Best popular movies like Soul Survivors:

Do you need specific genre & keyword selection to find films similar to Soul Survivors?
<< FIND THEM HERE! >>

Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Soul Survivors (2001)

College freshman Cassandra "Cassie" steps into a nightmare of otherworldly visitations after surviving a devastating car accident. Haunted by a grim reaper of a far different kind, her only hope is to cling to chance encounters with her lost love Sean and the aid of a mysterious young priest named F β€¦ather Jude. It is the spirit of Sean, her soul mate, who guides her to love, but it is her friends Matt, Annabel and Annabel's morose friend Raven who try to draw her to the dark side. (Read More)

Subgenre:
independent film
Themes:
supernatural powerlesbianismghostinfidelity
Locations:
nightclubswimming pool
Characters:
boyfriend girlfriend relationship
Story:
girl stripped down to pantiesgirl in pantieswhite pantiesunderground ravecamel toealternate realitysexual abusecomaundeadpremarital sexvoyeurhallucinationcollegecar crashmask β€¦car accidentdreamtopless female nuditypantiessurprise endinglesbian kissmale rear nudityfemale nuditybare breasts (See All)

Flatliners (2017)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Flatliners (2017)

Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int β€¦ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)

Subgenre:
supernaturaltragedymedicalparanormalteen movieteen horrorpsychological thrillerpsychological horror
Themes:
supernatural powerdeathfriendshiprevengesurrealismfeardrunkennessescapeobsessionparanoiaredemptionguiltbullyingpanicchildhood β€¦near death experienceafterliferegret (See All)
Mood:
nightmarehorror movie remake
Locations:
nightclubswimming poolhospitalbarsnowmotorcyclebathtubbuswaterelevatorapartmentrooftopyacht
Characters:
mother daughter relationshipafrican americandoctornursesecurity guardprofessorcrying baby
Period:
2000s2010s
Story:
alternate realitypremarital sexhallucinationcar crashcar accidentdreamsurprise endingone word titleflashbackbare chested malekissinterracial sexknifeshowercell phone β€¦corpseremakerescueslow motion scenefalling from heightsunglassespianoreference to jesus christsubjective cameraswimmingflashlightdeath of friendmontagebridgeapologyunderwater scenevoice overflash forwardlibrarydangerprologuefantasy sequencecharacter's point of view camera shotrace against timecover updeath of childinjectiontragic eventbasementlaptoptwenty somethingsyringeelectronic music scorehypodermic needleloss of friendmorguecaucasianaccidental deathwristwatchparking garageback from the deadhaunted by the pastpower outageresurrectionfalling to deathdeath of sisteraerial shotdark pastlightmoral dilemmabullet timetext messagingmale objectificationstabbed in the handscene before opening creditsold flamebroken mirrordomineering motherhearing voicesmedical studentraveloss of sisterexperiment gone wronghigh techtragic pastcamera phonetaking off clothesmedical doctorpsychotronic filmbulldozercar rolloverhedonismscience runs amokwhite coatjellyfishflickering lightmedical experimentbritish actor playing american characterrubik's cubepagerwalking stickhouseboatscientific experimentguilty consciencedefibrillationdefibrillatorout of body experienceyear 2017inside the mindseeing dead peoplevirtualitybrain scancompetitivenessparanormal phenomenonreference to jesusside effectcyberbullyingremake of cult favoritemedical sciencemedical scannercar falling off a bridge (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Mulholland Dr. (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Mulholland Dr. (2001)

A bright-eyed young actress travels to Hollywood, only to be ensnared in a dark conspiracy involving a woman who was nearly murdered, and now has amnesia because of a car crash. Eventually, both women are pulled into a psychotic illusion involving a dangerous blue box, a director named Adam Kesher,  β€¦and the mysterious night club Silencio. (Read More)

Subgenre:
independent filmcult filmexperimental filmconspiracy
Themes:
lesbianismghostinfidelitymurderdeathsurrealismsuicidejealousyfilmmakingdeceptionextramarital affairdivorcemafiaguiltmental illness β€¦amnesiaregrethomosexual lovehollywood party (See All)
Mood:
neo noirbehind the scenesnightmareavant garde
Locations:
nightclublos angeles californiataxiairport
Characters:
homosexualfemale protagonistdetectivedanceractresshitmanwaitressmotherdirectorcanadianhomeless mansuicide by gunshotself identity
Period:
2000s
Story:
hallucinationcar crashcar accidentdreampantiessurprise endinglesbian kissfemale nudityf ratedviolencetwo word titleguncigarette smoking β€¦photographtitle spoken by characterpistoltelephone callpunctuation in titlecryingcorpseshot to deathshot in the chestblondeshot in the headplace name in titledead bodytelephonebisexualcaliforniadinernonlinear timelineman with glassesattempted murderlimousinemicrophonekeycowboyauditiontragic eventperiod in titleno pantiesnipples visible through clothingred dresscowboy hatmagicianhollywood californiamovie starmobmovie directorwoman in jeopardydwarfinnocencetv series pilotunfaithful wifesongunshot woundtitle appears in writingengagementfilm setfrustrationboxactress playing multiple rolesdoppelgangerauntbag of moneycastingwoman cryingpaintmovie actressgolf clubvacuum cleanergardenershow businesslandladylip synchingdisfigured facelighting a cigarettemysterious womanbechdel test passedenigmashowbizkangarooschizophrenichostile takeoveridentity crisisloss of memoryidentity swapdoublemental instabilityaerial photographyborderline personality disorderlight bulbniecephone bookstrong sexual contentstreet in titlebroken windshielddualitystolen identityacting auditionit was all a dreamcowboy costumebullet holeoneiricdeliberate crueltymurder disguised as suicidegrandparentshot in the buttstarletchoke holdfemale tearsdisorderheadshotemptinessmafia donshot with a gunactor's lifepool cleanerespressovisual hallucinationname tagactress playing dual roleoptimistbroken dishcorralfilm extragarbage dumpsterlighting someone's cigarettespurned womanhollywood starfull circlered curtainscared to deathpearl earringsecret clubcontradictory accountsjitterbugvintage clothingcasting agentdoo wopcheap hoteldead body in bedmise en abymebased on dreamcheerfulnessmixed identitytwo women in bedflophousemysterious objectmaking of a movieyounger woman older manbroken cuplittle black bookcryptic messagespilled paintcolor symbolismblack book (See All)

The Gift (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Gift (2000)

When Jessica King goes missing, all eyes turn to Annabelle Wilson. Not as a murder suspect, but as a clairvoyant. Many of the towns folk go to Annabelle for help, and Jessica's fiancee, Wayne Collins, turns to Annabelle for possible guidance. Annabelle feels that she can't help, but this doesn't sto β€¦p her from constantly getting visions of Jessica's fate. (Read More)

Subgenre:
independent film
Themes:
supernatural powerghostinfidelitymurderdeathsuicidejealousyadulteryinvestigationdeceptionincestextramarital affairdeath of fatherunfaithfulnessmental illness β€¦father daughter incest (See All)
Mood:
rainnightmare
Locations:
schoolcemeterysmall townbathtubwaterwoodsrural settingwheelchaircourtroomstormbackwoods
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshiptattooboylawyersingle motherlustwitchsheriffsuicide by hanging
Story:
girl stripped down to pantiesgirl in pantieswhite pantieshallucinationdreampantiesmale rear nudityfemale nudityf ratedbloodviolencefemale frontal nudityflashbackmasturbationdog β€¦two word titlebare chested malegunfightdancingphotographexplosionpartyleg spreadingtelephone callfirebeatingcorpsewatching tvthongbare buttsecretliedead bodysex standing uphandcuffscleavagecandlestrangulationwomanwidowchild abusetrialscantily clad femaleritualunderwater scenesearchgraveyardgraveperson on fireliarmissing personbaseball batlightningflowershangingdomestic violencecourtfemale removes her clothesthreatdeath of husbandwitnessloss of fathertied upgrandmotherwhippingcult directorpsychictherapygarageheart attackpickup truckoccultburned alivenipples visible through clothingsexual attractioncaught having sextherapistdysfunctional marriageback from the deadchokingmechanicsexual desirecamera shot of feetredneckwoman in jeopardyreverse footagetensionbloody noseintriguereference to satanswampcard playingcon artistblack eyefoggasolinechainfortune tellerabusive husbandphoto albumunhappy marriagecartoon on tvpromiscuous womanviolence against womenmental breakdownmisogynistfencesouthern u.s.satanismsexual promiscuityschool principalspreadeagledistrict attorneypremonitiongeorgiaprosecutorauto mechanicpondpsychic powertow truckcrowbarslappencilimmolationsocialiteclairvoyantburningmissing girlwomen's bathroomcrotch shotrascalnymphomaniaextrasensory perceptionmarital abusewife abusefamily in dangersatanistactress breaking typecastcountry clubvoodoo dolldark and stormy nightbrokesouthern gothicfemale bare feetimplied incestscratchspouse abusefiddlerpensioneresplasciviousnessbattered womantarot cardsincestuous overtonesinstinctpromiscuous pastswappingpromiscuous daughtersynchronicitypsychic readingsatan worshipsexual child abusehanging mobilesmashing a windshieldblueberry muffindaddy's girlblue diamondkey witnesssetting a man on fire (See All)

The Unborn (2009) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Unborn (2009)

While babysitting a boy and his baby brother, Casey Beldon has a dreadful nightmare involving a weird dog and an evil child, and she tells her best friend Romy over the phone. Casey is haunted by this boy, and when she goes to the ophthalmologist, he asks if she has a twin brother or sister. She ask β€¦s her father and discovers that her mother lost a son that died in the womb. Casey suspects that she is haunted by the spirit of her brother. She finds a letter addressed to a woman called Sofi Kozma and a creepy picture at home that belonged to her mother. She goes with Romy to a retirement home to meet Sofi, a survivor of the experiments during the Holocaust. But Sofi tells Casey that she had never met her mother and later calls Casey to tell her she is in great danger. (Read More)

Themes:
deathrevengesuicidepregnancydeath of motheradoptionholocaust
Mood:
rainnightmare
Locations:
nightclubhospitaltrainwoods
Characters:
boyfriend girlfriend relationshipfather daughter relationshipfemale protagonistpriestsuicide by hangingghost in mirrorgerman officer
Story:
girl in pantieswhite pantiescamel toepremarital sexhallucinationmaskpantiessurprise endingbloodflashbackdogtwo word titlebare chested malekissphotograph β€¦title spoken by characterchaseshowertelephone callbeatingmirrorpunched in the facefalling from heightletterbookvomitingprayerriverflashlightcandleaxevideo camerastabbingbasketballstabbed to deathsubwaydream sequencechild in perilhit by a carrituallocker roompossessiondeath of childcollege studentinjectionlaptoploss of motherclasstwinbralessexperimentcoachfalling down stairssyringediscobabysitterjoggingwalkie talkiestabbed in the stomachloss of loved oneback from the deadwindpower outageball gagstabbed in the neckinsectheadphonesscissorshit on the headsuperstitionjumping through a windowconcentration campaerial shotdemonic possessionexorcismnewspaper clippingshowapparitionelderlyeyestairwaypregnancy testfilm projectorwhistlex raybroken mirrorrabbitwin brotherholocaust survivorbellreference to albert einsteindeath of boyfriendauschwitzgurneykiller childbabysittingdeath of grandmotherfetushebrewevil childgloveimplied nudityinfanthornpendanthuman experimentationfall to deathultrasoundphantomstabbed in the bellybroken backwind chimebaby monitorblue eyescatatoniaabandoned hospitalmirror does not reflect realitycirclebasketball coachpossessed girlkabbalahdistortionstillbirtheyes different colorfried eggone way mirrornazi experimentpit bullhead spinbathroom mirrorgirls locker roomneedle in eyeeye doctorchimecrash through windowhead twisted backwardsdybbukhetero chromiabreaking mirroreye colorcrab walkhome for the old (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Eyes Wide Shut (1999)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Eyes Wide Shut (1999)

After his wife, Alice, tells him about her sexual fantasies, William Harford sets out for a night of sexual adventure. After several less than successful encounters, he meets an old friend, Nick Nightingale - now a musician - who tells him of strange sex parties when he is required to play the piano β€¦ blindfolded. All the men at the party are costumed and wear masks while the women are all young and beautiful. Harford manages to find an appropriate costume and heads out to the party. Once there, however, he is warned by someone who recognizes him, despite the mask, that he is in great danger. He manages to extricate himself but the threats prove to be quite real and sinister. (Read More)

Subgenre:
cult filmsuspenseconspiracyerotic thriller
Themes:
infidelitymurderdeathfriendshipmarriagedrugschristmasmoneyjealousyadulterydrinkingfeardrunkennessdancedeception β€¦voyeurismmemoryextramarital affaircorruptiondeath of fatherobsessionparanoiadrug useredemptionguiltcrueltywealthmysterious death (See All)
Mood:
neo noirnightmarenight
Locations:
new york cityrestauranthoteltaxiurban settingcitytaxi driversex in public
Characters:
boyfriend girlfriend relationshiphusband wife relationshipfather daughter relationshipmother daughter relationshipfrienddoctorboyprostitutegirlnursedancermusicianwaitresslustpsychiatrist β€¦self discoveryfiance fiancee relationship (See All)
Period:
1990s
Story:
girl in pantieswhite pantiescamel toevoyeurhallucinationmaskdreampantiesmale rear nudityfemale nuditybased on novelmale nudityfemale frontal nudity β€¦kissfemale rear nudityfemale full frontal nuditycigarette smokingdancingnipplespartyleg spreadingthree word titletelephone callfondlingcryingunderwearmirrorurinationwatching tvdrinkundressingthongbeerlingeriebeddead body69 sex positioncafemarijuanasex standing upbathroompianoprostitutionorgymanhattan new york citycleavagenewspaperbedroomcandlebanddisguisemansioncocainetoiletfemale pubic hairlesbian cunnilingusmodelman with glassescultno opening creditsscantily clad femaleforeign language adaptationritualroommateconfessionpublic nuditydrug addictblack pantiesstrippingcostumechampagnestorytellingreadingchristmas treepianistfemale removes her clothesblindfoldcult directorsacrificeheroinbralesspowersexual fantasyflirtingpot smokingrevelationno pantiesdesirenipples visible through clothingwoman with glassesbabysittersexual attractionpatientmorguedrug abusetherapistdysfunctional marriageaudienceteddy bearcoitusart galleryvirginitydead womanmasked mandrug overdoserole playingsexual desirebra and pantieshookerrear entry sexsurveillance cameraguestpool tablesex talkjunkiesculpturepanties pulled downfrustrationdeceitwedding ringsailortuxedolooking at self in mirrorbruisenude woman murderedcopulationmannequincoffee shopgirl in bra and pantiesmysterious mang stringdirector cameocartoon on tvchristmas presentpromiscuous womancentral park manhattan new york citydoubtfemale removes her dressjazz musicbitternesssexual tensionthong pantiessex orgyunconsciousnessreceptioniststonedmissingmarriage problemsnaked dead womanrainbownude with glassespasswordritecaressteenage girl in underwearblack dressrehablolitasexual obsessionhungariansubculturefemale sitting on a toilettrophy wifehiv positivecuriositymarital crisisgreenwich village manhattan new york cityjazz clubtoy storemedical schoolguilty conscienceilluminatishooting upmasked womantaking off pantieslynchianuninvited guesthotel desk clerkpramsociologistprivilegedead woman in morguesexual curiositymasked ballpromiscuous daughtercape cod massachusettslooking in mirror while nudesoho manhattan new york cityex classmateunwanted guestcostume shopwife and husband lead actorsblue lightrockefeller center manhattan new york citysecret clubchristmas shoppingreal life husband and wife play husband and wifechristmas starosteopathhouse callreference to the nutcrackerlaughing fitsex act reflected in a mirrorbackground music score revealed to be source musicbald spotdog muzzlereference to ovid (See All)

Poltergeist (1982)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Poltergeist (1982)

A young family are visited by ghosts in their home. At first the ghosts appear friendly, moving objects around the house to the amusement of everyone, then they turn nasty and start to terrorise the family before they "kidnap" the youngest daughter.

Subgenre:
cult filmparanormal investigation
Themes:
supernatural powerghostvoyeurismdysfunctional familyafterlifemissing childscience versus supernatural
Mood:
moving
Locations:
swimming poolcemeterykitchen
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipboybrother sister relationshipteenage girlgirlphotographersister sister relationshiplittle girllittle boyemployer employee relationship β€¦blonde girl (See All)
Period:
1980s
Story:
girl in pantieswhite pantiesvoyeurhallucinationpantiesone word titleinterviewcorpsemirrorblondewatching tvcameralingeriemarijuananeighbor β€¦televisiongood versus evilcleavagevideo camerahousescantily clad femalecoffinchild in perilclownsuburbfirst of seriesskeletonhauntingfirst parthaunted houseobscene finger gesturecult directorpsychicpot smokingspirittape recorderlifting someone into the airtoyamerican footballblockbusterburialbarefootremote controlreverse footagechild's point of viewpet dogpsychotronicthunderstormchairwilhelm screamreal estate agentapparitionlegsreal estatetornadospreadeaglegoldfishmediumpsychic powermiddle classmaggotorchestral music scorereference to star warsbulldozeralternate dimensionevil clownvideo cassettepoltergeisthauntedcrotch shotshort shortsphonograph recordevil dollghost huntertv setentitygolden retrieverlifting a female into the airsource musicparanormal investigatoranimate objectgiving the fingerburial groundbike ridingparanormal phenomenonparapsychologyanimate treestar wars referencehousing developmentsymphonic music scorelife forceanimate dollthe star spangled bannerattempted child strangulationparapsychologistvertigo shotancient burial groundkiller treeobject floats in the airpsychic investigatortelevision as portal (See All)

Freddy Vs. Jason (2003)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Freddy Vs. Jason (2003)

It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun β€¦d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)

Subgenre:
independent filmcult filmsuspensesupernaturalpsycho thrillerparanormal phenomenaslasher flickamerican horrorcanadian horror
Themes:
supernatural powerghostmurderdeathrevengesuicidekidnappingfeartorturedrunkennesspsychopathdeath of fatherbrutalitydeath of motherinsanity β€¦evilabductiontraumafear of water (See All)
Mood:
gorerainhigh schoolnightmareslasherbreaking the fourth wallblood and gore
Locations:
forestcemeterysmall townpolice stationlakeschool nurse
Characters:
boyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenage girlteenage boyzombieserial killerlittle girlkillervillainsheriffterrorslasher killermysterious villain β€¦serial murderer (See All)
Period:
2000s
Story:
alternate realitycomaundeadpremarital sexcar crashmaskdreamsurprise endingcharacter name in titlebloodviolencesequelflashbackphotographexplosion β€¦partypistolshowerfirevoice over narrationcorpseblood splatterslow motion scenebrawlfalling from heightdemondecapitationfoot chasestabbingimpalementsevered headdream sequencechild in perilunderwater scenevandrowningskinny dippinglibrarycharacter repeating someone else's dialoguevirginprologueperson on fireelectrocutioncharacter's point of view camera shotcover upevil mandeath of childdeath of brotherhigh school studentstalkingneck breakingmurderercabinsevered armdismembermentkillingsplatterchild murdermaniacburned aliveheroinemass murdermachetelifting someone into the airragemutilationpsychosevered handvictimgoatcrushed to deathmasked manrampagesevered fingernew jerseymisunderstandingbutcherpsychotronicmedicationmurder of a childeye gougingslaughterbody countdemonic possessioncharacters killed one by onekilling spreegeekburned to deathmasked killernewspaper clippingpsycho killertorso cut in halfblood on camera lensserial murderpsychopathic killerbad guybeheadingmadmanmysterious manfinal showdownnecrophiliakilldockohiosummer camplockerevil spiritsexual violencehomicidal maniacstonerslashingdomineering motherflaskhanging upside downburnt facecornfielddeputywrist slittingkidnapperdripping bloodchild kidnappingravedeath of boyfriendcrossoverburnt bodypsychiatric hospitalgraphic violenceclawmasked villainbloody violencedeformityfemale victimsadistic psychopathpsychotronic filmbreaking through a doormurder spreemass murderervillain not really dead clicheghoulbutcherychild abductionescaped mental patientfedoracaterpillarglovearm ripped offchild killedsevered earsliced in twoeighth partpsycho terrormidwestchild killerobituarychild murdererhand through chestdead teenagerhockey masktorturerdemonicboiler roomsadisticmissing person posterburnt handpassed out drunkserial child killerbroken backtranquilizergory violenceeast coastlucid dreamsataniccamp counselorgruesomejason voorheesdouble impalementhell on earththrown through a glass dooreleventh parttwo killersshared dreamdisbelieving adultfreddy kruegerfriday the thirteenthmonster versus monsternightmare becomes realityreanimated corpsemachete mutilationpsycho filmserial teen killerbrutaltroubled childhoodreference to the three stoogesmutilated childsevered nosehead spinmonster as victimserial child murderelm streetslashed to deathspringwood ohioabusive childhoodserial child murdererwessex county new jerseycrystal lake new jerseyevil versus evilkilled with machetekiller vs killerdreams vs realityserial teen murdererkilled by machete (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Unbearable Lightness Of Being (1988) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Unbearable Lightness Of Being (1988)

Tomas is a doctor and a lady-killer in 1960s Czechoslovakia, an apolitical man who is struck with love for the bookish country girl Tereza; his more sophisticated sometime lover Sabina eventually accepts their relationship and the two women form an electric friendship. The three are caught up in the β€¦ events of the Prague Spring (1968), until the Soviet tanks crush the non-violent rebels; their illusions are shattered and their lives change forever. (Read More)

Subgenre:
independent filmhistorical event
Themes:
lesbianisminfidelitymurderdeathlovefriendshipmarriagejealousypoliticsadulterydrinkingfearweddingvoyeurismmilitary β€¦extramarital affairblackmailcancerunfaithfulnesssexualityphotographyfreedomaffaircouragephilosophy (See All)
Mood:
rain
Locations:
nightclubswimming poolhospitalbarbeachrestauranttrainsnowfarmtrucktruck accident
Characters:
husband wife relationshippolicefrienddoctorsingersoldierpolicemanphotographerwriterlove trianglewaitressprofessorengineerrussian abroad
Period:
1960syear 1968
Story:
girl in pantieswhite pantiesvoyeurhallucinationdreampantieslesbian kissfemale nuditysexbased on novelnuditymale nudityviolencefemale frontal nudityflashback β€¦male frontal nuditydogfemale rear nudityfemale full frontal nuditycigarette smokingdancingphotographexplosionsingingleg spreadingfirevoice over narrationfondlingcryingunderwearmirrorcameradrinksex in bedlettertearsinterrogationcafemenage a troisswimmingcleavagebrawinebandcaliforniafemale pubic hairscantily clad femaleforeign language adaptationbartenderimmigrationblack pantiesprotestchampagnepassionreadingtankfarmersensualityinjectionfemale removes her clothespigchessriotteano pantieshappinessexercisedemonstrationcommunistdysfunctional marriagemobwomanizerparadepassportinnocenceinvasionchaosnewsreel footageevacuationexilepanties pulled downvoice over letterswitzerlandtangosurgeonbenchpromiscuitycrowdfemale female kissfarmingtractorfemale removes her dresseuthanasiastrikeeditorborder crossingcattlesexual promiscuityatrocitycactusprosecutorreference to john f. kennedyspanude modelinglesbian subtextmerry go roundczechoslovakiafreedom of speechsovietcommitmentnudistinner title cardnude photographarm slingswancurtaincentral europecowardiceheterosexualityfrisbeestalinismbottomlessprague czechoslovakiaintegritypolitical repressionmartial lawczech historymarchingdeath of petgeneva switzerlandsuicide contemplationczechpolitical oppressiontrystsoviet armysuppressionerotic photographyemancipationcognac360 degree panodorfilm with ambiguous titlearm injurypromiscuous manwindow washerhand under skirtmilitary occupationdislocated shoulderfreedom of the pressrussian in europecareerismanthemfemale armpit hairscoundrelsoviet occupationconfiscationinvading armyreference to nikita khrushchevwadingbrain surgeonchampagne glassreference to oedipusbowlerpet pigczechoslovakian historyreference to anna kareninaburial of petfonduemay daysoviet troopsspanielwarsaw pactpolitical uprisingbottomless womanrussian in czechoslovakiasalamipolitical turmoilbrain specialistreference to man rayretraction (See All)

Crank (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Crank (2006)

When the hit-man Chev Chelios is poisoned by the criminal Verona, his friend and doctor Miles advises him that he must keep his adrenaline levels elevated to stay alive. Chev meets his girlfriend Eve and together they look for Verona to kill him.

Subgenre:
cult filmblack comedydark comedyabsurdism
Themes:
deathrevengesuicidevoyeurism
Mood:
gorecar chasebreaking the fourth wall
Locations:
swimming poolhospitalrestauranthotelhelicoptermotorcyclelos angeles californiataxielevatorkitchensex in publicchinese restaurantmotorcycle accidentfire escape
Characters:
doctortattoopolicemantough guyhitmanlust
Period:
2000s
Story:
girl in pantieswhite pantiesvoyeurhallucinationcar accidentpantiessurprise endinglesbian kissfemale nuditybare breastsbloodmale nudityone word titlefemale frontal nudity β€¦title spoken by characterleg spreadingerectionpistolfondlingcell phoneshootoutshot to deathblood splatterfistfightmachine gunshot in the chestshot in the headbrawlfalling from heightshootinghand to hand combatsunglassesbathroomcleavagegay slurassassindrug dealercocainemixed martial artsanti heroscantily clad femaleone man armyunderwater scenespankingcigar smokingnecklaceshot in the foreheadracial slurpublic nudityorganized crimepoisonproduct placementmoaninghangingexploding bodyneck breakingdie hard scenariofirst partdirectorial debuthandgunsilencertransvestitemachismoanswering machineteasyringegrenadekilling an animalhead buttnipples visible through clothinggay charactersexual attractionsecurity camerabearddrug abusesevered handcoitusretirementsexual desiredamsel in distressrear entry sexsevered fingershopping mallsculptureheartone daybody landing on a carduct tapepigeoncopulationshaved headsurprise after end creditspillfemale female kisssuffocationgang warstreet gangsnorting cocainedvdloud sextriadpharmacymeat cleaverbullemergency roomshot in the handgurneyjetsewing machinemotorcycle coptour busfinger gunbody partmodern artmicrowave ovenclothes rippingpharmacistwoman moaning from pleasurewoman moaningmoaning womannewscasterburnmethamphetaminemotorcycle stuntswathospital gownchange of heartmotorcycle crashhomoeroticnumbertrashcandefibrillationgangsta gripgoateebambooorchidscaffoldskylinefirst person perspectivesweatshopintravenousreference to houdiniparakeetenergy drinkcamera shot from inside human bodyhypodermicrolling pinchinatown los angelespart computer animatedpenthouse apartmentpicket fencefalling from a helicoptergoogle earthcharacter can see subtitledaylight saving timehelicopter landing padlast joblawn jockey (See All)

Tucker And Dale Vs Evil (2010)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Tucker And Dale Vs Evil (2010)

Two lovable West Virginian hillbillies are headed to their "fixer-upper" vacation cabin to drink some beer, do some fishin', and have a good time. But when they run into a group of preppy college kids who assume from their looks that they must be in-bred, chainsaw-wielding killers, Tucker & Dale's v β€¦acation takes a bloody and hilarious turn for the worse. (Read More)

Subgenre:
cult film
Themes:
torturevoyeurism
Mood:
night
Locations:
boatbackwoods
Story:
girl stripped down to pantiesgirl in pantiesvoyeurcollegecar crashtopless female nuditypantiesfemale nuditybare breastscharacter name in titlenuditybloodfemale frontal nudityflashbackdog β€¦explosionblondeshot in the headbeercleavagename in titlemassacreimpalementscantily clad femalefishingpolice officer killedfive word titleskinny dippingperson on firevacationcollege studentcabinsplatterpickup truckchainsaweavesdroppingburned alivebeer drinkinggroup of friendsoverallstherapistaccidental deathrednecksevered fingermisunderstandingbooby trapaccidental killingsevered legnewspaper clippingpetgirl in bra and pantiesblue pantiesnudeasthmaaccidental shootingnude girlhillbillycabin in the woodsfall from heightrole reversalhit with a shovelboard gameunwanted kissshot in the crotchscytheburning buildingstockholm syndromeanimal in cast creditsswimming in underwearhung upside downnail gunpick axethrowing starsicklegeneral storecircular sawhead bandagewest virginiafreak accidentsuicide pactbeehivecanuxploitationshallow graveblue brapaternity revealedmistaken for gaycut off jeanslone survivoraxe throwingsawmillaccidental suicidebuddy filmlatrinepit bullmiscommunicationbee attacknail in the headwoodchipperappalachian mountainsblue bra and pantiespancakescollege kidforced to watch rapeweed whackerpsychology studentsummer hometrivial pursuitredneck stereotypedigging own gravecutoff shortsbump on the headcircular saw bladehead mutilated (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Nightmare On Elm Street 5: The Dream Child (1989)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Nightmare On Elm Street 5: The Dream Child (1989)

Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on β€¦e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)

Subgenre:
independent filmcult filmsuperherosupernaturalparanormalstop motion animationslasher flickbody horroramerican horrorurban fantasy
Themes:
supernatural powerghostmurderdeathfriendshiprapepregnancyfearmonsterinvestigationpsychopathbrutalitydepressioninsanitysadism β€¦eviltrauma (See All)
Mood:
gorenightmareslasher
Locations:
swimming poolhospitalchurchcarmotorcyclewatercar on firedeath in a car accident
Characters:
boyfriend girlfriend relationshipfather son relationshipmother son relationshipfather daughter relationshipteenagermother daughter relationshipafrican americanfrienddoctorboyfemale protagonistgirlserial killernursebaby β€¦artistreference to godlittle girlsingle motherwaitresskillerlittle boyalcoholicvillainterrorfatherslasher killercrying babyalcoholic fatherserial murdererpregnant from rapemysterious girlcomic book characterbaby monster (See All)
Period:
1980s1940s
Story:
undeadpremarital sexhallucinationcar crashcar accidentdreamtopless female nuditysurprise endingfemale nuditybare breastssexf ratednuditybloodviolence β€¦sequelflashbackbare chested malegunfemale rear nudityphotographpartyknifechasepistolshowertelephone callcryingblood splatterfoodslow motion scenewatching tvbare buttfalling from heightshootingplace name in titlebeddemongood versus evilfoot chaseflashlightdisguiseambulancestabbingdeath of friendimpalementdinerweaponaccidentapologynunchilddream sequencepart of seriesdrawinghit by a carunderwater scenetransformationpaingunshotlibrarydangerscreaminglocker roomfantasy sequencechampagnepossessiondollevil manscreamskeletonstalkingautomobilemurderersevered armhaunted housedismembermentkillingredheadsplatterfreeze framemaniacwaiterfalling down stairsteen angstwarehousemass murderbeer drinkinggay characterfaintingcomic booklifting someone into the airmutantmutilationloss of friendspidercrying womanvictimskateboardbirthfollowing someonepicnicback from the deadcelebrationmental institutionrampagedamsel in distresstensionplaygroundblood on faceanimated sequencemental hospitalblack and white sceneskateboardinghot tubmurder of a childslaughterdisfigurementdark pastbarefoot femalebody countgay stereotypeasylumcharacters killed one by onefifth partkilling spreepsychoticnewspaper clippingpsycho killermale objectificationserial murdervillain played by lead actorpsychopathic killertaking a showergiving birthbad guymental patientmadmanmysterious mantaking a photographreturning character killed offkillohioassumed identitytowerevil spirithomicidal maniacbroken windowslashingdomineering motherhospital roommasturbation referencelistening to a radionewspaper articlehit by a trucklollipopdripping bloodlocked doorbreaking a windowcarnagejockdeath of boyfriendcrying femaleeating disordertraffic accidentfacial scarjumping into watermysterious womanshape shifterclawreference to shakespeare's romeo and julietcut into piecesswimmerbloody violencesadistic psychopathpsychotronic filmwet clothescut handmurder spreefetusghoulbroken bottledeath of lovergrindhouse filmplant in titlebody partscreaming womanhigh school graduationdrinking from a bottleglovearm ripped offhysterical womanbad dreammental asylumfemale in a showersecretly observingposing for a photographbossy womanhand injurypretending to be someone elsesuperhero costumepsycho terrorhand kissingfalling asleeploss of lovermidwestultrasoundchild killerhysterical outburstbaby carriagechild murdererhand through chestbreaking a car windowcarrying someonelifting a female into the airplace in titleloss of boyfriendscarred facedemonicmidnight moviestreet in titleboiler roomsadisticsequel to cult filmboogeymandrive in classichorror iconfantasy sceneoff screen rapeserial child killerdrinking winediving boardnursery rhymeindoor swimming poolpart time jobprivate investigationfainting manforce feedinglifting a male into the aircomic book artgruesomehand bandageseeing dead peoplefeeding someonemysterious eventdream within a dreambody partspost coital sceneshape shiftingairplane ticketmutilated bodycharacter appears in newspaperjumping into a swimming pooldrinking champagnehole in the wallnightmare becomes realitybaby strollerdepressed womangraduation partyriding a motorbikechoked to deathpsycho filmkilled in a car accidentriding a motorcyclechild born of rapeserial teen killersleeping shirtlessbrutalcamera shot from inside human bodyfusiongroup hugviolent mankissing someone's handbossy mothervictim invited to dinnertv show within a filmdream sequence within a dream sequencefainting womanmurder disguised as accidentserial child murderelm streetopen endingslashed to deathspringwood ohioreformed alcoholicactor reprises previous rolecrying for helpdrawing comes to lifefamily relationshippushy motherbreaking a bottlechild ghostserial child murdererhole in the floormale antagonistmother issuesbroken car windowfather issuesbroken dollconflict between friendssitting on the floordeformed babyspitting out a drinkwaking up someonecrashed carlifting a boy into the airpossessed boydrinking coffeelying on the floorcutting oneselfoperation roomrunning latesleeping fully clothedteam workcreepy childforced to eatgag reflexpicture comes to lifepushy father (See All)

The Dead Zone (1983) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Dead Zone (1983)

Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...

Subgenre:
independent filmcult filmsuspensesupernaturaltragedyparanormalpsycho thrillerparanormal phenomenaamerican horrorcanadian horror
Themes:
supernatural powermurderdeathlovesurrealismsuiciderapechristmasfearinvestigationdeceptionpsychopathdeath of motherparanoiablackmail β€¦death of wifepanicapocalypsedisabilitymadnessmurder investigationunlikely heronuclear holocaust (See All)
Mood:
neo noirslasher
Locations:
hospitalschoolchurchsnowwheelchairpolice cartrucktunnelschool teacherfire truck
Characters:
boyfriend girlfriend relationshiphusband wife relationshipfather son relationshipmother son relationshipdoctorteacherpolice officerserial killernursephotographerbabylittle boyvillainpsychiatrist β€¦snipersheriffgermanex boyfriend ex girlfriend relationshipsniper rifleself mutilationserial murderer (See All)
Period:
world war two1980s1970swinterseeing the future
Story:
comapremarital sexcar crashcar accidentdreamsurprise endingfemale nuditybased on novelbloodflashbackkissphotographtitle spoken by characterexplosionchase β€¦pistolfireshootoutcorpseshot to deathblood splattershot in the chestrescueslow motion scenewatching tvbattlegunfightfalling from heightletterrifleheld at gunpointhandcuffsrevolvertelephonef wordreportergood versus evilflashlightambulancemansionpoliticianstabbed in the chestman with glassesassassinationchild in perilunderwater scenepolice officer killednews reportmarriage proposaldrowningflash forwardattempted murderdangerprotestwidowerpay phoneproduct placementdeath of childrabbitchristmas treelightningshot in the shoulderscarbodyguardtragic eventisolationmurderercharacter says i love youloss of mothergenerallove interestcult directorsacrificepsychicnewspaper headlinecorrupt copbattlefieldchild murderheart attackhenchmanmaniaccold waricedestinydesireassassination attemptelectronic music scorereference to adolf hitlergothicheavy rainsociopathmutilationexploding buildingloss of wifepress conferencesevered handgrindhouseambitionpresumed deadrampagecrime scenevisionmercilessnessevacuationpsychotronicscissorssenatordeath of protagonistdark herodead childrainstormslaughterbody countsexual assaultmoral dilemmaarrogancemain character diesfirefightersouthern accentserial murderpsychopathic killerbad guyteachingswastikacrutcheshomicidal maniacroller coastermegalomaniacold flameslashingelection campaignbillboardpolitical campaigndeputykiss on the lipsreluctant heropremonitionhead injuryrallycorrupt politicianshot in the handpolitical candidatestar crossed loversbra removingpsychic poweroverturning cartitle same as booktragic endingpresidential candidatemainepsychotronic filmcar rolloverheadachehouse on fireassassination plotgrindhouse filmstabbed with scissorsnuclear threatcandidatechild killeddental bracesstabbed in the mouthpolitical assassinationsexual predatorpayphonescreaming in feartorture chamberextrasensory perceptionfrozen lakewalking stickchild killerworld war threecharacter appears on tvchild murderernew hampshiregazebodrive in classicbased on the works of stephen kingreference to edgar allan poeserial child killerpolitical rallyhuman shieldsubterfugesee through brachild's bedroomevil politicianneurologistwaking up from a comadental headgearparanormal phenomenonnuclear attackkissing in the rainpsychiatrist patient relationshipcharacter appears on magazine coverromantic kisscontemporary settingclothes ripped offkiller copstormy nightserial child murderstuffed toy rabbitserial child murderergirl in periltoy rabbitex fiance ex fiancee relationshipserial teen murderersecond sightaltering the futurepsychic detectivereading lessontruck car collisionaspiring politician (See All)

One Flew Over The Cuckoo's Nest (1975)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

One Flew Over The Cuckoo's Nest (1975)

McMurphy has a criminal past and has once again gotten himself into trouble and is sentenced by the court. To escape labor duties in prison, McMurphy pleads insanity and is sent to a ward for the mentally unstable. Once here, McMurphy both endures and stands witness to the abuse and degradation of t β€¦he oppressive Nurse Ratched, who gains superiority and power through the flaws of the other inmates. McMurphy and the other inmates band together to make a rebellious stance against the atrocious Nurse. (Read More)

Subgenre:
independent filmcult filmtragicomedy
Themes:
deathsuicidedrunkennessescapeangerpsychopathinsanitysexualitymental illnessdisabilityfreedomcheatingclaustrophobia
Locations:
swimming poolhelicoptersmall townbuswheelchairfishing boat
Characters:
doctornursereference to godnative americandoctor patient relationshipdeath of hero
Period:
1960s
Story:
girl stripped down to pantiesgirl in pantieswhite pantiespremarital sexpantiessurprise endingmale rear nudityfemale nuditybased on novelnumber in titlebloodmale nuditycigarette smokingdancingparty β€¦based on playpunctuation in titlewatching tvbrawlanimal in titleapostrophe in titletelevisioncleavagestrangulationbasketballwomanhuman rightssuicide attemptanti heroscantily clad femalefishingracial slurattempted murderchristmas treestrong female characterclaim in titlesociopathlifting someone into the airpatientblockbusterrebelblack humorcompassionschizophreniamental institutionmental hospitalmedicationdeath of protagonistconvictasylumirreverencemain character diessocial issuessuffocationbarbed wireoppressionmental patienthysteriapromiscuous womaneuthanasiafencemental retardationgroup therapypsychiatrychewing gumpsychoanalysiscrazinesspsychiatric hospitalevil womanoregonpersecutionbird in titlestutteringvotingsadistic psychopathschizophrenicepilepsylifting person in airmedical professionreference to the devilescaped mental patientsittingmarinadeaf muterestraintelectroshock therapypacific northwestlifting male in airvillainess played by lead actresslifting an adult into the airmotivationalauthoritylobotomyindividualityconfinementplaying cardfake illnessdefiancemedical treatmenttroublemakersmothered with a pillowambiguous titleyawningchrist figuremonopoly the board gamebad guy winsfighting the systemnurse patient relationshipelectroconvulsive therapypsychiatric nursesadistic crueltypsychiatric examinationwrongful commitmentyawnblackjack gameescape from a mental institutionpatient rightsinstitutional lifereference to hellreference to the world seriesstern nurse (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Talk To Her (2002)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Talk To Her (2002)

After a chance encounter at a theater, two men, Benigno and Marco, meet at a private clinic where Benigno works. Lydia, Marco's girlfriend and a bullfighter by profession, has been gored and is in a coma. It so happens that Benigno is looking after another woman in a coma, Alicia, a young ballet stu β€¦dent. The lives of the four characters will flow in all directions, past, present and future, dragging all of them towards an unsuspected destiny. (Read More)

Subgenre:
melodramasilent movie
Themes:
friendshipsuiciderapeprisonpregnancyfearweddingmemorylonelinesstheftobsessiontheatrepanicunlikely friendship
Mood:
rain
Locations:
swimming poolhospitalbarchurchhotelcemeterytaxirural settingapartmentspaincatholic church
Characters:
father daughter relationshipdoctorsingerteachernursestudentdancermusicianphotographerwriterpriestlawyeractresslittle girllust β€¦psychiatristpregnant from rape (See All)
Period:
2000s
Story:
white pantiessexual abusecomavoyeurcar crashpantiesfemale nuditysexnuditybloodmale nudityfemale frontal nudityflashbacknipples β€¦photographtitle spoken by charactersingingshowercryingcell phoneslow motion scenewatching tvcomputercameraswordarrestundressingbare buttlettertearsjailreporterswimminggay slurjournalistbraconcertambulancewomanfemale pubic hairsnakedream sequencescantily clad femalehit by a carritualbartendermicrophonecostumeuniformmassagebaseball batscreamtragic eventfilm within a filmstagecinemaballettraditionentertainmentnipples visible through clothingexerciseguitaristbuttocksmovie theatervisittimeaudiencebridetv showhaircutwatching televisionspanishrainstormsymbolismman cryingmale objectificationmenstruationnotebookimperative in titlemetaphorsubtitlesautographstage playnewspaper articleinfatuationballerinaactual animal killedbullgroomprison visitcapemadrid spaininmatetragic loveentertainerriteshrineiconsuicide notephobiacurtainwedding gowncustombullfightingbedriddenspectatorcrutchshrinkingloss of girlfriendcompact discmale nurseembroiderybullfighterphysical therapyconciergejordanwalking canematadorbullfightballet classcharacter appears in newspaperappointmentballet schoolballet teacherbullringdance showlobbycoming out of a comatorerocoma rapegoringnewspaper obituary (See All)

Open Your Eyes (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Open Your Eyes (1997)

A once handsome playboy, Cesar finds himself in a mental facility and he can't remember why. All he can remember is meeting the love of his life for one day, and then getting into a car accident which left his face horribly disfigured. But the pain of becoming physically undesirable may help him to  β€¦find the truth. (Read More)

Subgenre:
cyberpunk
Themes:
murderdeathlovefriendshipsurrealismsuicidejealousyprisondrinkingdrunkennessmonstermemoryangerdeath of fatherdeath of mother β€¦paranoiaabusewealthamnesia (See All)
Mood:
nightmare
Locations:
nightclubchurchrooftop
Characters:
boyfriend girlfriend relationshipfather son relationshippolicemother son relationshipfrienddoctorchildrenpolicemandancerlawyerlove triangleactressbest friendreference to godsecurity guard β€¦psychiatristsecretaryhispanicself pity (See All)
Story:
comacar crashmaskcar accidentdreamfemale nuditynuditybloodfemale frontal nudityinterviewflashbackgunsex scenekissdancing β€¦nipplesphotographthree word titleshowervoice over narrationbeatingwatching tvcomputercatdrinkkissingshootingvomitingrunningbirthdaysubjective cameratoiletaccidentdream sequencedrawingflash forwardparkcharacter's point of view camera shotactinghandgunsurgerysyringepsychologistvirtual realitywomanizerdrug overdoseremote controlpillssufferingresurrectionmental hospitalimmortalitymakeupinfectiondisfigurementprison cellsurgeonpajamasswearingsymbolismatheistcontractsuffocationcartoon on tvimperative in titleplastic surgerymen's bathroommetaphorcoca colainsane asylumaccidental shootingvanitydisfigured facetv interviewmimeanorexiaarm wrestlingfrenchmandreamingtalking while drivingfamous lineeyessurgical operationsubconsciousreference to walt disneyreligion versus sciencedeus ex machinalynchiantranquilizerdream worldvertigosmotheringcaterercautionary talesense of sightcryonicsvanishingdream sequence within a dream sequencepsychiatricreference to jules verneprosthesismental problemracket ballatheism versus christianityreference to the phantom of the operafrench giallolife extensionspanish giallocryogenic technologyrhinoplasty (See All)

The Devil's Advocate (1997) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Devil's Advocate (1997)

Kevin Lomax, a ruthless young Florida attorney that never lost a case, is recruited by the most powerful law firm in the world. In spite of his mother's disagreement, which compares New York City to Babylon, he accepts the offer and the money that comes along. But soon, his wife starts feeling homes β€¦ick as she witnesses devilish apparitions. However, Kevin is sinking in his new cases and pays less and less attention to his wife. His boss and mentor, John Milton, seems to always know how to overcome every problem and that just freaks Kevin right off. (Read More)

Subgenre:
cult filmallegory
Themes:
supernatural powermurderdeathsuicidemarriagerapereligionmoneyfearartincestseductionangercorruptionobsession β€¦guiltinsanitygriefmental illnessgreedpanicdevilmythologymurder of familythe devil (See All)
Mood:
goresatirebreaking the fourth wallambiguous ending
Locations:
nightclubhospitalnew york citybarchurchsnowelevatorwheelchairapartmentcitycourtroomusaslum
Characters:
husband wife relationshipfather son relationshippolicemother son relationshipafrican americansingerteenage girlteachernursestudentdancerphotographerbabypriestlawyer β€¦christianjewishreference to godsingle motherchristianitylustteacher student relationshipbiblecatholicchinesehomeless man (See All)
Period:
1990swinter
Story:
white pantiescamel toevoyeurhallucinationcar accidentdreampantiessurprise endingfemale nuditybare breastsbased on novelbloodmale nudityfemale frontal nudity β€¦doggunsex scenefemale rear nudityfemale full frontal nuditycigarette smokingdancingphotographsingingpartyknifethree word titlepistolcryingbeatingmirrorshot in the headslow motion scenewatching tvcomputerarrestsex in bedbare buttpaintingbookheld at gunpointtearsrunningbathroomdemonmanhattan new york cityalcoholreporternewspaperbracandlevideo camerathroat slittingboxingfemale pubic hairsubwayjudgetrialscantily clad femaleanimalhit by a cartongueritualbartendergunshotpublic nudityblack pantiesmicrophonebeaten to deathbusinessmanringfemale removes her clotheswitnessnewspaper headlinepoweritalianoccultundergroundfireplacewoundstreetlawjoggingrageloss of wifecrying womanfloridalosstimeaudiencerape victimcrying mangoathomiciderealityambitionmoralitysexual desireremote controlattorneytoe suckingintriguespanishgunshot woundreference to satantime lapse photographysenatorpedophilepanties pulled downprideevidencebalconypassionate kissvoodooblack magicmarital problemmusic bandsindead dogpervertvillain played by lead actorethicstestimonymental breakdownmetaphorstreet markettemptationbrooklyn bridgekoreansouthern u.s.abandonmentsatanismjurylawsuitarenaglassquarrelbusiness cardboxing matchpressmuggingmurder suspectdocumentvanityacoustic guitargropingboxing ringchild molesterritesex with a minordoormantycoonantichristdeal with the devilholy waterblasphemysinistersex on the floorchurch servicepanic attackstreet vendorsubcultureglobebloody body of a childcourthousecity parkmuraltroubled marriageflamencolucifermetropolisoathspectatorlaw firmsatanalibigalaperjuryjudicial systemholy biblesex offendersatanistmorphingmuggerjudicialjudiciarywashroomit was all a dreamtouching someone's breastsimplied incestcasedemon rapefurybrother sister sexvirtualitychinatown manhattan new york citychequeseven deadly sinsprime suspectcoachingeliteelitismnotepadshredderkosherjury trialmale cryingdecoratingrecesscommitting suicidejinnpersonification of satanjustice departmentovarybilocationdagainesville floridalegal trialglandmuderwoman squeezing another woman's breast (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

An American Werewolf In London (1981)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

An American Werewolf In London (1981)

Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar β€¦es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)

Subgenre:
cult filmblack comedysuspensesupernaturaltragedypunkfish out of watercreature featuremonster movie
Themes:
supernatural powermurderdeathfriendshiprevengesurrealismfearescapemonstervoyeurismtheftbrutalityparanoiapanichomelessness β€¦murder of a police officermurder of family (See All)
Mood:
goresatirenightmaremurder of a boy
Locations:
hospitaltrainforestcemeterybuslondon englandtaxivillagewoodsrural settingapartmentpolice carenglandtrucktaxi driver β€¦laboratorysex in shower (See All)
Characters:
policedoctorzombiepolice officernursejewishlittle boyterroramericanamerican abroadtruck driverhomeless mantalking to oneself in a mirrorpolice sergeant β€¦jewish americanamerican in the ukmythical creatureamerican in englandamerican in europeamerican in great britainmurder of a girl (See All)
Period:
1980s
Story:
comaundeadpremarital sexvoyeurcollegecar crashcar accidentdreamtopless female nuditysurprise endingmale rear nudityfemale nuditybare breastssexnudity β€¦bloodmale nudityviolencefemale frontal nuditymale frontal nuditydogbare chested malesex scenefemale rear nuditycigarette smokingknifechaseshowercorpseshot to deathblood splattermachine gunshot in the chesturinationblondeslow motion scenewatching tvcatwritten by directorsex in bedbare buttrifleplace name in titleanimal in titlebedtelephonef wordsubjective cameradecapitationcleavagegay slurambulancedeath of friendmontagethroat slittingsuicide attemptsubwayjokesevered headdream sequencescantily clad femalehit by a carvannews reporttransformationfive word titleracial slurpublic nuditylegendcursedangerfantasy sequencepay phoneumbrellacharacter's point of view camera shotproduct placementrace against timestatuecover upknocked outcollege studentlightningactor shares first name with charactercity name in titlelong takescarhairy chesttragic eventfilm within a filmsuspicioncharacter says i love youfirst partthreatened with a knifeprofanitylove interestpubnewspaper headlinemonkeychesswerewolfuziundergroundsupermarketwolfno pantiesballoongothicheavy rainlooking at oneself in a mirrorred dressmutilationloss of friendelephantbuttockscaucasianswat teamphone boothsevered handcovered in bloodsheepcoitushitchhikeranimal attackhitchhikingrealityindianeaten alivefull moonrampagebarefootattempted suicidemercilessnessgash in the facezooevacuationpsychotronicmedicationassault riflerainstormdeertigerbody landing on a carpassionate kissdead boyethnic slurpolice inspectorkilling spreesirencopulationclose up of eyesdead girlmemory lossbriberyliving deaddirector cameoalleyapparitionjunkyardhomagesubway stationnudephysicianjukeboxnurse uniformbus stopdenialjacketnude girltavernkiss on the lipsambassadormetamorphosisoffscreen killingcrashing through a windowbitten in the necknurse outfitclawhomeless persontragic endingmagnifying glassfemale bartenderreference to john waynepentagramdeath by gunshotmetromurder spreeanimal killingdeath of loverglowing eyesgiraffeinnocent person killedhead ripped off555 phone numberbitebloody body of a childloss of memoryhuman becoming an animalnurse hatwoman in showerdecomposing bodyreference to winston churchillthick accenttelling a jokefemale nursethrown through a windshielddartsedativetalking to the deadshared showerbackpackingscotland yardends with deathbackpackercontemplating suicidelycanthropyseclusionlondon undergroundlorrydoomed lovedream within a dreamenglish countrysidereference to queen elizabeth iiscottish highlandswaking up from a comatower bridge londontwo friendsquestioned by policereanimated corpseporno theaterhowlreference to prince charlesalmost hit by a carpiccadilly circus londoncar crashing through a windowmoorsnightmare sequencecontemporary settingmonster as victimmoor the landscapedream sequence within a dream sequencelycanthropetunnel chase scenewatching a porno moviedartboardhospital patientwerewolf transformationwerewolf bitetongue in cheek humortrafalgar square londonyorkshire englandchannel surfingknock knock jokechild killed by animallondon busreference to bela lugosihackney carriagereference to the queen of englandcar pileupmonster in mirrorred jacketshooting a childreference to the alamochest ripped openporn theaterreference to claude rains (See All)

My Bloody Valentine (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

My Bloody Valentine (2009)

In the mining town of Harmony, a drilling accident is caused by the son of the owner, Tom Hanniger. The mine collapses, burying six miners alive. The rescue team finds only Harry Warden alive, but in coma, and the other miners murdered by his pickax, and they conclude that Harry killed them to save  β€¦oxygen for himself. On Valentine's Day, Harry awakes from his coma in the local hospital, and he kills twenty-two people, including a group of teenagers that are partying in the mine. Harry is killed by the deputy, but the only survivors are Tom Hanniger, his girlfriend Sarah, their friend Axel Palmer and his girlfriend Irene. Ten years later, Tom returns to Harmony after the death of his father. Tom has decided to sell the Hanniger Mine, and finds that Sarah has married Axel, who is now the local sheriff, and they have a son named Noah. On Valentine's Day, Harry Warden also returns, seeking revenge against those that had escaped his pickax in the past, and Tom is accused by Axel and other locals, who in turn makes accusations against Axel. (Read More)

Subgenre:
slasher flickholiday horror
Themes:
infidelitymurderdeathpregnancydrunkennesspsychopathbrutality
Mood:
goreslasherhorror movie remake
Locations:
hospitalbarsmall townpolice carmoteltunnel
Characters:
boyfriend girlfriend relationshiphusband wife relationshippoliceserial killerlittle boymaidex boyfriend ex girlfriend relationshiptruck drivermysterious villain
Story:
camel toecomapremarital sexhallucinationcar crashtopless female nuditysurprise endingmale rear nuditynumber in titlebloodviolencefemale frontal nudityflashbackbare chested malesex scene β€¦female rear nuditycigarette smokingexplosionthree word titlepistolpunctuation in titlewoman on topcorpsedigit in titleblood splatterfistfightremakeshotgunslow motion scenepunched in the facesecretfalling from heightheld at gunpointshot in the backf worddecapitationfoot chaseflashlightmassacrevideo camerabridgeimpalementstabbed to deathstabbed in the chestchild in perilflash forwardgravelocker roomfantasy sequenceamerican flagsuspicionnewspaper headlinemaniacidentityundergroundrevelationshot in the stomachstabbed in the stomachcheating husbandbar fightgas maskgrocery storesevered fingerfight to the death3 dimensionalstabbed in the neckstabbed in the headbilliardshearteye gougingslaughterstabbed in the eyenude woman murderedpsycho killertorso cut in halfmental patientpolice chiefabandoned houseloud sexwhodunitdouble barreled shotgunvigilante justicehand over mouthactress shares first name with charactercabin in the woodscarnageburnt bodyminervalentine's dayhit with a shovelhiding under a bedheart ripped outschizophrenicbreaking through a doormass murdererbreaking a mirrorstabbed in the mouthwriting in bloodcut armpick axecoal minesmall town sheriffstore clerkdual identitystabbed in the heartmine shafthead cut in halfmining townnude with a gunvalentinestabbed through the cheststabbed through the chinhole in chestatonal music scorejaw ripped offpugtelevision interviewtotem poleclothes dryerheart shaped box of candyimpaled through eyeshovel through headmine ownerhelmet light (See All)

The Body (2012)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Body (2012)

In the middle of the night, a guard working the night shift at the morgue located deep in the woods has a terrible car accident, and as a result, he is now in a coma, suffering multiple skull injuries and fractures. But what made the guard panic and leave his post in the first place? Furthermore, ac β€¦cording to the register, the body of Mayka Villaverde, a beautiful well-off businesswoman, is mysteriously missing from the morgue. Presumably, Mayka died of a heart attack, nevertheless, who signed the death certificate with the autopsy pending? In the end, when in forensic medicine the principle of: "every death is a homicide until proven otherwise" is a basic general rule, finding out who is behind this case shrouded in mystery is going to be an arduous task. (Read More)

Subgenre:
family tragedy
Themes:
infidelitymurderdeathloverevengeadulteryprisonweddinginvestigationdeceptionextramarital affairtraumavengeancepolice brutalitypolice investigation β€¦getting away with murder (See All)
Mood:
rain
Locations:
hospitalrestaurantforestmotorcycleairportelevatorwoodspolice carstormtunnelrunning through the woodssex in elevatorchurch wedding
Characters:
boyfriend girlfriend relationshipfamily relationshipshusband wife relationshippolicefather daughter relationshipdoctorbrother sister relationshipgirlstudentdetectivepolicemanpriestlawyersister sister relationshiplittle girl β€¦waitresssecurity guardpolice detectiveprofessorolder man younger woman relationshipcolleague colleague relationshiprunning from the police (See All)
Story:
comahallucinationcar crashcar accidentdreamtopless female nuditysurprise endingfemale nuditybare breastsflashbackbare chested malesex scenecigarette smokingphotograph β€¦chasetelephone callcryingcell phonepunched in the facelettershootingvomitingdead bodyinterrogationsex standing uphandcuffsscientistfoot chaseflashlightwineold mantoiletaccidentapologyhit by a carfemme fatalegunshotlibrarystalkerkeywidowerpoisonmissing personscreamringuniversitymanipulationdisappearanceinjectionstalkinggiftwitnessreunionsuspicionvigilanteredheadheart attackprivate detectiveidentitylooking at oneself in a mirrorlistening to musictape recordersecurity cameramorgueloss of wifecrying womanwristwatchbarefoot malebridecheating husbandcrying manfalse identitybikerguardmillionairebusinesswomanplot twistescape attemptevidenceaccidental killingwedding ringsuspectbarefoot femalepolice inspectordrugged drinkunfaithful husbandtext messagingmale objectificationunhappy marriagewedding ceremonyrepeated scenefake identityhospital roomfemale lawyertaking a bathvigilante justicepolice interrogationbody baguniversity studentmurder suspectcrying femaletraffic accidentfemale police officerawkward situationmanipulative behaviorhitchcockiansmall breastsfully clothed sexwatching a videotext messagewet clothesflashback within a flashbackprivate eyefinding a dead bodyframed photographcrying malehidden gundiscovering a dead bodyfire alarmlearning the truthsecretly observinguniversity professorpretending to be someone elsepsychological manipulationfemale objectificationlocked inmissing womanadulterous husbandaudio recordingmanipulative manwoman in a bathtubrich womanscreaming mandrinking winewedding daywatching someone sleepprivate investigationfemale stalkerpost coital scenerepeated scene from a different perspectivefemale vigilanteoverweight mansecret relationshipheavy smokerwedding videowine glassfalse evidenceriding a motorbikedomineering wifekilled in a car accidentriding a motorcyclestuck in an elevatorsleeping shirtlesspolice investigatorpretending to sleepdragging someonealmost hit by a carkissing someone's handunreliable flashbackfilthy toiletcompromising photographchemistry classfrontier justicedestroying evidenceflushing a toilettoilet flushchased by policevomiting in a toiletmissing bodytraumatic memoryclosed doorwealthy womanhandcuffed mansitting on the floorsleeping in underwearvomiting in toiletwrapped in a blanketwriting on a blackboardunpunished crimewashing one's facedrinking coffeedetective as protagonistscene repeated from alternative perspectivebroken toiletcomatose patienteating paperpoliceman as protagonistpouring rainrunning latesleeping fully clothedteam workchemistry studentcompany ownergag reflexmurderer as protagonistscene told from more than one perspective (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

A Clockwork Orange (1971) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

A Clockwork Orange (1971)

Protagonist Alex DeLarge is an "ultraviolent" youth in futuristic Britain. As with all luck, his eventually runs out and he's arrested and convicted of murder and rape. While in prison, Alex learns of an experimental program in which convicts are programmed to detest violence. If he goes through the β€¦ program, his sentence will be reduced and he will be back on the streets sooner than expected. But Alex's ordeals are far from over once he hits the mean streets of Britain that he had a hand in creating. (Read More)

Subgenre:
cult filmcoming of ageblack comedydystopiapolitical satire
Themes:
murderfriendshiprevengesurrealismsuicidedrugsrapebetrayalpoliticsprisontorturedrunkennessdeceptionrobberypsychopath β€¦brutalityredemptioninsanitysexualityillnessmental illnesssadismhome invasiondeath of wifehomelessnesswritingpolice brutalitynear death experience (See All)
Mood:
satireneo noiravant gardeambiguous ending
Locations:
nightclubhospitalbarrestaurantchurchsnowmotorcyclebathtublondon englandwheelchairapartmentpolice stationwater torturesex in the snow
Characters:
family relationshipshusband wife relationshipfather son relationshippolicemother son relationshipteenagerdoctorpolice officernurseactorwriterpriestlustpsychiatrist β€¦biblehomeless manpolice sergeantsex with a nurse (See All)
Period:
world war two1990sfuturenear future
Story:
white pantiesalternate realitycomapremarital sexvoyeurcar crashmaskcar accidentdreamsurprise endingmale rear nudityfemale nuditybased on novelbloodmale nudity β€¦violencethreesomeinterviewmale frontal nuditymasturbationbare chested malefemale rear nudityfightfemale full frontal nudityphotographsingingknifeleg spreadingthree word titlevoice over narrationfondlingbeatingfistfightslow motion scenepunched in the facecatarrestundressingbrawlsex in bedbare buttfalling from heightrifleinterrogationhandcuffsbritishreference to jesus christmale pubic haircolor in titlecriminalreportersubjective cameracleavagejournalistbound and gaggedwinegangdisguisemansionmontagethroat slittingbridgesuicide attemptprisonerpoliticianfemale pubic hairtied to a chairsnakeno opening creditsanti heroscantily clad femaledouble crosscontroversypublic nuditylibraryauthorblack pantiesbeaten to deathstabbed in the backlocker roomwidowerattackfantasy sequencecharacter's point of view camera shotstatueevil manknocked outkicked in the facebaseball batlightningscreamattempted rapepranklong takemanipulationconvertiblebodyguardinjectionfemale removes her clothesneck breakingthreatened with a knifecult directortypewriternewspaper headlinesexual fantasyexperimentelectronic music scorereference to adolf hitlerhypodermic needleheavy raintape recordersociopathred dressloss of loved onesex on floorkicked in the stomachmovie theaterblockbustereccentricwristwatchclassical musicclubirishrape victimmind controlrapistmilkstreet lifesocial commentarythugyogawoman in jeopardyreverse footageprison guardstealing a carministerhatredpool tabletitle appears in writingsculptureblack and white scenetime lapse photographypunched in the chestrivalbilliardsgang rapeaccidental killingfascismrainstormhomoeroticismfemale doctorcanesocial workerpublic humiliationgrowing uprelease from prisonsexual assaultjuvenile delinquentalienationpolice inspectorsports carmoral dilemmairreverencefast motion scenedrugged drinkhit with a baseball batclose up of eyespervertchocolatevillain played by lead actorface maskcrucifixionbrainwashingforced to stripspit in the facemisogynisteyebeggarmini dressreference to the beatlesgovernorweightliftinganarchynihilismstrait jacketcrashing through a windowimmaturityvolunteerrehabilitationaudio cassettebritainwhite briefsfight the systemanarchistexperiment gone wrongfamous scorewet t shirtfisticuffsancient romecureharempsychological torturegang membercockney accentimprovised weapongang leaderspaghettimurder of a nude womanprison wardenfamous linejerkbreaking a bottle over someone's headclimbing out a windowsocial decayattempted robberycrime spreerecord storefemale journalistred wineslow motion action scenereference to ludwig van beethovenlibertymarinacult figureflirtationfamily abandonmenthuman experimentationman fights a womandebaucheryvicarspiked drinkconcert hallsex crimedehumanizationabsurd violenceanti socialpopsiclesubliminal messagebreakfast in bedhoodlumslangreference to draculafemale psychiatristpixelationgrand theft autobeethovenmultiple loverspsychological tormentphalluscountry homebowler hatlasciviousnessfilm with ambiguous titlegovernment officialenglish countrysideinvented languagered pubic hairwaking up from a comapolitical manipulationhanged childextreme filmflick knifereference to pink floydchild executioneye dropsyouth ganglong underwearclothes torn offshock therapywilliam tell overturecenturionjoyridegraphic nuditypet snakecat ladymanservantdriving in the wrong directionforced to watch rapeholding someone's head underwaterludwig van beethovenmilk bottleunprovoked violencehidden weaponsexual imagerynose bandagecensored rape scenetesticles squeezedwife raped in front of husbandclothes cut offerotic 70struncheonultraviolenceaversion therapybottle smashed over someone's headgang brawltorn pantieslistening to classical musicmoral reformationobjectified womanmen beating defenseless manreformed (See All)

The Amityville Horror (1979)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Amityville Horror (1979)

Based on a true story that was claimed by writer Jay Anson, The Amityville Horror is about a large house on the coast of Long Island where newlyweds George and Kathy Lutz and their three children move into the house that they hope will be their dream house which ends up in terror. Despite full discl β€¦osure by the real estate agent of the house's history, George and Kathy buy the house. George says, "Houses don't have memories," but they turn to their family priest Father Delaney who believes the house is haunted and performs an exorcism on the house. But the evil spirit in the house causes him to become blind and makes him very sick. With the help of another priest Father Bolen and a police detective, George and Kathy face the fears of the house, but not knowing the spirit is planning to possess George and then the children... (Read More)

Subgenre:
independent filmcult filmparanormal phenomenasupernatural horror
Themes:
supernatural powerghostmurderlovemarriagefearweddingtheftparanoiasurveillanceevilpanicpolice investigationmurder of family
Mood:
nightmare
Locations:
barchurchmotorcyclecatholic church
Characters:
husband wife relationshippriestterrorcatholic priest
Period:
1970s
Story:
girl stripped down to pantieswhite pantiescamel toedreampantiesfemale nuditysexbloodflashbackdogthree word titlebased on bookshotgunvomitingbeer β€¦place name in titledemonriverbedroomaxeambulancetoiletnunvanparktreelibrarycurseattacklightningscreamcrosshauntingfirst parthaunted housechild murderoccultfireplacegothicbabysitterlifting someone into the airagingcrucifixbeardblockbustergrindhousemale underwearreincarnationstairsthunderstormdemonic possessionbriefswedding receptionblindsuffocationreal estate agentclosetdead childrenstepfatherwellimaginary friendflynewspaper articletavernchandelierbumwhite briefswoman wearing only a man's shirtgurneyorchestral music scoremenacerealtortormentblack cathoaxglowing eyesrocking chairchopping wooddental bracesgun shotlight bulbrainy nightlong island new yorkfamily in dangerbased on supposedly true storyremadetrailer narrated by percy rodriguezbare midriffevil forcehorror movie remademicrofilmfly the insectboathousedental headgearvillage name in titlebreaking windowfliesstormy nightgoing crazyred roomfalling through a staircasefront doorsweatshirtknockingindian burial groundmissing moneyupside down crucifix (See All)

Final Destination 3 (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Final Destination 3 (2006)

When Wendy Christensen has a vision of an accident on the roller coaster, resulting in her and her friends' deaths, she instantly begins to panic and gets off the ride, causing a few of her friends to get off as well. The remaining friends, including Wendy's boyfriend, are stuck on the roller coaste β€¦r and find themselves involved in the accident. With death waiting around the corner, Wendy and Kevin Fischer must try and work out death's plan, before they and the remaining survivors end up dead. (Read More)

Themes:
supernatural powerdeathfuneralvoyeurismguiltsadismcheating death
Mood:
gorerain
Locations:
new york citytruck accident
Characters:
teenage girlbest friend
Story:
girl in pantiesvoyeurcar crashcar accidentdreampantiessurprise endingfemale nuditybloodviolencesequelfemale frontal nuditydancingphotograph β€¦explosionfireblood splatterhorseblondeshot in the headcomputercamerafalling from heightmanhattan new york citydecapitationcleavagevideo cameraambulanceimpalementsubwaysevered headscantily clad femalethird partperson on fireelectrocutionmini skirtscreamskeletonconvertiblegymtragic eventratobscene finger gesturefireworkspickup truckwolfburned aliveno pantiesheavy rainloss of friendfatecrushed to deathcannonfannippleamusement parkexploding headpanties pulled downshadowtrailercharacters killed one by onefortune tellerworld trade center manhattan new york citypigeontorso cut in halfgothgraduationhysteriacremationpink pantiesblue pantiesthong pantiesroller coasterpremonitionferris wheelkitelocked doorcrushed headcoincidencewarningjockdeath of boyfriendburnt bodyclueacoustic guitartheme parkscaregoth girlscytheimmolationextremetarot cardforkliftsignno survivorsnail gundigital camerabodily dismembermentgrave side ceremonydead teenagerhelium balloonloss of boyfriendfreak accidentsparklerlifting weightstrain crashwind chimehand cameratanning beddrive thrucannonballfootball practicehorseshoealternate endingvision of the futuredizzinesstrain derailmentflipping a cointanning salondesk bellsparksnarrow escapeforgeslurpingpopping balloonsoccer practiceapprehensionforeshadowgust of windhonking a hornrunaway vehiclevisible thong straps (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Carlito's Way (1993)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Carlito's Way (1993)

A Puerto Rican ex-con pledges to stay away from his former drug dealing ways but finds himself being dragged back by his past connections and the naive machinations of his lawyer and best friend. Hoping to raise enough money to get away from New York, Carlito Brigante takes on the job of running a n β€¦ightclub, renews an affair with a dancer but old associates and old instincts suck him back into a world of violence and mistrust. (Read More)

Themes:
murderdeathrevengedrugsbetrayalprisongangstervoyeurismpsychopathblackmailmafiaprison escape
Mood:
neo noir
Locations:
nightclubhospitalnew york citytrainboattaxielevatorwheelchaircourtroomstrip clubyachtsex in publicshootout in a hospital
Characters:
boyfriend girlfriend relationshippolicedancertough guyjewishlustdeath of herogo go dancer
Period:
1970s
Story:
girl in pantiespremarital sexvoyeurpantiessurprise endingfemale nuditycharacter name in titlebased on novelbloodmale nudityviolencefemale frontal nudityflashbackkissfemale full frontal nudity β€¦interracial sexdancingpartyleg spreadingchasepistolvoice over narrationfondlingshootoutbeatingshot to deathblood splattershot in the chestblondeshot in the headgunfightbikinisex in bedmanhattan new york citystrippersubjective cameracleavagestabbingthroat slittingcocainestabbed in the chestsubwayman with glassesanti heroscantily clad femaleracial slurorganized crimechampagnecharacter's point of view camera shotbaseball batopening action scenelong takefemale removes her clothestragic eventex convictprofanitysilencerlove interestkissing while having sexcrime bossfalling down stairsdiscono pantiesnipples visible through clothingtape recordermobsterrailway stationinterracial romanceanti semitismshot in the faceblack and white scenedeath of protagonistsafeextortionethnic slurmain character diesexotic dancerescalatorinformantbillboardstretcherdistrict attorneyentrepreneurpool partyunplanned pregnancyparaplegicdeath of title characterinformerunwanted pregnancyjailbreakpuerto ricanmain character shotcocaine snortingsecret passagemob violencepool hallbludgeoningpole dancingmob hitvillain turns goodunwed pregnancylast standknife in the chestone last jobdutch anglenarration from the gravedance studiowearing a sound wiretopless dancinggrand central station manhattan new york citywiretapbuoycocaine addictsteadicamcrooked lawyerfriend turned foefirst person narrativerikers island new york cityeast riverspanish harlem manhattan new york cityhit on headpoolhall shootoutsex in restroom stall (See All)

Fright Night (1985) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Fright Night (1985)

For young Charley Brewster, nothing could be better than an old horror movie late at night. Two men move in next door, and for Charley with his horror movie experience, there can be no doubt that their strange behavior is explained by the fact that they are a vampire and his undead day guardian. The β€¦ only one who can help him hunt them down is a washed-up actor, Peter Vincent, who hosts Charley's favorite TV show, Fright Night. Vincent doesn't really believe that vampires exist, but does it for the money... (Read More)

Subgenre:
cult filmpost modernstop motion animationteen movieteen horrorhorror spooflgbt horrorvampire comedy
Themes:
supernatural powerdeathherovoyeurismseductionfaithpolice investigation
Mood:
gorespoofnight
Locations:
nightclubsmall town
Characters:
boyfriend girlfriend relationshippolicemother son relationshipteenagerteenage boyserial killerdetectivepolicemanactorvampiresingle mothervillaingirlfriendparent child relationshipneighbor neighbor relationship
Period:
1980s
Story:
undeadvoyeurtopless female nuditysurprise endingmale rear nudityfemale nuditynuditybloodmale nudityviolencetwo word titlebare chested maleguntitle spoken by character β€¦chasepistolshot to deathmirrorshot in the chestpunched in the facewatching tvwritten by directorundressingfalling from heightpaintingheld at gunpointneighborgood versus eviltoplessimpalementstabbed in the chesthousesevered headcoffinnews reporttransformationshot in the foreheadbinocularsvirginsuburbskeletonscarhigh school studentstalkingcrossexploding bodywitnessbasementcharacter says i love youfirst partwerewolffalling down stairswolfburned alivelifting someone into the aircrucifixhunterteenage protagonistwoman in jeopardyreverse footagehypnosisjumping through a windowfriendship between boysdead boylevitationstabbed in the handhorror hostmale friendshipcamera shot of bare feetbroken mirrorkiss on the lipsrhyme in titlebitten in the necksuper powerbra removingbloody violencevampirismhomosexual subtextvampire hunterpsychotronic filmblack copghoullifting person in airglowing eyesgrindhouse filmholy watervampire slayerjumping out a windowtv hostthroat rippingolder man young girl relationshiphand injurystakelifted by the throatnext door neighborgarlichowlingsunlightnew neighbortv starremadewashed up starstabbed in the heartshort haired femalevampire bitehorror movie remadered eyesthreatening telephone calldead body in a car trunkteenage sonpointing a gun on someonevampire batseductive manboyfriend girlfriend conflictreflection in a mirrorgrabbed by the throatstabbed with a pencilfanboyeviction noticeusa horror hosttv personalitymale vampireseductive dancereflection in mirrormelting manbat attackreference to bela lugositeenager in dangerhuman versus vampirestake through the heartno reflectionvampire driving a carthrown across a roomtruth taken as a liereference to christopher leenosy motherpunch catch (See All)

It Follows (2014)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

It Follows (2014)

For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends β€¦ must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)

Subgenre:
cult filmsupernaturalsupernatural horrorcult horror
Themes:
supernatural powerghostmurderdeathfriendshipfearinvestigationvoyeurismparanoiaevilpanicsupernatural beingsupernatural rape
Mood:
rainhigh schoolambiguous ending
Locations:
swimming poolhospitalbeachschoolforestcarboatbicyclewaterwheelchairpolice carlakesex in carsex in hospital
Characters:
teenagerfriendteenage girlprostituteteenage boyfemale protagonistsister sister relationshipneighbor neighbor relationshipsex with a strangersupernatural killer
Story:
white pantiesvoyeurcar crashtopless female nuditypantiesmale rear nuditybare breastssexbloodviolencefemale frontal nuditymale frontal nuditytwo word titlebare chested malesex scene β€¦kissfemale rear nudityphotographmale full frontal nuditychasepistolcorpseshot to deathblood splatterurinationshot in the headwatching tvwritten by directorbikinibooklow budget filmcafebathroomneighbordemonclassroommale pubic hairf wordsubjective camerafoot chasebedroomflashlightbanddeath of friendhousetied to a chairunderwater scenesearchshot in the legold womanpublic nuditycursedangersuburbelectrocutionknocked outcollege studentlightningstalkingautomobilethreatdatelove interestteenage sexcard gamegameelectronic music scorelooking at oneself in a mirrorsexual attractiongroup of friendsmovie theaterpooldesperationflatulenceswimsuitstrangervictimteenage protagonistpeeping tombroken leggirl with glassesvisiontarget practiceplaygroundthunderstormboyfriendswingtied feetlooking at self in mirrorbroken armliving roomneighborhoodchloroformbeing followedabandoned buildingsuffocationgirl in bra and pantiesinvisibilityporn magazineapparitionshot in the neckhead wounddetroit michiganreading aloudabandoned housebroken windowhospital bedswimming underwaterbreaking a windowhallwaycowgirl sex positionshot in the handfrightmenaceshape shiftertied up while barefoottalking about sexpsychotronic filmscaregrindhouse filmyoung adultoverhead shotsexual intercoursehit with a chairrunning for your lifefalse nameentityhead bandageloss of innocencetarget shootinggirl next doorsexually transmitted diseasemidnight movieporchnipple sliparm castindoor swimming poolwashing a carincest subtextconsequenceshape shiftingmotor boatsleep overmysterious personcollateral damagefootstepsguessing gamebare breastnear drowninghigh school yearbookneo 80schevrolet impalaopening creditstimelessnessdemonic presencesex horrordead woman on a beachdemonic entityelectric typewriterhorror movielounging on a beachtied to a wheelchair (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Accused (1988)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Accused (1988)

Sarah Tobias goes to her local bar and is gang-raped by three men. The district attorney on the case is Katheryn Murphy who wants to prove that although Sarah had taken drugs that night and was acting provocatively while in the bar, this is no reason for her to be so brutally attacked and the men re β€¦sponsible should be brought to justice. (Read More)

Subgenre:
courtroom drama
Themes:
friendshiprevengerapebetrayaldrinkingdrunkennessdanceinvestigationdeceptionvoyeurismangerredemptionguilthomophobiabreak up β€¦abortionjustice (See All)
Mood:
rain
Locations:
hospitalbarmotorcyclepolice carcourtroomtruck
Characters:
boyfriend girlfriend relationshippolicemother daughter relationshipfrienddoctortattoonursedetectivepolicemandancerlawyerbest friendwaitresslustterror β€¦truck driver (See All)
Period:
1980s
Story:
girl in pantieswhite pantiessexual abusevoyeurcollegecar accidentpantiesmale rear nudityfemale nuditysexmale nudityviolencefemale frontal nudityinterviewflashback β€¦two word titlekissfemale rear nudityfightfemale full frontal nuditycigarette smokingdancingphotographtitle spoken by characterleg spreadingshowerbased on true storytelephone callunderwearmirrorwatching tvcameradrinkarrestundressingbare buttlierock musicinterrogationcriminalreportersubjective cameracleavagegay slurbridgefemale pubic hairjudgetrialscantily clad femalenews reportbartenderpublic nuditysmokingscreamingliarmini skirtpay phonecollege studentcourtscarwitnessobscene finger gestureflirtingpickup truckmachismoapplausetv newslistening to musiclawvictimrape victimcrime scenewoman in jeopardyinnocenceconfrontationkickingpool tablesexismheadphonesmedical examinationpanties pulled downgang rapesocial workerlooking at self in mirrorsexual assaultinjusticefemale in showervideo tapemenstruationpromiscuous womandinner partytestimonyviolence against womenhead woundmisogynistsuit and tiejukeboxpolaroidjuryyoung womanfemale lawyerfraternitycigarettedistrict attorneywhite trashconscienceprosecutormassachusettsspittormentgynecologistastrologychantingrecord storeends with textcourthousecoercionbailpinball machinetv cameradebaucheryverdictgynecological examwoman smoking cigarettehospital gownrailroad crossingjudicial systemred carsex crimecourt casejudicialjudiciarymedical examinervenereal diseaselegal systemcar won't startsearch warrantlicense plateguilty verdictpolice lineuplasciviousnessi.v.scratchingwishing someone good luckfelonygraphic rapeplea bargaindancing alonecriminal trialcharacter says go to helldouchepants around anklesfemale district attorneyhittingtestifying in courtjury trialcutting own hairholding one's hand over someone's mouthmouthwashsolicitationramming a carfraternity brothervanity license platebystanderismcontraceptivegame roompublic prosecutordeputy district attorneyreckless endangermenttorn pantiesblaming the victimplaying pinball (See All)

New Nightmare (1994)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

New Nightmare (1994)

It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks β€¦ on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)

Subgenre:
independent filmcult filmsuspensefairy talepost modernpsychological thriller
Themes:
supernatural powermurderdeathsurrealismkidnappingfearescapefuneralmonsterfilmmakingdeceptiondeath of fatherbrutalityparanoiacourage β€¦near death experience (See All)
Mood:
gorenightmareslasher
Locations:
swimming poolhospitalcarcemeterylos angeles californiawaterwheelchairtrucksinging in a cartruck accident
Characters:
husband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipboypolice officerserial killernurseactorpriesthostageactresssecurity guarddirectormaid β€¦film directorself referentialcoroner (See All)
Period:
1990s
Story:
alternate realityhallucinationcar crashcar accidentdreamsurprise endingbloodviolencesequelinterviewexplosionknifechasefirecell phone β€¦corpseblood splatterblonderescueslow motion scenefalling from heightpaintingvomitingshowdownsunglassesrunningbeddemontelevisiontelephonegood versus evilfoot chaseambushcaliforniastrangulationmansionstabbingdeath of friendwidowstabbed to deathstabbed in the chestsnakebrunetteno opening creditsdream sequencechild in perilhit by a cartonguenews reporttransformationcoffeeparkattempted murderlimousinestalkercharacter repeating someone else's dialoguescreamingperson on firecharacter's point of view camera shotactor playing multiple rolesrace against timeknocked outactor shares first name with characterscarinjectionstalkingfilm within a filmexploding bodydeath of husbandneck breakingactor playing himselfanswering machineburned aliveelectronic music scorewoundhypodermic needleslow motioninjurybabysitterlifting someone into the airmorguehollywood californianosebleedjumping from heightsalivatorchsocial commentaryearthquakewatching televisionreverse footagecameofloodbraveryplaygroundstabbed in the throatmovie setstabbed in the legfilm settitle at the endeye gougingdisfigurementstabbed in the eyefemale doctordemonic possessionfilm actorburned to deathpajamasnannymedia coverageyellingmovie actorspecial effectshiding in a closetstuffed animaljunkyardhuman monsterno title at beginningsleephearing voicesoffscreen killingtrailer parkpalm treepsychiatric hospitaltv studiofamous scorebadgerepeated lineclawscriptfade to blacklifting person in airsleepwalkingfreewayactress playing herselfstairwellsittinggloveseventh parttalk show hostsleeping pillscondominiumgrave side ceremonylifting male in airsevered tonguesedativelimousine driverknife woundtelevision studioserial child killerfurnacesleep deprivationcar phonedirected by co starlairlong tonguelorryvirtualitydream within a dreamshape shiftingprank callfreddy kruegersiren the alarmfilm executivefourth wallhansel and gretelcoffee makerinanimate object comes to lifemetafictiondreamscapeelm streetknife in the thighspringwood ohiopsychiatric nurseunplugged electronic worksgray hairfemale stuck in sticky substanceguttingmechanical handfatal injurysoft toy (See All)

Sorority Row (2009) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sorority Row (2009)

"Sorority Row" sees a group of sorority sisters try to cover up the death of their house-sister after a prank gone wrong, only to be stalked by a serial killer.

Subgenre:
black comedy
Themes:
murderdeathfriendshipbetrayaldrunkennessguilt
Mood:
goreslasherhorror movie remake
Locations:
kitchenfire truck
Characters:
boyfriend girlfriend relationshipfather son relationshipbrother sister relationshipserial killerinterracial relationshipalcoholicmysterious killerdeath of a friend
Story:
white pantiesvoyeurhallucinationcollegepantiessurprise endingmale rear nudityfemale nuditybloodviolencefemale frontal nuditybare chested malefemale rear nudityparty β€¦knifechaseshowerfirecell phonecorpseblood splattermirrorshot in the chestblonderemakeshotgunslow motion scenepunched in the facebare buttsecretvomitingheld at gunpointlingeriehandcuffsalcoholcleavageflashlightstrangulationaxeambulancedeath of friendthroat slittingimpalementstabbed in the chestaccidentscantily clad femalehit by a carpublic nudityblack pantiescharacter repeating someone else's dialogueperson on firemini skirtchampagnecover upcollege studentscreambraceletpranklong takestalkingbasementcharacter says i love youburned alivelooking at oneself in a mirrorsociopathfaintingscene during opening creditscatfightloss of friendtherapistnosebleeddead womanbroken legpump action shotgunwoman in jeopardystabbed in the throatironygash in the facestabbed in the neckstabbed in the headsenatorstabbed in the legaccidental killinghot tubraised middle fingercanered pantiescharacters killed one by onedead woman with eyes openmisogynyfemale in showerlyingfirefighterlaptop computervodkatext messagingintimidationgraduationfire extinguishermolotov cocktailhiding in a closetreference to facebookmisogynistwebcamdisposing of a dead bodyconstructionsororityjacketbubble bathwoman in bra and pantieswrist slittingreference to youtubeshot through the mouthfilmed killingcheating boyfriendbutt slapcamera phoneflare gunhouse on firemurder of a nude womandragging a bodycomeuppancefalling through the floortied to a treegpsdiscovering a dead bodystabbed in the mouthhooded figureaxe in the headcprdrink thrown into someone's facetire ironmine shafthandcuffed to a bedhit on the head with a fire extinguisherfoaming at the mouthwoman stabbedrotting corpsestabbed through the chinbeer kegprank gone wrongsorority housesorority girlcalling for helpcollege graduationwild partyreference to lindsay lohanrunning out of ammosoap bubblevaledictorianflare gun as weaponfalling down a shaftshot glassstabbed through the mouthfoamshot in the mouthbeer bongluncheonsorority partyfall through floorpleading for helpjust desserts (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Sex And LucΓ­a (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Sex And LucΓ­a (2001)

Lucia is a young waitress in a restaurant in the centre of Madrid. After the loss of her long-time boyfriend, a writer, she seeks refuge on a quiet, secluded Mediterranean island. There, bathed in an atmosphere of fresh air and dazzling sun, Lucia begins to discover the dark corners of her past rela β€¦tionship, as if they were forbidden passages of a novel which the author now, from afar, allows her to read. (Read More)

Themes:
infidelitydeathfriendshippregnancydrinkingdrunkennessvoyeurismdeath of fatherdepressionabortion
Locations:
nightclubhospitalbeachtrainboatsex in showermalta
Characters:
boyfriend girlfriend relationshipfather daughter relationshipmother daughter relationshipfriendsingergirlbabywriterwaitresslustgrandmother granddaughter relationshipmermaid
Story:
girl in pantiescomavoyeurcar accidentpantiesfemale nuditybare breastssexcharacter name in titlenuditymale nudityfemale frontal nudityflashback β€¦male frontal nuditymasturbationdogsex scenekissfemale rear nudityfemale full frontal nuditycigarette smokingnipplesphotographsingingleg spreadingerectionshowertelephone calllickingfondlingcryingsongwoman on topunderwearsex on couchfoodwatching tvcomputerdrinksex in bedsecrettearsrunningbirthday69 sex positionsex standing upislandmale pubic hairswimmingcleavagestabbingeatingsuicide attempttoiletfemale pubic hairscantily clad femaletongueunderwater scenelatex glovesskinny dippingpublic nuditystalkerblack pantiesstripteasemini skirtdeath of childfemale removes her clotheschildbirthblindfoldmoonbirthday cakediscono pantiesnipples visible through clothingbabysittercookchefflatulenceone night standanimal attackfull moonpillsporn starlove at first sightnovelistsunpanties pulled downcliffunsimulated sexcopulationmudwoman in bathtublighthousegiving birthpromiscuous womannovelfemale removes her dresspicturebroken windowporn actressforeplaywriter's blockunplanned pregnancyscuba divingcoincidenceillegitimate childmadrid spaincrabsitting on a toiletdeath of familyinternet chatdog attackmopednude photographadult filmmakingbedtime storydiscothequemoonshinesleeping pillsmediterraneanillegitimacymasturbating in a showerscuba divershrinktidesinkholewatching a porn videoguest housevalenciastrollerlighthouse keeperslit wristsalonenesspaellalunapotholefalling down a holediving gearremoving panties in a public placejumping in front of a car (See All)

Body Double (1984)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Body Double (1984)

Jake Scully comes home to find his girlfriend with another man and has to find a new place. In between his acting workshops and his job in a vampire B-movie, he scans the paper looking for anything. He happens to meet Sam Bouchard, a fellow actor who needs a house sitter. Both are pleased with the a β€¦rrangement that will have Jake staying in the house and for a sweetener, Sam shows him his favorite neighbor, a well-built woman who strips with her window open each night. Jake becomes obsessed with meeting her and is able to help recover her purse from a thief, but shows his own phobia, he is incapacitated by claustrophobia when the thief runs through a tunnel. When Jake witnesses a murder, he finds out that the police love to pin crimes on peeping Toms. Jake discovers that here are just too many coincidences but must hunt them down himself without the police. (Read More)

Subgenre:
suspenseslasher flickerotic thriller
Themes:
infidelitymurderdeathdrinkingfearfilmmakinginvestigationvoyeurismlonelinesstheftobsessionabusehollywoodpanic β€¦unemploymentclaustrophobia (See All)
Mood:
goreneo noirnightslasherone night
Locations:
nightclubbarbeachhotelcemeterylos angeles californiawaterelevatorapartmentpolice cartunnel
Characters:
boyfriend girlfriend relationshippolicetattoosingerpolice officerdetectiveactorthiefvampirebullywaitresslustfilmmakerfilm directoramerican β€¦girlfriendslasher killer (See All)
Period:
1980s
Story:
girl in pantieswhite pantiesvoyeurcar crashmaskpantiessurprise endingfemale nuditybare breastssexnuditybloodfemale frontal nudityinterview β€¦flashbackdogbare chested malesex scenefemale rear nuditycigarette smokingdancingnipplesphotographsingingleg spreadingchaseshowertelephone callfirefondlingcryingsongwoman on topbeatingunderwearfistfightmirrorblondeface slapwatching tvundressingfalling from heightsunglassesrunninglingeriebedinterrogationsex standing upneighborsubjective cameracleavagefoot chaseflashlightbrastrangulationdisguisehousesubwayscantily clad femalecoffincontroversysearchbartendergraveargumentstalkerbinocularskeyfired from the jobfantasy sequencecharacter's point of view camera shotauditionmistaken identitysuitcasestatuereadingdomestic violenceconvertiblepursuitfemale removes her clotheswiggiftwitnessstageactingbreaking and enteringjoggingcaught having sexmale bondingagentwatching a moviebuttocksimpersonationcoitushitchhikerpeeping tomembarrassmentindianmovie theatreburglartelescopepet dogporn starshopping mallmovie setshovellaughterpanties pulled downseasideperversionspyingdressing roomlanternpassionate kissnervous breakdownpuppysirencopulationposterplantbatbeing followedpervertface maskburied alivemenstruationset upvideo storefilm crewalarmporn industryescalatortombstonefilm in filmfish tanksecuritymaking outsweatexhibitionistporn actresspursetoastmovie studiofilm studioroad accidentbody bagmercedes benzmurder witnessgravestonehitchcockiandrillmotorcycle copmovie camerapsychotronic filmdog attackphobiavideo cassettecreepguard doggrave diggingbiterecord storejoggernightgownchanging roomfoot pursuitsexual intercoursephonograph recordstrobe lightsee through pantiescuckolded husbandpower drillweldinghot dog standfangscondominiumbody doublepurse snatchergiallo esquedog bitemeta filmwelderpunk rockerentertainment industrynylonscamera crewcheating on boyfriendrip offover the topacting musiciantattoo on buttacting classshallow gravewall safemementoclimbing a fencemysterious eventstruggling actorsound stageerotismgroceryreservoirhair brushacting lessonhouse sitteralcoholic relapsepipelinepatsysleazy giallogreen eyesprowlervalet parkingadult entertainment industryblack nylon stockingsclimbing fencedriller killerkey cardhollywood hillsoily hairthespianattackerdriving licensereference to fistingtitillationbestiality referenceparking valetreference to bestialitysearch for answers (See All)

The Girl With The Dragon Tattoo (2011)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Girl With The Dragon Tattoo (2011)

This English-language adaptation of the Swedish novel by Stieg Larsson follows a disgraced journalist, Mikael Blomkvist ('Daniel Craig (I)' (qv)), as he investigates the disappearance of a wealthy patriarch's niece from 40 years ago. He is aided by the pierced, tattooed, punk computer hacker named L β€¦isbeth Salander ('Rooney Mara' (qv)). As they work together in the investigation, Blomkvist and Salander uncover immense corruption beyond anything they have ever imagined. (Read More)

Subgenre:
punk
Themes:
infidelitymurderdeathrevengerapetortureinvestigationdeceptionblackmaildysfunctional familyvengeancemurder investigationfather daughter incestrape and revenge
Mood:
rain
Locations:
trainsnowmotorcyclelondon englandelevatorpolice stationlesbian bar
Characters:
father daughter relationshiptattooserial killerlawyerbiblesniperolder man younger woman relationshipuncle nephew relationshipuncle niece relationship
Period:
1960s
Story:
girl in pantieswhite pantiescar accidenttopless female nuditypantiessurprise endinglesbian kissbased on novelfemale frontal nudityflashbackbare chested malesex scenefemale rear nudity β€¦cigarette smokingphotographknifepistolwoman on topcorpseslow motion sceneundressingislandjournalistbound and gaggeddisguisebridgefemale pubic hairsubwayexploding carsevered headman with glassesforeign language adaptationnews reportcharacter repeating someone else's dialogueumbrelladisappearancethreatlaptopstrong female characterscandalfireplacekilling an animalrevelationgothictied to a bedfraudphone boothbrother sister incestrailway stationstrong female leadparadeaction heroineanti semitismresearchgash in the facebible quotelens flarefemale in showerage differenceleather jacketbisexual womansuffocationvideo surveillanceinvestigatorhackernotebooktaserbag over headbirthday presenthead woundgerman shepherdyoung version of characterlawsuitanal rapecottageloancomputer hackerteenage daughterpatricidegasolder man younger woman sexchild molesterdead catgoth girlstockholm swedenattempted robberyolder man younger womanmissing girlclothes rippinggpswoman punching a manolder man young girl relationshipmob of reporterssexual sadismsecret codetattoo parlorvideo recordingpierced nipplecocktail partycrime scene photographgooglebody piercingmagazine editorno cellphone signalyear 1966mohawkhit with a golf clubwiretapblonde wigyounger woman older man relationshipolder man younger girlyounger girl older manhung from a hookhiding in a car trunkforced blow jobsex with an older manstray catgraphic nuditygender in titlelibelfemale hackercorrupt lawyerstroke victimbackground checkward of the statenewspaper archivewikipediabisexual lead characterold moneypressed flower (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Ring (2002) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Ring (2002)

Rachel Keller is a journalist investigating a videotape that may have killed four teenagers (including her niece). There is an urban legend about this tape: the viewer will die seven days after watching it. If the legend is correct, Rachel will have to run against time to save her son's and her own  β€¦life. (Read More)

Subgenre:
paranormal phenomenasupernatural horror
Themes:
supernatural powerghostmurderdeathrevengesurrealismsuicidefearfuneralinvestigationvoyeurismphotographyadoptiondyingmysterious death
Mood:
rainnightmarehorror movie remake
Locations:
bathtubwaterelevatorwheelchaircity
Characters:
family relationshipshusband wife relationshipfather son relationshipmother son relationshipfather daughter relationshipmother daughter relationshipdoctorboyteenage girlteenage boyfemale protagonistteachergirlserial killerstudent β€¦writercousin cousin relationshipex boyfriend ex girlfriend relationshipgrandmother grandson relationshipaunt niece relationship (See All)
Story:
girl in pantiesvoyeurhallucinationdreampantiessurprise endingf ratedbased on novelbloodflashbackcigarette smokingphotographtitle spoken by charactershowertelephone call β€¦cell phonehorsemirrorblondeface slapremakewatching tvcomputercamerafalling from heightislandclassroomtelephonereportergood versus evilcleavagenewspaperjournalistaxewomanno opening creditsbirdscantily clad femaledrawingforeign language adaptationunderwater scenetreecurseblack pantieselectrocutionmini skirtrace against timeskeletonringfilm within a filmfirst partcabinpsychicanswering machinebreaking and enteringbabysitterbarnnosebleedvideotapeladderapartment buildingmental institutionsevered fingerpastmental hospitaldead childcliffbalconychairferryreckless drivingmiscarriageseattle washingtonplaying cardslighthousecartoon on tvhairdark secreturban legendwellno title at beginningfalling into watertape recordingflyassistantcoughingcabin in the woodsinfertilitystablekiller childpsychiatric hospitalpsychic powermaggotbechdel test passedinnwatching a videodeath by drowningelevator shafthookevil childinvestigative reporterpick axejumping off a cliffel trainfolk talesubliminal messagefire hosepsionic powerdeliberate crueltywallpapercentipedeabyssdeath of cousinhayloftfamily violencecalling parent by first nameremake of japanese filmremake of asian filmanimated scenefingernailtelevision staticrace against the clockunplugged electronic workshole in the floorpsychiatric treatmentdead teen couplepsychotic childseven dayswhitewashelectrocuted in a bathtubpeanut butter and jelly sandwichthrown down a wellbottomless pitjournalism studentdeformed armhorse breederfalling down a well (See All)

Synecdoche, New York (2008)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Synecdoche, New York (2008)

Theater director Caden Cotard is mounting a new play. Fresh off of a successful production of Death of a Salesman, he has traded in the suburban blue-hairs and regional theater of Schenectady for the cultured audiences and bright footlights of Broadway. Armed with a MacArthur grant and determined to β€¦ create a piece of brutal realism and honesty, something into which he can put his whole self, he gathers an ensemble cast into a warehouse in Manhattan's theater district. He directs them in a celebration of the mundane, instructing each to live out their constructed lives in a small mock-up of the city outside. As the city inside the warehouse grows, Caden's own life veers wildly off the tracks. The shadow of his ex-wife Adele, a celebrated painter who left him years ago for Germany's art scene, sneers at him from every corner. Somewhere in Berlin, his daughter Olive is growing up under the questionable guidance of Adele's friend, Maria. He's helplessly driving his marriage to actress Claire into the ground. Sammy Barnathan, the actor Caden has hired to play himself within the play, is a bit too perfect for the part, and is making it difficult for Caden to revive his relationship with the alluringly candid Hazel. Meanwhile, his therapist, Madeline Gravis, is better at plugging her best-seller than she is at counselling him. His second daughter, Ariel, is disabled. And a mysterious condition is systematically shutting down each of his autonomic functions, one by one. As the years … (Read More)

Subgenre:
independent filmcult filmblack comedydark comedypost apocalypseabsurdismallegorydark fantasy
Themes:
infidelitymurderdeathsurrealismsuicidebetrayaladulteryfuneralvoyeurismmemoryangerlonelinessdeath of fatherobsessiondepression β€¦cancerinsanitygriefsexualitytheatreapocalypsewritingforgivenessdeath of daughter (See All)
Mood:
avant gardebreaking the fourth wall
Locations:
nightclubswimming poolhospitalnew york citybarrestaurantcemetery
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipdoctortattoosingeractorartistactresstranssexuallittle girlmotherhomosexualitydirectorex boyfriend ex girlfriend relationship β€¦theatre director (See All)
Period:
future
Story:
girl in pantieswhite pantiesalternate realityvoyeurdreamtopless female nuditypantiesfemale nuditybare breastssexnuditybloodmale nudityviolencefemale frontal nudity β€¦female rear nuditysingingthree word titlefirepunctuation in titlecryingwoman on topurinationblondewatching tvsex in bedtearsbombplace name in titlebathroommanhattan new york citystripperf wordcleavagebramassacrewomantoiletmapnonlinear timelinechild abuseman with glassespainterscantily clad femalecoffinpainpublic nudityauthorblack pantiesfired from the jobfantasy sequenceauditiondiaryfemale removes her clothesstalkingsadnessratstagedirectorial debutreference to william shakespearetherapycheating wifeberlin germanyapplauseshavingdestructionmedicineno pantieswarehousered dressdiseasebuttockstherapistrehearsaltimecoituscheating husbandart gallerypicnicrealitygas maskremote controldentistattempted suicideold agechaostheatre audienceblack bramarital separationnoteexistentialismplayalienationcopulationsymbolismmusic bandlaptop computerreal estate agentconfusionmysterious manpedophiliadefecationmetaphorpubertyfemale removes her dressnudesubtitlesvacuum cleanerstage playnude girlnewspaper articlenihilismcreativityseizureplumberfully clothed sexinvitationschizophrenichouse firecity in titlepsychosisscrapbookreference to sigmund freudairlinerfemale sitting on a toiletabstract artstate in titlepinkmeta filmzeppelinexhibitlistening devicestrange personsetgerman culturelistening to the radiocrying during sexsurgical stitchessee through gowngritplay within a playfever dreammental torturemise en abymeplay directorminiaturesfade to whiterecursionbodily fluidssmoke inhalationdental care (See All)

What Lies Beneath (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

What Lies Beneath (2000)

Norman Spencer, a university research scientist, is growing more and more concerned about his wife, Claire, a retired concert cellist who a year ago was involved in a serious auto accident, and who has just sent off her daughter Caitlin (Norman's stepdaughter) to college. Now, Claire reports hearing β€¦ voices and witnessing eerie occurrences in and around their lakeside Vermont home, including seeing the face of a young woman reflected in water. An increasingly frightened Claire thinks the phenomena have something to do with the couple living next door, especially since the wife has disappeared without apparent explanation. At her husband's urging, Claire starts to see a therapist; she tells him she thinks the house is being haunted by a ghost. His advice? Try to make contact. Enlisting the help of her best friend, Jody, and a ouija board, Claire seeks to find out the truth of What Lies Beneath. (Read More)

Subgenre:
suspense
Themes:
supernatural powerghostinfidelitymurderdeathfriendshiprevengemarriageadulteryfearvoyeurismextramarital affairangerunfaithfulnesspanic
Mood:
rain
Locations:
swimming poolrestaurantsnowcemeteryboatbathtubrural settinglakelaboratoryyacht
Characters:
husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipfriendteenage girlteacherstudentmusicianteacher student relationshippsychiatristprofessorghost in a mirror
Period:
2000s
Story:
collegecar accidentsurprise endingbloodinterviewdogphotographpartythree word titleshowertelephone callcryingcell phonemirrorwatching tv β€¦computercatsecrettearsbathroomneighborwinecandlewomanbathunderwater sceneroommategraveyarddrowninggravebinocularskeyelectrocutionpossessionmissing personcollege studentdeath of husbandhauntingratsuspicionmurderergardenhaunted housetherapyrunawaypickup truckoccultteafireplacegothicmousehammertherapistblockbusterdrug overdoseresearchboston massachusettspet doganxietyspyingpieropening a doorphoto albumlaptop computervillain played by lead actordockseancefireballphysicianfencesailboatparamedicshoedruggedcelloouija boardgeneticshitchcockiansleeplessnesspet catpoltergeistcellistfootprintmissing girl911power failurevermonthair dryervisionswriting on a wallsteamcocktail partyouijasource musiclock of hairvaliumglass shardmurder by drowningalimonyprinceton universityempty neststepping on glasssound systemhair dryer falling into a bathtubreference to jonas salkreference to madame curie (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Coyote Ugly (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Coyote Ugly (2000)

Sexy, romantic comedy about a girl in her early 20s named Violet Sanford going to NYC to pursue a dream of becoming a songwriter. Violet gets a "day" job as a bar maid at a nightclub called Coyote Ugly. Coyote Ugly is the city's newest hot spot where the employees are a team of sexy, resourceful wom β€¦en that provoke the clientele and press with their mischief. (Read More)

Subgenre:
fish out of water
Themes:
friendshipdancewedding
Mood:
night
Locations:
nightclubnew york citybarkitchenwheelchairapartmentrooftop
Characters:
boyfriend girlfriend relationshipfather daughter relationshiptattoosingermusicianwaitressemployer employee relationshipsingle father
Period:
2000s
Story:
girl in pantieswhite pantiesdreampantiessexf ratedmale nuditybare chested maledancingsingingfirefistfightblondepunched in the faceundressing β€¦pianoguitarmanhattan new york citycleavagenewspaperwomandinersubwayscantily clad femalebartenderargumentblack pantiesstripteasefired from the jobmini skirtauditionproduct placementfemale removes her clothesloss of mothernewspaper headlinesexual attractionchefclubbossbar fightbroken legplayboy magazinenew jerseyburglaryobesityshoppingkaraokefat manwedding dresssongwriterred pantiesworld trade center manhattan new york citynew jobdrifterfemale removes her dressblue pantiescrutchesmini dressautographfriendship between womenbrooklyn bridgethong pantiesnaivetypartial female nuditymusic industrywet t shirtacoustic guitarbouncerfemale bartenderimplied sexrecord storemoving outbarmaidshort shortsapple computerfire breathingstripper polehot pantsgigstage frightfish marketpart time jobrecord labelrulessprayed with waterphone messageattitudetrying on clotheslift skirttollboothaustralian accentsmall town girlbiddingapple laptopdemofishmongerreading a porn magazineopen mike nightcomic book collectorpursue a dreamdate auction (See All)

Memento (2000) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Memento (2000)

Memento chronicles two separate stories of Leonard, an ex-insurance investigator who can no longer build new memories, as he attempts to find the murderer of his wife, which is the last thing he remembers. One story line moves forward in time while the other tells the story backwards revealing more  β€¦each time. (Read More)

Subgenre:
independent filmcult filmsuspensepsychological thriller
Themes:
murderrevengerapemoneyinvestigationdeceptionmemoryparanoiahome invasiondeath of wifevengeanceamnesia
Mood:
neo noiravant gardedarknessmurder suicide
Locations:
barwheelchairmotelcampfire
Characters:
husband wife relationshipdoctortattooprostitutetough guybibletattoo artistinsurance agentself deception
Period:
2000s
Story:
girl in pantieswhite pantiescar crashcar accidentpantiessurprise endingmale rear nudityviolenceone word titleflashbackbare chested malefightphotographchasepistol β€¦showerfirevoice over narrationbeatingcorpsefistfightshot in the headslow motion scenebrawlbare buttlingerierevolvertelephonef wordcleavagebound and gaggedambushcaliforniastrangulationdrug dealerdinernonlinear timelinefalse accusationanti herodisarming someonedouble crossfemme fatalebartenderflash forwardbeaten to deathwidowerbased on short storypay phoneundercovermistaken identityknocked outlong takemanipulationscarinjectionobscene finger gesturevigilantefreeze frameidentityelectronic music scorehypodermic needleheavy rainlooking at oneself in a mirrorslow motionmonologueloss of wifedesperationdrug overdosemental institutionreverse footagehaunted by the pastimaginationstealing a caritalian americanblack and white scenedark heroundercover copnotetragic heromemory lossbag over headforced to strippistol whipold dark housevigilantismassumed identityfake identitypolaroidbody in a trunkvigilante justiceelectric shocktrailer parkreference to albert einsteininsurancemurder of wifecarjackingrepeated linecrowbarin medias resfemale bartendercocaine snortingschizophrenicflashback within a flashbackbrain damagediabetesbreaking a bottle over someone's headattempted robberyred herringasphyxiationloss of memorydriver's licensevoice over inner thoughtsmental disorderdiabeticblack and white segues into colortattoo parlorhidden truthambiguitybook burninginsulinjaguarfalse memorysouvenirinternal monologuemementonude fightinsurance investigatorunreliable narratorspoken inner thoughtsmemory lapseamnesiacmental abusebackwardsreverse chronologyunreliable flashbackdriving licenceshort term memory lossunreliable narrationlost memoryshort term memorymemory gamesanterograde amnesiainsulin overdosereference to pocahontasretrograde narrativehanging up without saying goodbyeadvice from bartendergideon bible (See All)

Bully (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Bully (2001)

After finding himself at the constant abuse of his best friend, Bobby, Marty has become fed up with his friend's twisted ways. His girlfriend, a victim of Bobby's often cruel ways, couldn't agree more and they strategize murdering Bobby, with a group of willing and unwilling participants in a small  β€¦Florida town. In the midst of their plotting, they find themselves contemplating with the possible aftermath of what could happen. (Read More)

Subgenre:
independent filmmurder conspiracy
Themes:
murderdeathfriendshiprevengedrugsrapepregnancydrinkingdrunkennesstheftparanoiadrug useabusebullyingcruelty β€¦panicabortionrevenge murdercar sex (See All)
Mood:
murder plot
Locations:
nightclubbarbeachcarcourtroomgay barsex in carsex in a carsex on carsex in the backseat of a carsex on a car
Characters:
boyfriend girlfriend relationshipfamily relationshipshomosexualfather son relationshippolicemother son relationshipteenagermother daughter relationshipbrother brother relationshipbrother sister relationshipteenage girlprostituteteenage boystudentgay sex β€¦policemandancerthiefbest friendbullyhitmanwaitresscatholicsheriffcousin cousin relationshipgay teenageraunt nephew relationshippolice arrestdirector on camerago go boy (See All)
Story:
white pantiescamel toepremarital sextopless female nuditypantieslesbian kissmale rear nudityfemale nuditybare breastsnuditybloodmale nudityviolence β€¦female frontal nuditymale frontal nuditydogbare chested malegunsex scenefemale rear nuditycigarette smokingdancingknifeleg spreadingbased on true storytelephone callfondlingcryingbased on bookcell phonebeatingunderwearmirrorurinationpunched in the facewatching tvdrinkarrestbare buttvomitingbirthdaydead bodymarijuanabathroomcleavagebisexualgay slurtoplessstabbingdeath of friendthroat slittingstabbed to deathstabbed in the chestscantily clad femalebirthday partystrippingstabbed in the backsuburbbaseball bathigh school studentteenage sexwaiterpot smokingsociopathstabbed in the stomachstealingdrug abusebuttocksnosebleedfloridasurfingskateboardrape victimrapistmale prostituterap musicsufferingunderage drinkingpunched in the stomachsex talknipplepanties pulled downblack eyecasual sexbruisephysical abusemarijuana jointteenage pregnancydirector cameopromiscuous womantrue crimeacidrear nuditysurferbully comeuppancepregnancy teststabbed in the armpeer pressurelsdnude girlmale stripperstonednihilismwhite trashplaying a video gametopless girlcinema veritemale prostitutionford mustangsitting on a toiletdeath sentencenatural breastssmall breastsbreastwatching a videobronx new york cityabusive boyfriendelectric chairnakeddate rapecloseted gaytechno musiccanaldrug tripsittingcrotch shotbutt nakedsexual torturesnorricamvideo arcadeaccompliceclubbingguilty consciencegirl toplessprison sentencedobermangay pornwatching pornographywashing handsgay for payrepressed homosexualgirl rear nudityunsafe sexcomic book shopdrinking and drivingduitelephone sexteenage rapedrug rehabwatching a porn videodangerous friendhallucinogenic drughigh school dropoutfriends falling outvictimizationclothespinacid the drugmortal kombatclothespin on nipplespolice busthot candle waxburyingroller bladingidle richbad parentsclubberpizza hutcrotch slipsex on the hood of a carmustang convertiblesandwich shopsitting on the toiletaccessory to murderexploitation of friendshipmale wearing thongsex in backseat of carteen pregnancywatching porn on tvwatching pornographic filmcutoff shortsfemale nudity reflected in a mirrorspinning camera shotwatching a music videonaked on the telephonestanding naked in front of a mirrorwatching a gay porn videowatching gay porn (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Unbreakable (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Unbreakable (2000)

This suspense thriller unfolds as the audience is introduced to David Dunn. Not only is he the sole survivor of a horrific train-crash that killed 131 people he doesn't have a scratch on him. Elijah Price is an obscure character who approaches Dunn with a seemingly far fetched theory behind it all.

Subgenre:
cult filmsuperhero
Themes:
supernatural powermurderheropsychopathterrorismhome invasiondisability
Locations:
swimming poolhospitaltrainwaterwheelchairpennsylvania
Characters:
father son relationshipmother son relationshipserial killerhostagesecurity guardvillaincrying baby
Period:
1960s
Story:
hallucinationcar crashcar accidentsurprise endingone word titleflashbackgunrescuegood versus evilsubwaywritten and directed by cast memberproduct placementsingle parentdestinyfalling down stairs β€¦what happened to epiloguemass murderinjurycomic booksurvivorblockbusterart gallerybroken legvisionplot twistghettophiladelphia pennsylvaniabroken armmarital problemnewspaper clippingdirector cameocartoon on tvsuper strengthweightliftingnewspaper articlefilm starts with textart exhibitioncrime fighteroverhead camera shotsole survivorclose up of eyechild with gunclairvoyantprotectionarm slingman in a wheelchairends with biographical notesmultiple time framestroubled marriagebegins with textinvulnerabilityorigin of heromarital crisisart dealerbroken handmuggerphysical therapytrain crashshoplifterreference to bruce leememorial serviceimplied rapecomic book artcomic book shopbirth defectsleeper holdformer football playerarch villainsixth sensearchenemyreference to princebroken ribremoving wedding ringsoothsayerbench presswriter cameoriding a traindriving at night in the rainfall down stairsbrittle bonescomic book storegenetic abnormalityosteogenesis imperfectashattered bone (See All)

Scream 3 (2000)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 3 (2000)

A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.

Subgenre:
independent filmmartial artsblack comedypost modernhorror spoof
Themes:
murderdeathrevengekidnappingbetrayaljealousyfeardrunkennessescapefilmmakinginvestigationdeceptionvoyeurismtheftbrutality β€¦paranoiacelebrityhome invasioncourage (See All)
Mood:
goresatirenightmareslasher
Locations:
swimming poolbarhelicopterlos angeles californiaapartmentpolice stationpolice car
Characters:
boyfriend girlfriend relationshippolicefather daughter relationshipbrother sister relationshipfemale protagonistpolice officerserial killerdetectiveactorhostageactresssecurity guardpolice detectivefilm directorex boyfriend ex girlfriend relationship β€¦death of girlfriendself referentialpregnant from rape (See All)
Period:
1990s2000s
Story:
premarital sexvoyeurhallucinationcar crashmaskcar accidentsurprise endingf ratednumber in titlebloodviolencesequeldogbare chested malefight β€¦cigarette smokingphotographpartyknifechasepistolshowercell phonebeatingcorpsedigit in titleshot to deathblood splatterfistfightshot in the chestshot in the headrescuepunched in the facewatching tvbrawlsecretfalling from heightshowdownheld at gunpointsunglassesbirthdayhandcuffsrevolvershot in the backf wordreportersurvivalfoot chaseflashlightjournalistbound and gaggedambushstrangulationambulancemansionthroat slittingstabbed to deathtoiletstabbed in the chesttied to a chairfalse accusationno opening creditsdisarming someonecoffindouble crossbirthday partythird partnews reportshot in the legmarriage proposalshot in the foreheadracial slurstalkercharacter repeating someone else's dialoguebeaten to deathstabbed in the backcostumescreamingrace against timecover upknocked outkicked in the facetough girlbaseball batscreamprankshot in the shoulderbodyguardstalkingfilm within a filmexploding bodyisolationbasementsuspicionthreatened with a knifeactingobscene finger gesturecult directorstrong female charactereavesdroppinganswering machinefalling down stairsentertainmentsabotagerevelationhead buttsociopathsurvivorred dressstabbed in the stomachhollywood californiakicked in the stomachvideotapewristwatchjumping from heightrape victimfaked deathstrong female leadmexican standoffmasked manpresumed deadfemale warriorduct tape over mouthmovie theatrebarefootcrime scenecameobraverymobile phonestabbed in the throatpartnermercilessnessmovie setfalling to deathframe upstabbed in the legsibling rivalrypunched in the chestfilm setbooby trapaerial shotblood on shirtfilm producerwedding ringbulletproof vestbalconyknife throwingraised middle fingerfemale reportercharacters killed one by onesequel to cult favoritekilling spreemasked killernewspaper clippinglingerie slipmedia coveragehit with a baseball batnews reporterdirector cameoreturning character killed offex coppromiscuous womantaserhiding in a closetlecturegolf clublighterquick drawtrailer homepopcornstabbed in the armwhodunithearing voicesbody in a trunkman kills a womanhollywood signmovie studiowoman kills a manstabbed in the shouldergassole black character dies clichemetal detectorcamcorderexploding housereference to star warsscriptpsychological tortureimprovised weaponfamous linehalf brotherman hits a womanstupid victimvillain not really dead clichewrongful arrestanti heroinebreaking a bottle over someone's headgas explosionguillotinesecret roomfratricidebullet proof vestred herringfemale journalistsittinghidden gunwomen's bathroomtalk show hostmystery killerhit with a chairsecret doorwoman punches a manhidden roomcriminal mastermindfalse nameman fights a womansecret passagewayfax machinehidden doorcounselorman punches a womanfilm reelvhs tapesequel to cult filmcounsellorfake bloodhit with a frying panthrown from heightcar phoneseclusionhit with a golf clubfalling down a hillthreatening telephone callfaking own deaththrown through a glass doorfaxphone terrortelephone terrorcopycattrailer narrated by don lafontainemovie scriptrekindled romancemetafictionthrown off a balconyvoice changerdriving in the wrong directionkilled on birthdaylock pickingcopycat killerpicking lockhall of recordscounterpartreference to lois lanereference to hannibal lecter (See All)

Trance (2013) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Trance (2013)

A fine art auctioneer mixed up with a gang joins forces with a hypnotherapist to recover a lost painting. As boundaries between desire, reality and hypnotic suggestion begin to blur the stakes rise faster than anyone could have anticipated.

Subgenre:
black comedyconspiracyheistheist gone wrong
Themes:
murderdeathloverevengesurrealismkidnappingmoneyjealousyfeartorturedeceptionrobberytheftobsessionparanoia β€¦gamblingsurveillancegreedamnesia (See All)
Mood:
gorerainneo noirnightmarebreaking the fourth wallambiguous ending
Locations:
nightclubswimming poolhospitalrestaurantchurchlondon englandelevatorapartmentrooftopcar fire
Characters:
boyfriend girlfriend relationshipdoctorhostagethieflove triangleinterracial relationshipsecurity guardfrenchamerican abroadex boyfriend ex girlfriend relationshipex soldieramerican in the ukself narrationart thief
Period:
2010s
Story:
alternate realitypremarital sexhallucinationdreamsurprise endingmale rear nudityfemale nuditybloodmale nudityviolenceone word titlefemale frontal nudityflashbackbare chested male β€¦sex scenefemale rear nudityfemale full frontal nudityphotographtitle spoken by characterlabiapistolfirevoice over narrationcell phonewoman on topbeatingcorpseshot to deathblood splattershot in the chestremakeshot in the headshotgunpunched in the facesex in bedbare buttsecretpaintingheld at gunpointinterrogationcafebritishrevolvercriminalshot in the backf wordsubjective cameragangstrangulationmontagetied to a chairsubwayexploding carno opening creditshit by a cardouble crossunderwater scenefemme fataleshot in the foreheadflash forwardskinny dippingcharacter repeating someone else's dialogueelectrocutionfantasy sequencemistaken identitydebtknocked outbaseball batfull frontal female nudityattempted rapemanipulationbodyguardmurderercharacter says i love youkissing while having sexsubtitled sceneeavesdroppingcard gamebulletrevelationwarehouseelectronic music scoresociopathsecurity cameramind controlparking garageart gallerygas maskthugpromisestealing a carplot twisthypnosisblack and white scenetime lapse photographyexploding headgasolinefemale doctorlens flarebrainauctionmemory losstext messagingshot through a windowvillain played by lead actorgamblerfire extinguisherburied alivetaserjunkyardhead blown offtwist endingfemale genitaliamind gameinterracial kissbody in a trunkhit by a truckmacguffinhypnotismfinger cut offrazor bladerussian roulettecar set on firemetal detectorrepeated linevaultabusive boyfriendstrangled to deathgambling debtgang leadershot in the crotchbrain damageman hits a womanpackageshaved vulvaattempted robberyman slaps a womantrancebald vulvastrawberryloss of memorydutch anglekeysdecomposing bodyabusive relationshipscotsmanstun gunmoral ambiguitycar keysmanipulative womansnorricamart theftrepressed memorygambling addictiongas grenadered carfemale star appears nudeipadrape attemptgoogledead body in car trunknight cityscapewearing a sound wireit was all a dreamhit with a rifle buttnude paintinghit on the head with a fire extinguisherindoor swimming poolerased memoryunreliable narratordead body in a car trunkhypnotistinside the mindvirtualitybrain scanreference to vincent van goghcompulsive gamblerfamous paintingreference to pubic hairparcelactor talks to audiencetitle appears in textauctioneerstolen paintingamnesiachit with a fire extinguishermrireference to rembrandthypnotherapyfingernail cut offimplanted memorysex with patientex lover ex lover relationshipalfa romeoart bookknocked out with gun buttreference to paul cezannewearing a wiresetting a car on firestolen arthypnotherapistopening creditssuppressed memorypuppet mastertriple crossauction housebased on tv moviedestroying a computergambling addictvertical smileshot in the penisgang rape attemptreference to edgar degasreference to edouard manetreference to jan vermeershaving of vulvacrazy ex boyfriendreference to amedeo modiglianireference to caravaggioreference to the sistine chapeltearing a page from a bookreference to iraqfingernail torturelost paintingonline poker (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

The Last House On The Left (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

The Last House On The Left (2009)

While being transported by two detectives in a car, the dangerous criminal Krug is rescued by his brother Francis and his girlfriend Sadie, and they brutally kill the detectives. Meanwhile Emma, her husband John, and their daughter Mari Collingwood head to their summer home near the lake. Mari borro β€¦ws the family car to meet her friend Paige that is working in a store in the town. While in the store, they befriend a teen boy named Justin, who offers some marijuana to Paige in the motel where he is lodged. While they are smoking marijuana in Justin's room, Krug, Francis, and Sadie arrive and abduct the girls. Krug drives Mari's car and she causes them to crash into a tree. Krug stabs Paige and rapes Mari; however Mari manages to escape, swimming in the lake, but Krug shoots her in the back. They walk through the isolated road in the woods and they reach Collingwood's house telling that they have just had a car accident. Emma and John welcome the strangers until they discover what has happened to their beloved daughter. (Read More)

Subgenre:
american horror
Themes:
murderdeathfriendshiprevengekidnappingrapetorturepsychopathbrutalityguiltsadismcrueltyvengeancemurder of a police officer
Mood:
goreslasherhorror movie remake
Locations:
forestboatwoodskitchenlakemotelstorm
Characters:
husband wife relationshipfather son relationshipfather daughter relationshipmother daughter relationshipdoctorbrother brother relationshipteenage girlserial killerhostagekillerterrorserial murderer
Story:
girl in pantieswhite pantiescar crashmaskcar accidentpantiesfemale nuditybloodviolencefemale frontal nuditybare chested malefemale rear nuditychasepistol β€¦showercell phonebeatingcorpseblood splattershot in the chestremakeshot in the headpunched in the faceheld at gunpointshot in the backswimmingcleavagefoot chasebound and gaggedwinestrangulationdeath of friendstabbed to deathstabbed in the chestscantily clad femalenecklaceon the runstabbed in the backliarfugitiveknocked outkicked in the facedeath of brotherdeath of sonmurdererthreatened with a knifemaniacfalling down stairspot smokingfireplaceno pantiessociopathragestabbed in the stomachcoitusrape victimrapistfemale killerwoman in jeopardystealing a carfight to the deathpunched in the stomachgunshot woundstabbed in the headexploding headjumping through a windowpanties pulled downperversionconvictrainstormabusive fathersexual assaultcopulationpsycho killermarijuana jointpsychopathic killergirl in bra and pantiesmadmanparalysisviolence against womenshot in the neckhead woundmisogynisthuman monsterremorsefemale friendshipsexual violencehomicidal maniac17 year oldescaped convictshot in the eyenihilismheld captivesummer vacationunderage smokingnaked dead womancountry housebroken nosegropingfemale criminalbutcher knifehit with a hammercoughing bloodfemale victimmurder of a nude womanbreaking a bottle over someone's headsexual humiliationknife held to throatdepravitymicrowave ovenserial rapistchild with a gunswimming in underwearsexual predatortortured to deathremake of american filmrunning for your lifeescaped prisonerfemale serial killerdelinquentrailroad crossingsexual crueltyhit with a rockhands tied behind backgirl stripped down to bramismatched bra and pantieshit on the head with a fire extinguisherseat beltstitchessummer houseboathousefire pokerfemale sociopathgarbage disposalguest housenihilistrunning out of ammoescaped killerclothes torn offremake of remakecauterizationbegging for liferapist comeuppanceprison escapeeshot through the eyesprayed with fire extinguisherremake of swedish film (See All)

Premonition (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Premonition (2007)

The middle-class couple Linda Hanson and Jim Hanson live a wasted and routine relationship with their two daughters in their comfortable house in the suburbs. On a Thursday morning, the local sheriff visits Linda and tells her that her husband died in a car accident on the previous day. On the next  β€¦morning, when Linda awakes, she finds Jim safe and sound at home. When she awakes on the next morning, she realizes that her days are out of order, but her family and friends believe she is insane. (Read More)

Subgenre:
melodrama
Themes:
supernatural powerinfidelitymarriagepregnancyfuneralmemoryextramarital affairgriefaffair
Mood:
rainnightmare
Locations:
hospitalschoolchurchcarcemeterysmall townkitchenlaketruckofficestormsuv
Characters:
husband wife relationshipfather daughter relationshipmother daughter relationshipchildrenpriestbest friendpsychiatristsheriffinsurance agent
Story:
alternate realitycar crashcar accidentsurprise endingbloodone word titleinterviewflashbackexplosionshowertelephone callcell phonemirrortelevisiontelephone β€¦decapitationcandlewomantied to a chairnonlinear timelineexploding carsevered headcoffinsuburblightningscardeath of husbandtied upgrandmotheranswering machinesyringejeepheavy rainloss of loved onebarefootreconciliationmourningbroken glasshousewifemedicationthunderstormrainstormloss of husbandmarital problemcrowunfaithful husbandmessageflyexploding truckpremonitionglassinsurancepsychiatric hospitalford mustangcadillactied up while barefootdead birdcalendarcasketcandlelightnightgowndeja vunew housesleeping pillchevroletmarital crisisclothes linedead husbandheadstarting overphone bookbusiness tripdoor belltoyotafalling through a windowlife insurancedying repeatedlymustanghondanissanfacial injurystop signother womaninjured childlightning strikeford motor companywindow smashinglithiumlincoln automobilelincoln town carmazdainvoluntary commitmentford tauruscutsford explorerhonda accordwaste basketcadillac escaladeloose endsmazda miatachevrolet tahoedistracted driverford f150 pickup truckford fusionfroot loops cerealjeep grand cherokeekellogg's frosted flakes (See All)

Lolita (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Lolita (1997)

Humbert Humbert, a British professor coming to the US to teach, rents a room in Charlotte Haze's house, but only after he sees her 14-year-old daughter, Dolores (Lolita), to whom he is immediately attracted. Though he hates the mother, he marries her as this is the only way to be close to the girl,  β€¦who will prove to be too mature for her age. They start a journey together, trying to hide they're not just (step)father and daughter, throughout the country, being followed by someone whom Humbert first suspects to be from the police. The profound jealousy, and maybe some guilt from the forbidden love, seem slowly to drive the man emotionally labile. (Read More)

Subgenre:
independent filmtragic romance
Themes:
murdermarriagerapemoneyjealousypregnancydrinkingdrunkennessvoyeurismincestseductiontravelobsessiondeath of motherblackmail β€¦redemptionsexualitydatingillnessdeath of wifewriting (See All)
Mood:
rainnightmare
Locations:
swimming poolhospitalschoolhotelbicyclepolice carroad triplakemotelgas stationnew england
Characters:
boyfriend girlfriend relationshipfamily relationshipshusband wife relationshippoliceteenagermother daughter relationshipafrican americandoctorsingerteenage girlteenage boyteacherdetectivepolicemandancer β€¦writerpriestlustmaidprofessorolder man younger woman relationshipself destructivenessfrench kissstepfather stepdaughter relationshipdeath of girlfriendpregnant teenagersex with teenager (See All)
Period:
1940s1950s1920s
Story:
girl in pantieswhite pantiesvoyeurcollegecar accidentpantiesmale rear nuditysexcharacter name in titlebased on novelbloodmale nuditymale frontal nuditydoggun β€¦kissfightcigarette smokingdancingleg spreadingpistolshowertelephone callfirevoice over narrationcryingunderwearface slapslow motion scenedrinksex in bedsecretshootinglietearssunglassesbedpianosubjective cameraswimmingcleavageambulancewidowtoiletaccidentchild abusescantily clad femalehit by a carcontroversyold womanblack pantiesvirginscreamingmini skirtpianistpursuitfemale removes her clothesdatesuspicionrecord playereyeglassesdesirenipples visible through clothingloss of virginitysexual attractionvirusdysfunctional marriagetenniscoitusforbidden lovevirginityfollowing someonesexual desiretarget practiceconfrontationbackstagemay december romancepedophilelipstickbananabrushing teethreckless drivingcopulationpajamasadolescentflat tireage differencepervertpedophiliaspiral staircasesummer campjazz musicplaywright14 year oldwhisperingsex educationlandladyballerinamailcollege professorchewing gumunderage sexwoman wearing only a man's shirtstation wagoncadillactragic lovesex with a minorfrenchmanhouse fireschool playlolitaprecocious childrocking chairdental bracesolder man young girl relationshipsleeping pillflirtationcannesclothes linenail polishbubble gumpreparatory schoolstatutory rapebraided hairlawn sprinklergirl man relationshiplovesickvintage carunderage girlcomic stripdirty old manteepeelasciviousnessporch swingcrossing oneselfhandwritingpromiscuous daughterdental retainerplayer pianobug zapperjitterbugnymphettecollege teachervibrating bedfake rabbit earswet dressschool theateradult actress playing minor girllifting up a dressjawbreakerlying to a childmilk moustachesoda fountainwind machine (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Road House (1989) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Road House (1989)

Dalton is the Cooler in bars; He backs up and directs the bouncers. He takes a job in a Road House that has gotten far too rough. His attempts to clean things up put him in conflict with Brad Wesley, the town bully and rich person. Things heat up.

Subgenre:
martial artscult filmfish out of waterrevenge plot
Themes:
murderloverevengedanceherovoyeurismrivalryblindness
Locations:
nightclubswimming poolhospitalbarcarhelicoptermotorcyclesmall townlakestrip clubfire truckbar brawlmonster truckbar keeper
Characters:
doctortough guyaction herobullywaitresslustuncle niece relationshipold friend
Story:
girl in pantieswhite pantiesvoyeurpantiesmale rear nudityfemale nuditybloodmale nudityviolencefemale frontal nuditygunfemale rear nuditycigarette smokingexplosion β€¦knifeleg spreadingpistolshot to deathunderwearblood splatterfistfighthorsemirrorblondeshotgunbikinibrawlsex in bedbare buttfalling from heightshowdownhand to hand combatrock musicsex standing uprevolverstripperkung fugood versus evilcleavageconcertthroat slittingmixed martial artsdinerexploding carscantily clad femaledisarming someoneone man armybreast fondlingskinny dippingpublic nudityone against manyorganized crimestrippingkaratefired from the jobmini skirtopening action scenescarconvertiblefemale removes her clothesmartial artistautomobilestagefirst partsemiautomatic pistolkissing while having sexclass differencesarsonhenchmanmachismomartial arts masterno pantiesspearnipples visible through clothingelectronic music scorebeer drinkingjeepvandalismguitariststabbed in the stomachexploding buildingcountry musicparking garagechop sockybar fightdrug dealingkickboxingthugredneckpump action shotgunrear entry sexbloody nosementorfat manthrown through a windowbilliardskarate chopfemale doctordark pastpassionate kisscopulationroundhouse kickflat tirefirefighterkarate kickdrifterstuffed animalfemale removes her dressjukeboxself defensereluctant herokicked in the headembezzlementbouncerpolar beartai chipool halltycoonburning buildingsex on first datepick upsmall businesshaving sex with skirt hiked upgeneral storeneon signpool cuegay subtextcar dealerconvicted felonknife woundknife attackacting musiciancar dealershipmullet haircutstrip jointprotection racketderringerbusiness tycoonprotection moneyembezzlershattering glassbarn firesevere tire damageman naked under coversnude sleepingtable dancetrophy animalblind singer (See All)

Funny Games (2007)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Funny Games (2007)

In this English-language remake of a deconstruction in the way violence is portrayed in the media, a family settles into its vacation home, which happens to be the next stop for a pair of young, articulate, white-gloved serial killers on an excursion through the neighborhood.

Subgenre:
independent filmpost modern
Themes:
murderdeathkidnappingvoyeurismpsychopathinsanityhumiliationhome invasionmurder of family
Mood:
breaking the fourth wallhorror movie remake
Locations:
kitchen
Characters:
family relationshipshusband wife relationshipboyserial killerhostage
Story:
girl in pantieswhite pantiesvoyeurpantiessurprise endingbloodviolencebondagedogknifechasecryingcell phonecorpseshot to death β€¦blood splattershot in the chestface slapremakeshot in the headshotgunvomitingprayertelevisioncleavagebound and gaggedstabbed to deathscantily clad femaleacronym in titlechild in perillooking at the cameradrowningtalking to the camerapainproduct placementlong takefemale removes her clothestied upmaniackilling an animalnipples visible through clothingeggsociopathlifting someone into the aircaptivesocial commentarybroken legremote controlball gagpunched in the stomachdark humorhousewifemurder of a childtitle at the endbettied feetbroken armduct tapedead dogbarking dogbag over headforced to stripdockdead animalfemale removes her dressdead childrengolf clubsailboatsailingdegradationdouble barreled shotgunmind gameteasingwetting pantsupper classwoman in lingeriecountry housetied up while barefootpsychological torturewoman smokerleg woundcat and mousebloody body of a childeggsglovechild with a gunno survivorshair dryerchild killergolden retrieverraincoatgolf ballcarpetpliersgolferno musicduct tape gaghit with a golf clubmurderer duoremake by original directorlifting a male into the airchain link fencechild shot in the headsummer houseweird behaviorwading in waterrewindcar stereoanti violencerandom violencebroken eggsail boatbound hand and footwire cuttersleg splintmurdered pet (See All)

All The Boys Love Mandy Lane (2006)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

All The Boys Love Mandy Lane (2006)

SPOILER: The orphan Mandy Lane is a beautiful, virgin and pure teenager raised by her aunt, desired by her schoolmates and a close friend of the outcast Emmet. After the death of their high school mate in a pool party, Mandy befriends Chloe, Marlin, Red, Bird and Jake. Red invites the group for a we β€¦ekend party in the isolated ranch of his family, with all the boys disputing who would succeed in having sex with Mandy Lane. They meet the henchman Garth that takes care of the ranch and he asks the group to go easy on the drugs and booze. In the middle of the night, a stranger wearing a hood attacks Marlin in the barn; when Jake seeks her out, he faces the killer, beginning a night of bloodshed and terror. (Read More)

Subgenre:
slasher flickteen horror
Themes:
lesbianismmurderdrugsvoyeurism
Mood:
slasher
Locations:
swimming pooltexas
Characters:
teenage girlteenage boyserial killerslasher killergirl in underwear
Period:
2000s
Story:
girl in pantieswhite pantiesvoyeurtopless female nuditypantiesfemale nuditybare breastscharacter name in titlenuditybloodfemale frontal nuditybare chested malefight β€¦nipplespartyknifeunderwearblondeshotgunbikinishot in the backcleavagebratoplessscantily clad femalefemme fatalecowboymini skirtshot in the shouldersix word titledirectorial debutfireworkscowno pantiesnipples visible through clothinglooking at oneself in a mirrormachetejoggingfemale killerbra and pantiesnippleblack brared pantiesbody countpassionate kisscharacters killed one by onepillgirl in bra and pantiesgun in mouthsnorting cocainenudeinterracial kissnude girlteenage sexualitysitting on a toiletduonatural breastsanorexiared brateenage girl in underwearwoman undressingbroken neckwhipped creamwoman wearing black lingerieex marineswimming in underwearfemale sitting on a toiletdiscovering a dead bodymystery killerrunning for your lifefall to deathfemale serial killerfemale in bra and pantiestruth or darebolt action rifledead teenagerstabbed in the bellysuicide pactstabbed in the heartbloody handhit with a rifle buttpartnershipgirl in brashell shockpacttwo killersskeet shootingwoman wearing a string bikiniteen sexualityend credits roll callfoot racepushed into a swimming poolwoman sitting on a toiletpierced belly buttonswimming in a lakedown blouseman wearing tidy whitieswoman wrapped in a towelbloody knifewoman wearing red lingerieanimal carcasskiller teenelectrical generatorwoman wearing mismatched lingeriewhispering in earwomen's locker roomfemale removes her clothingcamera shot between a woman's legshooded killerjumping off roofcamera shot of a woman's butttrimming pubic hairbareback womancamera shot of hand (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Scream 2 (1997)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Scream 2 (1997)

Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list  β€¦of suspects goes down. (Read More)

Subgenre:
cult filmblack comedysuspenseconspiracypost modernslasher flickteen movieteen horrorhorror spoof
Themes:
murderdeathloverevengebetrayalfeardrunkennessescapeinvestigationdeceptionvoyeurismpsychopathparanoiainsanitysadism β€¦theatremurder of a police officernear death experience (See All)
Mood:
goresatireslasher
Locations:
hospitalbicyclepolice stationpolice carfire truck
Characters:
boyfriend girlfriend relationshippoliceteenagerfemale protagonistpolice officerserial killerdetectivehostagekillerpolice detectiveex boyfriend ex girlfriend relationshipself referential
Period:
1990s
Story:
voyeurhallucinationcollegecar crashmaskcar accidentsurprise endingf ratednumber in titlebloodviolencesequelinterviewbare chested malekiss β€¦cigarette smokingsingingpartyknifechasepistolcell phonebeatingcorpsedigit in titleshot to deathblood splattershot in the chesturinationface slapshot in the headrescueslow motion scenepunched in the facewatching tvcomputerbrawlshowdownheld at gunpointsunglassessecond parttelevisiontelephonef wordreportergood versus evilsurvivalfoot chasegay slurbedroomflashlightjournalistambushaxevideo cameraambulancestabbingdeath of friendthroat slittingimpalementstabbed to deathstabbed in the chestinternetfalse accusationno opening creditsdisarming someonehit by a cardouble crosspolice officer killedvannews reportshot in the legnecklaceshot in the foreheadracial slurattempted murderlibraryauthorstalkercharacter repeating someone else's dialoguemicrophonestabbed in the backcostumescreamingattackpay phoneproduct placementstatuecover upknocked outkicked in the facecollege studentlightningprankscarbodyguardstalkingfilm within a filmisolationsuspicionstagecharacter says i love youthreatened with a knifeshot in the armbare chested male bondagecult directorstrong female characterpizzatwenty somethingeavesdroppingtv newsfalling down stairsheroineshot in the stomachfamecatfightsurvivorgroup of friendsstabbed in the stomachcrucifixmovie theatervillainessvideotapeblockbusterrehearsalpress conferencestrong female leadinterracial friendshipcrushed to deathsocial commentarymasked manpresumed deadfemale warriorduct tape over mouthcrime scenecameohaunted by the pastconstruction sitestabbed in the throatmercilessnessevacuationfalling to deathescape attemptstabbed in the heade maillens flarefemale reporterplaycharacters killed one by oneethnic slursequel to cult favoritekilling spreemasked killermedia coverageclose up of eyesenglishman abroadintimidationnews reporterdirector cameoreturning character killed offex cophiding in a closetohiocafeteriafake identitypolice chieffemale psychopathpopcornwhodunitcameramanfraternitysororitybusiness cardman kills a womanoffscreen killingfemale villainwoman kills a mandeath of boyfriendstabbed in the shouldershot in the throatcollege campusstabbed in the facetragic pastreference to star warslimpwoman slaps a manfamous linestupid victimvillain not really dead clicheclimbing out a windowvcrthrown from a car555 phone numberred herringfemale journalistsittingfilm schoolwoman punching a manmystery killergeneration xcult figurecut armfilm studentmob of reportersbroken handaccomplicereference to charles mansonthrown from heightdeath by impalementauditoriumstab woundthreatening telephone callthrown through a glass doorinstant messagingprank callsorority housereference to quentin tarantinoreference to o.j. simpsonphone terrorstabbed in the earreference to jeffrey dahmerreference to ted bundytelephone terrortheater directorcopycatvalley girlmetafictionthrown off a balconytv cameramanvoice changerreference to kevin costnerreference to the godfatherfake knifemise en abymereference to jennifer anistonreference to kevin baconreference to the terminatorbreaking bottle over headcopycat killerreference to sandra bullocktalking during a moviewoman kills a womanfalling off a stagesorority partysorority sisterfilm geekreference to james cameronsoundproof roomimpaled by pipestage director (See All)

Black Snake Moan (2006) is one of the best movies like Soul Survivors (2001)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Black Snake Moan (2006)

In rural Tennessee, Lazarus, a former blues musician who survives by truck farming, finds a young girl nearly beaten to death near his home. She's the white-trash town tramp, molded by a life of sexual abuse at the hands of her father and verbal abuse from her mother, who seems to delight in remindi β€¦ng Rae of her mistake in not aborting her. Lazarus, who is also facing personal crisis at the dissolution of his marriage, nurses Rae back to health, providing her with gentle, fatherly advice as well as an education in blues music. Rae's boyfriend, Ronnie, goaded by the man who nearly beat Rae to death, misunderstands the relationship between Lazarus and Rae, and vows to kill him. Lazarus, exhibiting a street-smart understanding of violence and its motives, calls Ronnie's bluff, senses that he is as troubled as Rae, and becomes a guiding force in the young couple's resurrection. (Read More)

Themes:
lovefriendshipmarriagedrugspregnancydrinkingdrunkennessweddingdeceptionseductionangerdrug useredemptioninsanityillness β€¦faithabuseexploitationabortiontraumafreedom (See All)
Mood:
nightmarearchive footage
Locations:
barrestaurantchurchsmall townbathtubbusrural settingkitchenmotelstormsex outsidesex outdoors
Characters:
boyfriend girlfriend relationshiphusband wife relationshipmother daughter relationshipafrican americanfriendtattoosingerboyprostitutedancermusicianlustbiblecousin cousin relationshipex husband ex wife relationship β€¦pimpu.s. soldier (See All)
Story:
girl in pantieswhite pantiessexual abusehallucinationtopless female nuditypantiesfemale nuditybare breastsnuditybloodfemale frontal nudityflashbackdoggunsex scene β€¦kissfightcigarette smokinginterracial sexdancingnipplestitle spoken by charactersingingpartyleg spreadingthree word titletelephone callfondlingcryingsongbeatingunderwearfoodslow motion scenedrinkundressingkissingvomitingriflebeertearsanimal in titlecafemarijuanaprayercolor in titleguitarcleavagebrabandconcertdrug dealermontageeatingprisonerchild abusescantily clad femalecoffeebartenderracial slurpublic nuditycursevirginprologuemini skirtattempted rapefarmergardenobscene finger gesturekissing while having sexgaragepickup trucktopless womansupermarketnipples visible through clothingwoundloss of virginitydressrace relationscaptiveguitaristcaucasianwristwatchnaked womanpreacherrear entry sexgrocery storebloody noseu.s. armyministerkickingsex talknippleanxietyfather figurecigarette lighterthunderstormroseblack eyehealingcapturewedding dressnervous breakdownchainholding handssouthern accentpromiscuous womanfarmingshortstractorchild molestationtemptationfarmhousetrailer homesexual promiscuitycowboy bootspharmacytennesseecoughingreverendtopless girlfeverauto mechanicwoman wearing only a man's shirtnymphomaniacbreastfilm starts with sexsalvationhymnblues musicunwanted kissfirst sexual experiencepool hallbride and groombroken bottleclothing storesex from behindzippo lighterguard dogpanic attackamerican southbarber shopsaying gracepharmacistdrugstoresex act reflected in mirrorsex addictmoonshinenymphomaniahot pantsleft for deadrecovering alcoholicgirl toplessunfaithful girlfriendchurch choirwoman in a bathtubsouthern gothicanxiety attackmultiple loversstomachnaked outdoorsblack man white woman relationshippoor white trashreformradiatorbare breastice bathcorn on the cobrose gardenblues singersexual innuendo in titlewickednessanxiety disorderflower gardenwatchdogvegetable farmheavy machinerysex act reflected in a mirrorchained to a radiatorsex reflected in mirrorsexual hysteria (See All)

Jennifer's Body (2009)
MovieTV-SeriesTV-Mini-SeriesTV-MovieTV-SpecialStraight-To-Video
ActionAdventureAnimationComedyCrimeDocumentaryDramaFamilyFantasy
HorrorMysteryMusicalRomanceSci-FiThrillerWarWestern

Jennifer's Body (2009)

Nerdy, reserved bookworm Needy Lesnicki, and arrogant, conceited cheerleader Jennifer Check are best friends, though they share little in common. They share even less in common when Jennifer mysteriously gains an appetite for human blood after a disastrous fire at a local bar. As Needy's male classm β€¦ates are steadily killed in gruesome attacks, the young girl must uncover the truth behind her friend's transformation and find a way to stop the bloodthirsty rampage before it reaches her own boyfriend Chip. (Read More)

Subgenre:
independent filmblack comedyparanormal phenomenateen moviechrist allegory
Themes:
funeralseductionpsychopathcannibalismescape from prisonunlikely friendship
Mood:
gorehigh schoolritual murder
Locations:
swimming poolschoolsmall townlakesinging in a carsex in woods
Characters:
boyfriend girlfriend relationshipmother daughter relationshipvampirebest friendteacher student relationshipself mutilationself cutting
Story:
girl in pantiesundeadpremarital sexpantieslesbian kissfemale nudityf ratedcharacter name in titlebloodflashbacksex sceneexplosionfirepunctuation in titletitle directed by female β€¦blood splattercondomsex in bedvomitingapostrophe in titleclassroomf wordcleavagebraambulanceimpalementstabbed to deathrock bandno opening creditsscantily clad femalevanfemme fatalevirginscreamingperson on firepossessionskeletonscene during end creditsfemale removes her clothescheerleaderwaterfallkissing while having sexnewspaper headlineteenage sexoccultburned alivewoman with glassescatfighttitle based on songred dressbisexual girlcovered in bloodcoitusfemale killermental institutionrock concertunderage drinkingmourningstabbed in the neckfootball playerdisembowelmentshadowdeertuxedodemonic possessioncharacters killed one by onetank topcopulationtext messaginggothabandoned buildingnarrated by characterplaying poolcafeteriablue pantieshuman sacrificeabandoned houseteenage sexualitybitten in the neckdripping bloodseductressjockkicked in the headunderage smokingdeath of boyfriendreference to shakespeare's hamletdeath of title characterlesbian subtextspitting bloodwhite dressgroupieimmolationsolitary confinementburning buildingimplied nuditysafe sexpost traumatic stresskilled during sexstabbed multiple timessuccubuspepper sprayorderlyslumber partysatanic ritualvortexvillainess played by lead actresstalking to the deadfootball fieldable to see the deadstory continued during end creditsbare midriffmalnutritionbad girlindependent musichook for handlesbian teenfirst lesbian experiencebadmintonbox cutteremobloodlustincest jokevengencewhirlpoolpopular girlheavy pettingzipperforeign exchange studentpolice tapereference to myspacespitting in someone's facevirgin sacrificecandlelight vigilmyspacenerdy girlpants falling downpierced lipgirl wearing glasseswoman leading a man onindie bandmesmerismbutane lighterfood as sex metaphortoy pianotwo girlfriendsformal dancehoveringimpaled by pipegoalpostspitting out a toothfalse virginity (See All)

Want to refine your search by certain categories/keywords? Please email us and explain your needs!

Showing Top 50 Matches Above.
Do you need specific genre & keyword selection to find films similar to Soul Survivors?
<< FIND THEM HERE! >>