasepistoltelephone callfirecryingcell phonedreamcorpsecar accidentmirrorshotgunwatching tvcomputershootingrifletearsrunningcar crashhallucinationreporterswimmingsurvivalfoot chasevideo camerawomanthroat slittingbridgesuicide attemptprisonerfalse accusationunderwater scenecigar smokingshot in the foreheadattempted murdermicrophonescreamingperson on firefantasy sequencepay phonefugitiveumbrellapossessionevil manlightningattempted rapeinjectionpursuitstalkingdeath of husbandmurderertrustkillingtherapypizzasyringehypodermic needlegothicheavy rainbarnsecurity camerajail cellpatientbuttocksdesperationrape victimrapistmental institutionbarefootwoman in jeopardyjanitorprison guardpillssurveillance camerathunderdeath threatmental hospitalco workerdelusionmedicationframe uptime lapse photographythunderstormwomen's prisonabsent fatherevidencerainstormfemale doctornervous breakdowncellarkilling spreereckless drivingowlnewspaper clippingframed for murderdead girlmemory lossintimidationgothvideo tapebad guymental patientmadmanelectricitykillmental breakdownblackoutsatanismblood stainspreadeagledenialhearing voiceslistening to a radiostethoscopescalpelfallingwrist slittingroadblockseizurepsychiatric hospitalshockextreme violencecamcordergraphic violenceinmatebloody violenceman on firetrapdoorfemale victimpurgatoryprophetsadistic psychopathelectric chairchainssolitary confinementgas explosionmurder victimcircumcisionsecret roomserial rapistflickering lightcar wreckconnecticutdead husbandjumping off a bridgerepressed memoryhospital gowndisturbingbreaking glassfingerprintsdemonicnew hampshiresedativepenitentiarysadisticdefense attorneyconfinementpsychiatric wardlogiccatatoniatwo killerssinkholeblood pressurecutterinstinctneurosurgeonpsycho filmspontaneous combustionlistening to a car radioholding one's breath underwatercriminally insanedetourfrench shock cinemadependencefreaking outfemale victimsbrake failurehighway patrolmanurban gothicwrist bandagecovered bridgeelectric generatorfootprintsswimming gogglescell blockchained to a bedwoman on firedistorted soundanimal tortureserial rapetemporary insanitymedical restraintsfloodlightbroken car headlight (See All)

Wrong Turn (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Wrong Turn (2003)

Subgenre:
cult filmindependent filmblack comedysuspensefish out of waterslasher flickteen moviesurvival horrorteen horrorpsychological thriller
Themes:
wildernessinsanitybrutalitypsychopathfearmurderdeathfriendshiprevengekidnappingtortureescapeparanoiahome invasionpanic β€¦cannibalismcouragehuntingmurder of a police officernear death experience (See All)
Mood:
slashergore
Locations:
woodsforestbathtubpolice cartruckcavegas station
Characters:
slasher killerteenage boyteenage girlteenagerboyfriend girlfriend relationshippolice officerhostageinterracial relationshipself mutilation
Period:
2000s
Story:
axe murderarrowmercilessnessfirst partfirst of seriesstabbed in the backsevered headstabbed to deathaxeflashlightdecapitationblood splatterbeatingsurprise endingblood β€¦sexviolencecigarette smokingexplosionknifechasepistolfirecryingcell phonecorpseshot to deathcar accidentshot in the headshotgunrescueslow motion scenefalling from heightshowdownriflecar crashmarijuanacollegeshot in the backsurvivalfoot chasebound and gaggedambushmountaindeath of friendtoiletstabbed in the chestmapexploding cardisarming someonehit by a carpolice officer killedshot in the legtreestalkerdangerprologuescreamingperson on firedollcollege studentscene during end creditsprankstalkingthreatened with a knifewaterfallsevered armnewspaper headlinedismembermentarsonpickup truckpot smokingbow and arrowmachetemutantgroup of friendstied to a bedjumping from heighttorchbroken legredneckdamsel in distressstealing a carbraveryjob interviewcannibalpolice officer shotengagementbooby trapaerial shotblood on shirtone daydisfigurementgasolinebody countsevered legcharacters killed one by onetank topsmokeflat tiresouthern accenthit with a baseball batbarbed wirecar troublemolotov cocktailjunkyarddead animalold dark househuman monstermental retardationarcheryshot in the eyedeputyhillbillycabin in the woodsroadblockoffscreen killingcdmedical studentdeath of boyfriendstabbed in the shouldertow truckarcherexploding houseslaughterhousepsychological tortureroadpool of bloodrock climbingstupid victimvillain not really dead clicheclimbing out a windowpolice officer shot in the headextreme close upleg woundsinistershot with a bow and arrowbear trapsevered eargas station attendantcar wrecksurprise during end creditsabandoned cardead teenagerwest virginiaham radiostate trooperclichelatin americanwatchtowerdragging a dead bodyhead cut in halfevil laughteraxe murdererdenturesinbreedingmountain mandeath trapdeath of fiancevictimizationamateur radiowoman wearing a tank toprolling down a hillradio towercell phone out of rangeno cell phone signalstabbed through the mouthgas tankpine forestreference to a white picket fenceboiling potwrong turntreating a woundranger tower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
american horrorcult filmindependent filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horrorurban fantasy
Themes:
traumaevilinsanitybrutalitypsychopathfeardeathmurderfriendshiprapeghostpregnancymonsterinvestigationsupernatural power β€¦depressionsadism (See All)
Mood:
slashergorenightmare
Locations:
waterhospitalchurchswimming poolcarmotorcyclecar on firedeath in a car accident
Characters:
slasher killerterrorvillainfemale protagonistfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfriendboyfriend girlfriend relationshipdoctorboygirl β€¦serial killernursebabyartistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicfathercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
psycho terrorpsycho killerhomicidal maniacmurder spreegrindhouse filmserial murderslashingpsychopathic killerdark pastmass murderteen angstmaniacscreamstabbingflashlight β€¦blood splattershowersurprise endingbare chested malefemale nudityflashbackbloodsexf ratednudityviolencebare breastssequelgunfemale rear nudityphotographpartyknifechasepistoltelephone calltopless female nuditycryingdreamfoodcar accidentslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebedcar crashdemonhallucinationgood versus evilfoot chasedisguiseambulancedeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manskeletonstalkingautomobilepremarital sexmurderersevered armhaunted housedismembermentkillingredheadundeadsplatterfreeze framewaiterfalling down stairswarehousebeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingmale objectificationvillain played by lead actortaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spiritbroken windowdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handfetusghoulbroken bottledeath of loverplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumehand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

The Hills Have Eyes 2 (2007) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes 2 (2007)

A team of trainees of the National Guard brings supply to the New Mexico Desert for a group of soldiers and scientists that are installing a monitoring system in Sector 16. They do not find anybody in the camp, and they receive a blurred distress signal from the hills. Their sergeant gathers a rescu β€¦e team, and they are attacked and trapped by deformed cannibals, having to fight to survive. (Read More)

Themes:
evilinsanitypsychopathmurderdeathrevengesuiciderapetorturecannibalismrape and revenge
Mood:
slashergore
Locations:
waterdesertnew mexico
Characters:
slasher killerterrorvillainserial killer
Period:
year 2007
Story:
psycho killerhomicidal maniacaxe murdergrindhouse filmserial murderpsychopathic killeraccidental deathpsychomaniacstabbed in the backstabbed to deathstabbingblood splattersurprise endingfemale nudity β€¦nuditybare breastssequelfightexplosionpistolfirelickingcorpseshot to deathshot in the chestremakeshot in the headfalling from heightriflenumbered sequelf wordgood versus evilsurvivalgay slurarmyimpalementstabbed in the chesttrainingbeaten to deathevil mankicked in the faceshot in the shouldertragic eventexploding bodysevered armdismembermentsplatterropeclaim in titlemutantrageassaultbroken legguardrampagesevered fingerhit in the crotchcannibalgash in the facestabbed in the headdynamiteaccidental killingminebody countkilling spreenude woman murderedtorso cut in halffemale soldierblood on camera lensintestinesgiving birthbad guymadmanhuman monsterstrandedsexual violencestabbed in the armanal rapesuicide bomberbayonetmeat cleaverbleeding to deathextreme violencegraphic violencestabbed in the facedrillunwanted pregnancybloody violencedeformitysadistic psychopathpsychotronic filmsledgehammerstupid victimhillbody partno endingstabbed in the mouthfalling off a cliffaxe in the headsevered tonguesadisticnational guardshootpregnant woman nudeskull crushingsequel to remakesickolong tongueraped by monstermutilated bodyumbilical cordtwisted anklegraphic rapeport a pottystillbirthtraining exercisesadistic torturedynamite explosionthrown from a cliffsemen in womanlast daywoman murderedfacial deformityfreeclimbing (See All)

A Nightmare On Elm Street 3: Dream Warriors (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 3: Dream Warriors (1987)

Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o β€¦ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)

Subgenre:
psycho thrilleramerican horrorcult filmindependent filmsupernaturalstop motion animation
Themes:
evilinsanitypsychopathdeathmurderghostfuneralmonstersupernatural powersadism
Mood:
slashergorenightmare
Locations:
barchurchcemeteryschool boy
Characters:
slasher killerterrorvillainfather daughter relationshipteenagermother daughter relationshipdoctorserial killernursetough guylittle girlsingle motherkillerself mutilationalcoholic father β€¦serial murdererevil nurse (See All)
Period:
1980s
Story:
psycho killerhomicidal maniacmurder spreebutcheryboy with glassesserial murderslashingpsychopathic killerdead childbutcherteen angstmaniacstabbed in the backstabbed to deathstabbing β€¦decapitationbathroomblood splattersurprise endingbare chested malefemale nuditynumber in titleviolencesequelbondagecigarette smokingfiredreamcorpsedigit in titleslow motion scenethongfalling from heightbedrock musicnumbered sequeldemonfoot chasenewspaperdeath of friendimpalementsuicide attemptstabbed in the chestnundream sequenceradiochild in periltonguethird partcharacter repeating someone else's dialoguescreamingpuppetpay phonedollevil manskeletonisolationbasementmurderercharacter says i love youkillingundeadsplatterfalling down stairselectronic music scorelifting someone into the aircomaragetied to a bedcrucifixvictimback from the deadclockdrug overdoserampageswitchbladetrappedwindmutefalling to deathhypnosisstairsstabbed in the legschool uniformjumping through a windowknife fightfogdisfigurementstabbed in the eyebody countcharacters killed one by onekilling spreepajamassmokebad guymadmanalleyreturning character killed offohioevil spiritabandoned housestabbed in the armgroup therapyburnt facebody in a trunkscalpelone linerdruggedwrist slittingrazor bladecarnagedisembodied headwheelchair boundsuper powerpsychiatric hospitalaspiring actresshit with a shovelclawthird in seriesbloody violencetelevision setdigging a gravemattresssadistic psychopathgymnasticsvillain not really dead clicheghoulsolitary confinementbreaking a mirrorsleepwalkingpitholy waterchantingfedoraglovetroubled teensexual innuendopayphonecut armreanimationfalling asleeplifted by the throattricyclechild killerjumping ropecreepyhospital gownmarionetteorderlychild murdererdead teenagerdisturbingboneslifting a female into the airbad motherhanged boydemonicsedativestreet in titleboiler roomforced suicidesadisticboogeymandrive in classicsexy nursegluereference to edgar allan poeserial child killerfurnacedungeons and dragonsnursery rhymehanged girlbourbonmohawkpunk girljump scarelong tongueolder woman younger manexperimental drugteen smokingburn scardream within a dreamskipping ropescaredshared dreamscratchingfreddy kruegerburned with a cigarettependulumgroup of teenagersstabbed with glassfootstepsserial teen killerdead pigpromiscuous motherbegins with a quotebossy motherinanimate object comes to lifespeaking spanishsleep disordernewton's cradleex drug addictfeathersserial child murderelm streetspringwood ohiofalling leavespapier macheserial child murdererteenager in dangerveinhomemade weaponstabbed with a needleselective mutismbreaking through wallphysical harmbicycle bellchase scenecommitted to asylumdiet cokeisolation cellkids playingscar tissuewidowed motherbathroom sinkminiature modelshoutteenager murderedunfit mothercarrying a childchasing a girlforced drug usenegligent motherteardrop tattoocarrying a girldisabled characterdisabled teenagerinstant coffeeolder woman younger boypopsicle sticktendon (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Witch (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Witch (2015)

New England, 1630: William and Katherine try to lead a devout Christian life, homesteading on the edge of an impassible wilderness, with five children. When their newborn son mysteriously vanishes and their crops fail, the family begins to turn on one another. 'The Witch' is a chilling portrait of a β€¦ family unraveling within their own sins, leaving them prey for an inescapable evil. (Read More)

Subgenre:
american horrorindependent filmsuspenseconspiracybritish horrorfolk horror
Themes:
wildernessevilinsanitydeath of fatherfeardeathmurderkidnappingreligionghostmagicsupernatural powerdeath of motherredemptionguilt β€¦illnessdyingdevilmadnessfather love (See All)
Mood:
darknessgorerain
Locations:
backwoodswoodschurchforestvillagerural settingfarmenglandcampfirenew england
Characters:
terrorvillainteenage girlfamily relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipchildrensingerbrother brother relationshipboybrother sister relationshipbaby β€¦sister sister relationshipchristianreference to godlittle girllittle boybiblewitchbaby boythe familydeath of boymother loveasking for forgiveness (See All)
Period:
winter17th century1600s
Story:
evil womanbutcheryslashingbutchermass murderdirectorial debutstabbingaxesubjective camerasecretblood splatterbare chested malemale rear nudityfemale nudityblood β€¦kissnuditymale nudityviolencefemale frontal nuditydogsingingknifecryingsongfoodhorseundressinglierifledemonhallucinationreference to jesus christprayercandlestrangulationwomaneatingfalse accusationsearchgunshotconfessiongravescreamingpoisonpossessionrabbitdeath of brotherdisappearancedeath of sondeath of husbandisolationsuspicionchickensleepingtwinwolfgothiceggwitchcraftcrying womancrying manburialanimal attackgoatapplepromisetensionhypocrisysonhungershovelpridemurder of a childslaughterlanterndead boydemonic possessionfieldkilling spreebonfireblack magicsinshameprayingbarking doglevitationfarmingrunning awaybaptismbreast feedingkilling a dogname callingsatanismwhisperingwhistlingbleedingnewborn babyravengame playinghymnkiss on the cheekmiserycornchild abductionminimalismsaying gracechantingno endingflintlock riflechopping woodcowardicepatriarchbanishmenthutsatandead brotherdead babylord's prayerlost in the woodsnew hampshirereference to the ten commandmentswashing clothesanimal trapdead sonreference to luciferreference to abrahambloodstainpuritanred capepuritanismchild sacrificereference to jobdaughter murders motherforebodingmilking a goatcovenantevil winsram1630sreference to englandhomesteaderpossessed boybathing in bloodnewborn sonconjuringpeek a boosilver cup (See All)

The Last House On The Left (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (2009)

While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β€¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)

Subgenre:
american horror
Themes:
brutalitypsychopathmurderdeathfriendshiprevengekidnappingrapetortureguiltsadismcrueltyvengeancemurder of a police officer
Mood:
slashergorehorror movie remake
Locations:
lakekitchenwoodsforestboatmotelstorm
Characters:
terrorteenage girlhusband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipserial killerhostagekillerserial murderer
Story:
psycho killerhomicidal maniacsummer vacationmurder of a nude womanfemale serial killerdepravityshot in the neckpsychopathic killerperversionmaniacstabbed in the backscantily clad femalestabbed to deathcleavageblood splatter β€¦beatingshowerbare chested malefemale nuditybloodviolencefemale frontal nudityfemale rear nuditychasepantiespistolcell phonecorpsecar accidentshot in the chestremakeshot in the headpunched in the facemaskheld at gunpointcar crashshot in the backswimmingfoot chasebound and gaggedwinestrangulationdeath of friendstabbed in the chestwhite pantiesnecklaceon the runliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonmurdererthreatened with a knifegirl in pantiesfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusrape victimrapistfemale killerwoman in jeopardystealing a carfight to the deathpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downconvictrainstormabusive fathersexual assaultcopulationmarijuana jointgirl in bra and pantiesmadmanparalysisviolence against womenhead woundmisogynisthuman monsterremorsefemale friendshipsexual violence17 year oldescaped convictshot in the eyenihilismheld captiveunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimbreaking a bottle over someone's headsexual humiliationknife held to throatmicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All)

IrrΓ©versible (2002) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

IrrΓ©versible (2002)

Events over the course of one traumatic night in Paris unfold in reverse-chronological order as the beautiful Alex is brutally raped and beaten by a stranger in the underpass. Her boyfriend and ex-lover take matters into their own hands by hiring two criminals to help them find the rapist so that th β€¦ey can exact revenge. A simultaneously beautiful and terrible examination of the destructive nature of cause and effect, and how time destroys everything. (Read More)

Subgenre:
cult filmindependent film
Themes:
evilinsanitybrutalitypsychopathcorruptionfearmurderdeathrevengedrugsrapemoneypregnancydrinkingvoyeurism β€¦incestseductionangerlonelinessparanoiadrug usesadismhomophobiacrueltyvengeanceaidsmadnessfather daughter incestrape and revenge (See All)
Mood:
darknessnightgore
Locations:
waterbarcarparis francetaxielevatorurban settingcityfrancetaxi drivertunnelgay barsex in a bathroom
Characters:
policehomosexualfather daughter relationshipchildrenprostitutegay sexpolicemandancerex boyfriend ex girlfriend relationshippimp
Story:
sexual perversionfemale in showerdegenerationdepravitydark pastperversionpedophilemercilessnessnipples visible through clothingtransvestitescreamcleavageblood splatterbeatingshower β€¦male rear nudityfemale nuditybloodkisssexmale nudityviolenceone word titlebare breastsfemale frontal nuditymale frontal nuditymasturbationfemale rear nudityfightfemale full frontal nuditycigarette smokingdancingphotographpartyknifeleg spreadingerectionpantiesfondlingmirrorslow motion scenepunched in the facewritten by directordrinkinterrogationprostitutionjailvoyeurmale pubic hairgay slurbedroomwinecandleambulancewomancocainefemale pubic hairsubwaynonlinear timelinewhite pantiespainstrippingbeaten to deathdangerscreamingevil manactor shares first name with characterlong takeisolationsadnesstrapthreatened with a knifewhippingheroinbralesshatehuggingdestinystreetdresssociopathsexual abusecomahappinessvandalismassaultdesperationsadomasochismrape victimnaked womanfaterapisthomicidewoman in jeopardysufferinghatreddespairstairspanties pulled downdisfigurementunsimulated sexsexual assaultbruisesodomymisogynyfire extinguishermenstruationhead blown offmisogynisthuman monstersubway stationsnorting cocainebitternesssexual violenceselfishnesspregnancy testmasochismanal rapehead injurycrushed headhallwaysex clubextreme violencedisfigured faceoverhead camera shotsex workerwhite dresspsychotronic filmcocaine snortingphilosophercurtainwashingcelibacydebaucherysexual sadismsexual torturesnorricamsexual crueltybreaking a car windowparisbroken windshieldlawn sprinklereye candymoral corruptionskull crushinghit on the head with a fire extinguisherviolence against a womansexual exploitationdeviant sexbattered womanaltruismpeugeotwatching a porn videounderpassflashing lightsex maniacfacial disfigurementhit with a fire extinguisherhardcore technoreverse chronologystreet prostitutiontransvestite prostitutefrench shock cinemablue lightcredits rolling downmistaken for a prostitutederanged manpopperssex degeneratebroken car windowsadistic sexretrograde narrativebreaking an armperverse sexrape scenetapewormtorn pantiesbrutal rape (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Scream (1996)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream (1996)

1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of β€¦ many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)

Subgenre:
cult filmcoming of ageblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorpsychological thrillerhorror spoof
Themes:
brutalitypsychopathfeardeathmurderfriendshiprevengeinfidelitybetrayaldrunkennessescapeinvestigationextramarital affairdivorcedeath of mother β€¦paranoiahome invasionnear death experiencedeath of daughter (See All)
Mood:
darknessslashergoresatirehigh school
Locations:
kitchenwoodsforestsmall townpolice stationschool bus
Characters:
slasher killersheriffvillainfemale protagonistteenage boyteenage girlpolicefamily relationshipshusband wife relationshipfather son relationshipfather daughter relationshipteenagermother daughter relationshipboyfriend girlfriend relationshipbrother sister relationship β€¦serial killersingle fatherself referential (See All)
Period:
1990s
Story:
mystery killernipples visible through clothingteen angstfirst partscreamcharacter's point of view camera shotfirst of seriesstabbed in the backstabbed to deathflashlightsubjective camerablondeblood splattersurprise endingbare chested male β€¦bloodf ratedviolenceone word titlecigarette smokingtitle spoken by characterpartyknifechasepistolfirecell phonecorpseshot to deathcar accidentshot in the chestface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputercatarrestfalling from heightmaskshowdownheld at gunpointbeercar crashinterrogationhandcuffstelevisiontelephonef wordsurvivalfoot chasebound and gaggedcaliforniadisguiseambulancedeath of friendthroat slittingstabbed in the chestweapontied to a chairbrunettefalse accusationno opening creditsdisarming someonevannews reportshot in the foreheadstalkervirgindangersuburbwidowerelectrocutionproduct placementhangingprankshot in the shoulderamerican flaghigh school studentstalkingcheerleaderpremarital sexsuspicionthreatened with a knifecult directorgaragesingle parentstrong female charactereavesdroppingropeanswering machinefalling down stairsrevelationloss of virginityheroinelifting someone into the airgroup of friendskicked in the stomachvideotapegossipcovered in bloodfaked deathstrong female leadcrushed to deathsocial commentaryhomicidemasked manpresumed deadduct tape over mouthcrime scenedamsel in distresscameohaunted by the paststealing a carunderage drinkingpower outageevacuationplot twistescape attemptframe upstabbed in the legfat manjumping through a windowdisembowelmentblood on shirtconvictlens flarefemale reportercharacters killed one by onemasked killerframed for murdermedia coveragenews reporterintestinesanniversaryyellingdirector cameohiding in a closethigh school teacherhomagevideo storediscoverypopcornclimbing through a windowwhodunitcameramandeputycrushed headjockdeath of boyfriendrepeated linetragic pasttabloidpsychological torturewrongful imprisonmenttelevision reporterfamous linevillain not really dead clichewrongful arrestbreaking a bottle over someone's headwoman in dangerquestionred herringwater fountainsittingfalling off a roofdutch anglerookie copgeneration xcut armcurfewloss of girlfriendaccomplicehigh school principalabandoned cardead teenagerhomoeroticteen violencefake bloodmurderer duovideo store clerkthreatening telephone callhanged bodyend credits roll callknife in backreflection in eyemotivehit with a doorphone terrorhiding in a bathroomtelephone terrortrailer narrated by don lafontainemetafictionreference to richard gerevoice changerreference to freddy kruegerwatching horror movie on tvintestinereference to meg ryanbeer bongbased on paintingfilm geekreference to anthony perkinsreference to ricki lakewatching a horror moviereference to jamie lee curtis (See All)

The Hills Have Eyes (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Hills Have Eyes (2006)

While celebrating their 50th wedding anniversary, a couple are caravanning through the desert with their 3 children, son in law and their baby granddaughter. While the rest of the family agrees there are plenty of better and more appropriate things to do to celebrate an anniversary, they make do wit β€¦h what they have, but things take a turn after a sketchy gas station attendant informs them about a "short cut" that will take them in between a series of hills in the desert. It doesn't take too long before they realise they're not alone and the hills indeed do have eyes. (Read More)

Subgenre:
psycho thrillertragedy
Themes:
evildeath of fatherbrutalitypsychopathdeathmurderrevengesuicidekidnappingrapetorturedeath of mothersadismdeath of wifecannibalism β€¦self sacrificemadnessmurder of familyghost town (See All)
Mood:
slashergorehorror movie remake
Locations:
desertcavegas stationsuv
Characters:
terrorvillainteenage boyteenage girlfamily relationshipsbrother sister relationshipserial killerbabykiller
Period:
year 2006
Story:
homicidal maniacaxe murderserial murderpsychopathic killermaniacfirst partvacationstabbed in the backcontroversysevered headaxeblood splattersurprise endingbloodviolence β€¦dogpistolcar accidentshot in the chestshot in the headshotgunfalling from heightcar crashrevolverfoot chaseimpalementstabbed in the chestexploding carshot in the foreheadperson on fireevil manbaseball batamerican flagglassesmurderersevered armdismembermentkillingsplatterclaim in titleburned alivekilling an animalmutantragemutilationwalkie talkievictimrapisthomiciderampagesevered fingerstabbed in the throatcannibalgunshot woundstabbed in the headstabbed in the legdeath of sistertrailerminebody countmutationsevered legkilling spreedeath of loved onemannequinbad guyhysteriamadmancrucifixionex copkilldead animalkilling a doghead blown offhuman monstergerman shepherdstrandedsexual violenceexploding truckbitten in the neckburnt bodyextreme violenceminersiblinggraphic violencestabbed in the facecut into piecesbloody violencedeformitystupid victimvillain not really dead clicheheart in handwedding anniversaryloss of parentsbrother in lawinfantsevered eargas station attendantaxe in the headpick axestabbed in the footfamily in dangerouthouseanthropophaguskidnapped childinbreedingdrug referencebirth defectgraphic rapenuclear testinggovernment secretwalking through a wallsevered spineradioactive fallout (See All)

Child's Play 2 (1990)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Child's Play 2 (1990)

Andy Barclay has been placed in a foster home after the tragic events of the first film, since his mother was committed. In an attempt to save their reputation, the manufacturers of Chucky reconstruct the killer doll, to prove to the public that nothing was wrong with it in the first place. In doing β€¦ so, they also bring the soul of serial killer Charles Lee Ray back to life. As Chucky tries to locate Andy, the body count rises. Will Andy be able to escape, or will Chucky succeed in possessing his body? (Read More)

Subgenre:
psycho thrilleramerican horrorblack comedysupernatural
Themes:
evilpsychopathdeathsupernatural power
Mood:
slashergoreraincar chase
Locations:
chicago illinoisschool buswater gun
Characters:
slasher killerterrorvillainpolicehusband wife relationshipboyteacherserial killerkillerserial murderernew student
Period:
1990s
Story:
psycho terrorpsycho killerhomicidal maniacbutcherypsychopathic killersuffocationbutcherpsychomaniacobscene finger gesturestabbed to deathbloodsequelcigarette smokingsinging β€¦punctuation in titlecorpsedigit in titlecar accidentslow motion scenefalling from heightheld at gunpointsecond partapostrophe in titlefoot chasebound and gaggedstrangulationambulancethroat slittingstabbed in the chesttied to a chairfalse accusationchild in perillimousinebeaten to deathelectrocutionpossessiondollevil manlightningdeath of husbandbasementneck breakingmurdererthreatened with a knifefalling down stairsburned alivegothiclifting someone into the airtied to a bedtoynosebleedsevered handblack humorshovelstabbed in the legexploding headthrown through a windoweye gougingswingraised middle fingerstabbed in the eyesocial workersevered legsequel to cult favoritevoodoopajamasframed for murderbad guymadmanhiding in a closetevil spiritclimbing through a windowelementary schoolhanging upside downburnt facehead bashed inactress shares first name with characteryuppiedripping bloodsewing machineorchestral music scorehiding under a bedbloody violencedigging a gravesadistic psychopathlocked in a roomvillain not really dead clicheliquor storetrail of bloodbedtime storyfire alarmevil dollfoster homemidwestthrown through a windshieldassembly linechantfoster parentlocked in a closetfalse accusation of murderfoster mothercar phonekiller dollgruesomefoster fatheraccused of murderdisbelieving adultpsycho filmreference to pinocchiohiding under the coverschild smoking a cigarettenewspaper manreference to hansel and gretelscore employs electronic instrumentstoy factoryfoster parentingsuffocated with plastic bagthrown down stairsevil smileelectric knifereflection in a car mirrorxeroxfoster sister (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Carrie (1976) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Carrie (1976)

It's nearing the end of the school year. High school senior Carrie White is a social outcast, largely due to being unwise to the ways of the world based on her upbringing. Her mother, Margaret White, is a religious fanatic, her extreme views primarily targeted against sex, which she believes is a si β€¦n. She even believes natural associated processes such as menstruation are a sin, about which she has refused to mention to Carrie. Mrs. White's beliefs were taken to that extreme largely because of her own failed marriage and her husband Ralph long ago having run off with another woman. The only adult authority figure who tries to help Carrie with her life is her phys ed teacher, Miss Collins, who is nonetheless warned not to get too close to go against how Mrs. White chooses to raise Carrie, Mrs. White whose beliefs are well known in the community. An impromptu event that happens among Carrie's phys ed classmates against her leads to her classmates being punished. One of those students, self absorbed Chris Hargensen, vows revenge against Carrie for that punishment, the method of the revenge associated to the phys ed class incident. Another student however, the popular Sue Snell, begins to feel sorry for Carrie. In wanting to help her get out of her shell, Sue asks her boyfriend, the equally popular Tommy Ross, to take Carrie to the senior prom instead of her. This move does not sit well with Mrs. White, who in her extreme view believes Carrie will fall prey to sin. All these comp… (Read More)

Subgenre:
american horrorcult filmindependent filmcoming of ageblack comedysuspensetragedyfairy taleteen movieteen romanceteen horrorcoming of age film
Themes:
traumaevilhumiliationinsanitydancefearmurderdeathfriendshiprevengereligionangersupernatural powerdeath of motherparanoia β€¦depressiondysfunctional familyredemptionguiltsexualitydatingpoetrysadismbullyingunrequited lovecrueltypanicdyingvengeancefirst lovepsychological trauma (See All)
Mood:
nighthigh schoolnightmare
Locations:
waterschoolcarcemeterysmall townbicycleschool busschool teachersex in a carschool danceoral sex in a car
Characters:
terrorfemale protagonistteenage boyteenage girlteenagermother daughter relationshipboyfriend girlfriend relationshipteachergirlstudentchristianreference to godbullysingle motherteacher student relationship β€¦biblereligious fanaticself confidenceout of controlreligious zealotmean girlmother versus daughterevil student (See All)
Period:
1970sfuturenear futureyear 1979
Story:
sexual attractionevil womanfemale psychopathbad girlhostilitygrindhouse filmsexual repressionmenacevolleyballshortsshynesspractical jokeattractionteen angstfirst part β€¦stabbed in the backstabbed to deathstabbingbathroomblondeunderwearshowersurprise endingfemale nuditybloodkisssexcharacter name in titlebased on novelviolenceone word titlefemale frontal nudityfemale rear nudityfemale full frontal nuditycigarette smokingdancingtitle spoken by characterknifepantiesfirecryingbased on bookdreamcar accidentface slapslow motion scenewatching tvbare buttreference to jesus christclassroomprayerf wordbedroombracandledeath of friendmontageimpalementstabbed in the chesthouserock bandchild abuseexploding carbrunettedream sequencegraveyardgravelibrarydangerscreaminglocker roomelectrocutionknocked outpranklong takeconvertiblegymhigh school studentcrosssplit screenisolationpigsadnessschoolgirlstagethreatened with a knifecult directorpsychicclass differencesgraffitikillingteenage sexsingle parentpoemnerdundergroundfalling down stairsdestructiondesirestreetdressgothicragecrucifixhammerbuttocksblockbustergossipcovered in bloodgrindhousecrushforbidden lovecompassiondead womanfemale killercrushed to deathhomicidesexual desirerampagereverse footagerejectionballreference to satanbible quotehit on the headsibling rivalryrosesurpriseatticlonerclassmatebody countpublic humiliationdemonic possessionstadiumjuvenile delinquentlaughingalienationdead woman with eyes opentelekinesisnewspaper clippingcrowdmusic bandphysical abusesinsouthern accentt shirttorso cut in halfjoytombgothprayinghysteriaforename as titlestabbed in the handmenstruationoutcasthigh school teacherkillteenage lovelong hairabuse of powerfemale teacherdoubtadolescencealonebitternessrepressionbully comeuppanceoutsidercrowndomineering motherredheaded womanschool principalknocked unconsciousmisfitjacketprincipalgeneration gapteenage daughterteenage sexualitypopularitydisappointmentwrathlocked doorpromshirtsewing machinecar set on firepsychic powergraphic violencefrightdisillusionmentstarsgravestoneopposites attractmatricidedeath of title characterbloody violencehit with a hammersymbolteenage girl in underwearabusive boyfrienddetentioniconnight timewhite dressanimal killingtreesvillain not really dead clichedisturbed individualsexual humiliationschool lifesinisterreference to the devilloss of controlabusive motherburningtauntingdeeply disturbed persondance contestbuckettamponwashingfemale studentcliquedesolationdark heroineextrasensory perceptionwork outburning househigh school dancehigh school principalwoman kills womanslumber partyfire enginedead teenagerdisturbingfanaticismgym classgym teachervillainess played by lead actressmass destructionbad motherremadedrive in classictrousersyearbookbased on the works of stephen kingquarterbackmass deathridiculereference to the antichristashtrayhorror movie remadeteasemenstrual bloodjuvenilepsionic powerhigh school prommenarchefurystrange personwoman stabbedteen lovefemale bullyflipping carunderageparty dressmultiple stabbingoverprotective parentwrong side of the trackslast supperparanormal phenomenonpink dresspopular girlfitting inshy girlprincipal's officeschool yearbookcruel jokebackwardsinferiority complexmaniaprom nighthigh school sweetheartsprom queenprom dressfiretruckhigh school lovecracked mirrortroubled teenage girlhand from graveoddballteenage pranksterburned up caradolescent romancecollapsing housedeath by falling objectfemale slaps femalefirestormprom kingfirestarterclosed doorspig bloodteenage alienationbucket of bloodmultiple viewsindex cards (See All)

A Nightmare On Elm Street 4: The Dream Master (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 4: The Dream Master (1988)

Following up the previous Nightmare film, the dream demon Freddy Krueger is resurrected from his apparent demise, and rapidly tracks down and kills all three of the surviving Elm Street kids. However, Kristen (who has the ability to draw others into her dreams) wills her special ability to her frien β€¦d Alice before her demise. Afterwords, Alice soon realizes that Freddy is taking advantage of that unknown power she now wields to pull a new group of teenage children into his foul domain. (Read More)

Subgenre:
american horrorcult filmindependent filmmartial artsblack comedysuspensesupernaturalparanormal
Themes:
evilpsychopathmurderrevengefuneralsupernatural power
Mood:
slashergorerainhigh schoolnightmare
Locations:
beachhospitalcemeterysmall townelevatorschool nurseblood in water
Characters:
slasher killerterrorvillainfather son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanbrother sister relationshipserial killertough guylittle girlwaitresskillerserial murderer
Period:
1980s
Story:
psycho killerhomicidal maniacmurder spreebutcheryserial murderslashingpsychopathic killerbutcherteen angstmaniacsevered headstabbed to deathblood splattersurprise endingbare chested male β€¦bloodnumber in titlesequelfemale frontal nuditydogcigarette smokingphotographfiredreamcorpsedigit in titleurinationface slappunched in the faceplace name in titlerock musiccar crashneighbornumbered sequeldemonambulancedeath of frienddinerstabbed in the chestcoffincharacter repeating someone else's dialoguelocker roomwidowerperson on firepay phoneevil mankicked in the faceskeletondeath of brothercheerleaderdeath of songlassesmurdererunderwatersevered armsleepingkillingundeadpizzasurgeryelectronic music scoreslow motionwoman with glasseslifting someone into the airmutilationstabbed in the stomachkicked in the stomachfourth partmovie theatercrushed to deathback from the deadrampageseriesresurrectionstabbed in the headblack and white scenedaydreamsouldisfigurementabusive fatherlooking at self in mirrorbroken armkilling spreevillain played by lead actorbad guyreturning character killed offneedlejunkyardohiodefecationold dark housecockroachevil spiritbugweightliftingclimbing through a windowfish tankbroken mirrorasthmaburnt facebody in a trunkdripping bloodafrican american womanpunching bagjockdeath of boyfriendhome videoclawsadistic psychopathburn victimtime loopplant in titlehead ripped offreturning character with different actorwater fountainfedoralifting female in airbandanaglovetroubled teendeja vufalling through the floorman dressed as womanpayphonereanimationcrushed by a cardaydreamingrepeated eventfalling asleepchild killersleeping pillsbitten on the armchild murdererhand through chestdisturbingtorturerafrican american mandemonicoverprotective fatherstreet in titleboiler roomsadisticsequel to cult filmreference to aristotledrive in classicserial child killerwaterbedlucid dreamdead body in waterthrown through a wallburn scarpin upsandcastlefreddy kruegerreflection in watertumbleweeddart boardserial teen killerbitten by a doghand through headnunchuckreflection in car mirrordog urinationtheatre marqueeasleep at the wheelloss of best friendhole through torsoserial child murderelm streetspringwood ohiofilm starts with a quotepin up girlserial child murdererfemale stuck in sticky substanceproducer cameofalling asleep in classscar tissuevolkswagen cargrumpy father (See All)

The Final Girls (2015)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Final Girls (2015)

When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit β€¦h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)

Subgenre:
independent filmslasher flickteen moviesurvival horrorteen horrorhorror spoofslasher spoofhorror comedyslasher horrorhorror parody
Themes:
brutalityfeardeathmurderfriendshiprevengesurrealismkidnappingescapevoyeurismseductiondeath of mothertime travelbullyingpanic β€¦self sacrificenear death experience (See All)
Mood:
slashersatirespoofhigh schoolparodyambiguous ending
Locations:
woodshospitalforestsinging in a car
Characters:
slasher killerfemale protagonistteenage boyteenage girlhomosexualteenagermother daughter relationshipdoctortattoogirlserial killernursehostagekillermother β€¦ex boyfriend ex girlfriend relationshipparent child relationshipself referentialparty girl (See All)
Period:
1980syear 1986year 1987
Story:
shot with an arrowcamp counselorgrindhouse filmsummer campdark pastmercilessnessscreamstabbed in the backscantily clad femalesevered headstabbed to deathcleavagedecapitationvomitingblonde β€¦surprise endingbare chested maletwo word titleflashbackviolencecigarette smokingdancingexplosionknifechasethree word titlepantiesfirecell phoneshot to deathcar accidentshot in the chestrescueslow motion sceneundressingshowdowncar crashvoyeurf wordgood versus evilsurvivalfoot chasegay slurorphansword fightambushmontageimpalementdinerstabbed in the chestaccidentwhite pantiesexploding carbrunettedrivinghit by a cardouble crossvanflash forwardattempted murdervirgindangerprologuescreamingstripteaseperson on firerace against timelightningprankscarhigh school studentfilm within a filmneck breakingrecord playergirl in pantiesbow and arrowelectronic music scoremacheteslow motionbarnwatching a moviemovie theaterlosscamphome movievirginitymasked manpresumed deadtarget practiceplayboy magazineescape attemptblack and white scenecigarette lighterjumping through a windowblack and whitebooby trapknife fightfogdisfigurementknife throwinggasolinebody countcharacters killed one by onegeekmasked killerteleportationporn magazineface maskfinal showdownbloopers during creditsurban legendmovie actressfilm in filmhospital bedcigaretteone linerman kills a womanretrowoman kills a manjocksole black character dies clichelighting a cigaretteopen endedoverturning carsome scenes in black and whitetragic pastiphonepsychotronic filmburn victimcar rolloverstupid victimclimbing out a windowwalkmanfirecrackerzippo lightervinyldeja vuslow motion action scenebear trapsexual innuendohigh school seniorsing alongdouble entendreflaming arrowrubik's cubefake trailerminiskirtfuntime travelerplanningthrown through a windshieldouthousefansmetascream queenvolkswagen busouttakes during end creditsyear 1957murder by stabbingprank gone wronghorror filmmovie reality crossoverface burntasting bloodshackledmetafictiontotem polegender in titlereference to loch ness monsterslashed to deathtrip and fallbig hairreference to bigfootneo 80sclothes on fireopening creditsunpaid billtime jumpreference to bon jovithrown through the airblood spattered facedistracted driver (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Suspiria (1977)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Suspiria (1977)

Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p β€¦revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)

Subgenre:
cult filmindependent filmcoming of agesuspenseconspiracysupernaturalfish out of waterarthouseart horrorpsychological thrillersupernatural horroritalian horror
Themes:
evilbrutalitydancefearmurderdeathfriendshipsurrealismdrunkennessescapedeceptionvoyeurismsupernatural powerparanoiaillness β€¦sadismunrequited lovecrueltypanicblindnessself sacrificemysterious death (See All)
Mood:
darknessslashernightgorerainavant gardestylization
Locations:
woodsschoolswimming poolforesttaxiairportapartmentgermanytaxi driver
Characters:
mysterious killeraunt nephew relationshipfemale protagonistteenage girlteenagerfrienddoctorboyteachergirlpolice officerstudentsister sister relationshipkillerpsychiatrist β€¦professorwitchgermanamericanamerican abroadself mutilationevil witchnew student (See All)
Period:
1970syear 1977
Story:
unknown killerknife murdergrindhouse filmslashingpsychopathic killermercilessnessnipples visible through clothingfirst partscreamcharacter's point of view camera shotstabbed to deathstabbingsubjective camerabathroomsecret β€¦blood splattersurprise endingflashbackbloodviolenceone word titledogcigarette smokingdancingexplosionknifechasetelephone callfirevoice over narrationcorpseslow motion scenefalling from heightshowdownpianodemonhallucinationvoyeurtelephoneswimminggood versus evilfoot chasewineambushstrangulationdeath of friendthroat slittingimpalementtoiletstabbed in the chestcoffinritualattempted murderlegendcharacter repeating someone else's dialoguedangerprologuescreaminglocker roommissing personcover upcollege studentlightninghangingdisappearanceinjectionsuspicionmurdererthreatened with a knifeballetcult directorpubeuropekillingitalianocculteavesdroppingburned alivekilling an animalelectronic music scorehypodermic needlegothicheavy rainlooking at oneself in a mirrorfaintingcookexploding buildingwitchcraftnosebleedgossipservantvisitcovered in bloodgrindhousevictimanimal attackdead womanschizophreniafull moonreverse footagebloody noseblood on facestabbed in the throatfemale leadpower outagestabbed in the neckmutebroken glasspsychotronicescape attemptcigarette lighterheartaerial shotatticshadowblood on shirttitle at the endrainstormdisfigurementnotedressing roomblind manopening a doorroomdead woman with eyes openlightbatpiano playerbarbed wireinvisibilityspiral staircasegerman shepherdmetaphorevil spiritpiano playingclimbing through a windowsleepschool principalwhisperinghearing voiceswormwhistlingrazoroffscreen killingbitten in the neckmacguffinpsychiatryrazor bladebreaking a windowhallwaygraphic violencemaggotbloody violencecoughing blooddog attacklocked in a roomsecret passageheadmasterhouse on firesilhouetteanimal killingfade to blackghoulglowing eyesnoiseextreme close upzippo lightersinisterwethorror artbitten in the throatblond boythroat rippingflickering lightacademydrinking bloodleotardtaxi ridehidden doorexterminatorgargoyleevil powerfragments of glasshanged womanitalian cinemademonicmale dancerremadedrive in classicstabbed in the heartknife woundprogressive rockfiendwiredance instructorcovengory violencesatanichanged girlindoor swimming poolhell on earthrotting corpsehole in chestdrugged foodemployee dismissalreanimated corpsestabbed with glassfootstepsseeing eye dogballet schoolballet teacherbitten by a dognauseahallucinogenicwall paintingmultiple stabbingshiding behind a doorballet shoesfalling through a glass roofrotten foodattacked by a dogmusical sceneguide dogstained glassstudy abroadcolor blindnesspsychiatric treatmentknife in throatserving traywoman hangedraspy voiceblind musiciandance academypainting fingernailsempty worldthematic cinema (See All)

The Fog (1980) is one of the best movies like Sleepaway Camp (1983)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Fog (1980)

As the centennial of the small town of Antonio Bay, California approaches, paranormal activity begins to occur at midnight. 100 years ago, the wealthy leper Blake bought the clipper ship Elizabeth Dane and sailed with his people to form a leper colony. However, while sailing through a thick fog, the β€¦y were deliberately misguided by a campfire onshore, steering the course of the ship toward the light and crashing it against the rocks. While the town's residents prepare to celebrate, the victims of this heinous crime that the town's founders committed rise from the sea to claim retribution. Under cover of the ominous glowing fog, they carry out their vicious attacks, searching for what is rightly theirs. (Read More)

Subgenre:
american horrorcult filmindependent filmparanormalcreature feature
Themes:
evilfearmurderdeathrevengeghostescapemonstersupernatural power
Mood:
darkness
Locations:
waterbeachbarchurchsmall townrural settingseashipcampfirefishing boatghost ship
Characters:
mysterious villainterrorsheriffvillainmother son relationshipchildrenboyzombiepriestsingle motherlittle boyemployer employee relationshipcatholic priest
Period:
1980s1970syear 1979
Story:
grindhouse filmbutcheryslashingdark pastbutchermass murderstabbed to deathstabbingdecapitationsurprise endingtwo word titlebloodviolenceknifechase β€¦corpsesworddead bodydemoncaliforniawomanimpalementchild in perilcursemicrophonestorytellingevil manspeechcrosscult directorkillingundeadrecord playerpirategoldelectronic music scoregothictape recorderlifting someone into the airmutilationstabbed in the stomachcrucifixtreasuregrindhousevictimhitchhikercelebrationwoman in jeopardyreverse footagepower outagepsychotronicautopsyfogeye gougingslaughterpierkilling spreelighthousedjbad guymysterious manliving deadspiral staircasejournalevil spiritblackoutradio stationcoastlistening to a radioscalpelhand over mouthvolkswagenmaggotghoulhookradio broadcasttragic villainmistphonograph recorddockscreepydisturbingmusic score composed by directorstained glass windowdemonicremadedrive in classicbayhorror movie remadefemale hitchhikercampfire storyhell on earthmutilated bodyleperticking clockgrimfemale djcorpscentennialfoghornwitching hour (See All)

Evil Dead II (1987)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Evil Dead II (1987)

Ashley Williams travels to a secluded cabin in the woods with his girlfriend Linda where they find a tape recording of a professor and a book of evil. This unleashes a bunch of evil spirits that constantly terrorize Ash. Meanwhile a journalist comes to the area to study the book of evil. Ash and her β€¦ end up having to survive this swarm of evil until morning comes. (Read More)

Subgenre:
american horrorcult filmindependent filmblack comedyepicdark fantasygross out comedyhorror spoofsupernatural horror
Themes:
evildancemurdersurrealismghostmonstermemorytime travelsadismbook of evil
Mood:
gorenightmareavant garde
Locations:
backwoodskitchenwoodsforestairplanecastlestorm
Characters:
husband wife relationshipboyfriend girlfriend relationshipbrother sister relationshipdancerself mutilation
Period:
1980s1990s20th centuryyear 1987
Story:
obscene finger gesturecabinstabbed in the backsevered headstabbingaxedecapitationbathroomlow budget filmblood splatterunderwearsurprise endingbloodkisssex β€¦number in titleviolencesequelchasethree word titlepantiesvoice over narrationsongmirrorshotgunfalling from heightbooksecond partnumbered sequelpianodemonhallucinationgood versus evilstabbed in the chestanti herotreecursepossessionskeletonbasementhauntingratsevered armshot in the armcult directordismembermentundeadsplatterchainsawfalling down stairsspiritfireplacetape recordertouristroman numeral in titlesevered handknightreverse footageloss of sonshovelpsychotronicthunderstormexploding headfogeye gougingdeerh.p. lovecraftstabbed in the eyedemonic possessioncellarplaying pianodaggerbeheadinglevitationstorehair pullinghead blown offevil spiritportaltornadoknocked unconsciousarcheologysawed off shotgunhillbillycabin in the woodsone linereyeballmeat cleavertragic lovebloodshedtongue in cheekloss of parentsrocking chaircult figurependantreanimationhand cut offshot through a wallwine bottlemousetrapvortexbreaking glassdisembodied handabsurd violenceevil deadover the topsame actor playing two charactersgreen bloodnecronomiconbridge collapsedecapitated headhead cut in halfpixelationactor playing dual rolepart stop motionshallow grave14th centurytarmacsame actor playing two characters simultaneously on screenstop motion scenereanimated corpseanimate tree1300sbook of the deadshattering glassharpyoldsmobilefighting with selfattacked by a plantdemonic undeadromantic songblack bloodcutting off own handtrophy animalglass breakingself strangulationsprayed with blood (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Sleepaway Camp?
<< FIND THEM HERE! >>