Please wait - finding best movies...
Suzy Bannion travels to Germany to perfect her ballet skills. She arrives at the Tanz dance academy in the pouring rain and is refused admission after another woman is seen fleeing the school. She returns the next morning and this time is let in. She learns that the young woman she saw fleeing the p …revious evening, Pat Hingle, has been found dead. Strange things soon begin to occur. Suzy becomes ill and is put on a special diet; the school becomes infested with maggots; odd sounds abound; and Daniel, the pianist, is killed by his own dog. A bit of research indicates that the ballet school was once a witches' coven - and as Suzy learns, still is. (Read More)
Subgenre: | italian horrorsupernatural horrorart horrorpsychological thrillerarthousefish out of watersupernaturalconspiracysuspensecoming of agecult filmindependent film |
Themes: | supernatural powermysterious deathself sacrificeblindnesspaniccrueltyunrequited loveevilsadismillnessparanoiabrutalityvoyeurismdeceptiondance …escapedrunkennessfeardeathmurdersurrealismfriendship (See All) |
Mood: | stylizationdarknessslasheravant gardenightraingore |
Locations: | taxi driverswimming poolgermanyapartmentwoodsairporttaxiforestschool |
Characters: | evil witchmysterious killeramerican abroadnew studentaunt nephew relationshipself mutilationamericanteenage girlgermanwitchprofessorpsychiatristkillersister sister relationshipstudent …police officergirlteacherfemale protagonistboydoctorfriendteenager (See All) |
Period: | year 19771970s |
Story: | dance academyballet teacherballet schoolbarbed wirerazor bladeflickering lightstabbed in the heartlocked in a roomgrindhouse filmdressing roomitalian cinemaballet shoesanimal killingcolor blindnessoffscreen killing …german shepherdevil powerlocker roomkilling an animalevil spiritunknown killerindoor swimming poolpsychopathic killerpiano playingpiano playertaxi ridesecret passagegood versus evilhanged girldance instructorreanimated corpserotting corpsecollege studentescape attemptheavy rainschool principalhouse on fireblond boyknife in throatknife woundknife murderthreatened with a knifetelephone callfoot chaseattacked by a dogguide dogbitten by a dogseeing eye dogpainting fingernailsthematic cinemagory violenceblind musicianpsychiatric treatmentfalling through a glass roofempty worldwoman hangedraspy voiceserving traystained glassstudy abroadhiding behind a doormusical scenemultiple stabbingsrotten foodwall paintingemployee dismissalstabbed with glassdrinking blooddrugged foodhole in chesthallucinogenicnauseafootstepshell on earthprogressive rockdrive in classichorror artfragments of glasssatanicmale dancercovenwirehanged womanfienddog attackremadedemonichidden doorcoughing bloodbloody violencegargoyleexterminatorthroat rippingleotardacademybitten in the throatgraphic violenceextreme close upzippo lighterglowing eyesfade to blackwetsinisternoiseghoulsilhouetteheadmastermaggotbreaking a windowbitten in the neckhallwaypsychiatrymacguffinrazorhearing voiceswhistlingclimbing through a windowwormwhisperingsleepslashingspiral staircasemetaphorinvisibilityblood on shirtbatdead woman with eyes openopening a doorlightblind manroomnotetitle at the enddisfigurementaerial shotblood on facerainstormshadowatticheartcigarette lighterstabbed in the neckbroken glassstabbed in the throatpsychotronicpower outagefemale leadmutemercilessnessbloody nosereverse footagecovered in bloodfull moonanimal attackdead womandeath of friendschizophreniavictimgrindhousevisitexploding buildingservantgossipnosebleedwitchcraftcooklooking at oneself in a mirrornipples visible through clothingelectronic music scorehypodermic needlefaintinggothicburned aliveeavesdroppingoccultitaliankillingcult directoreuropepubballetfirst partmurderersuspicioninjectiondisappearancehangingmissing personscreamcharacter's point of view camera shotlightningcover upcharacter repeating someone else's dialogueattempted murderscreamingprologuedangerlegendritualcoffinstabbed in the cheststabbed to deathtoiletthroat slittingimpalementstabbingstrangulationambushwinesubjective cameraswimmingtelephonevoyeurhallucinationdemonpianobathroomshowdownfalling from heightsecretslow motion sceneblood splattercorpsevoice over narrationfiresurprise endingchaseknifeexplosiondancingcigarette smokingone word titleflashbackbloodviolencedog (See All) |
A new family moves into the house on Elm Street, and before long, the kids are again having nightmares about deceased child murderer Freddy Krueger. This time, Freddy attempts to possess a teenage boy to cause havoc in the real world, and can only be overcome if the boy's sweetheart can master her f …ear. (Read More)
Subgenre: | supernatural horrorsupernaturalcult film |
Themes: | supernatural powermysterious deathpanicevilsadismparanoiabrutalityvoyeurismescapefearmurderfriendshipdeathsurrealism |
Mood: | darknessslasherraingore |
Locations: | swimming poolschool |
Characters: | self mutilationteenage girlkillerstudentgirlteacherboyfriendteenager |
Story: | grindhouse filmlocker roomkilling an animalevil spiritpsychopathic killerescape attemptthreatened with a knifetelephone callfoot chasegory violencehell on earthdrive in classicdemonicbreaking a windowhearing voices …slashingdisfigurementblood on facerainstormcovered in bloodfull moongrindhousevisitlooking at oneself in a mirrornipples visible through clothingelectronic music scoregothicburned alivemurdererscreamcharacter's point of view camera shotlightningscreaminglegendstabbed in the cheststabbed to deathimpalementstabbingsubjective cameravoyeurhallucinationdemonslow motion sceneblood splatterfiresurprise endingchaseknifecigarette smokingviolenceblooddog (See All) |
In a continuation of the plot of Halloween, Michael Myers shows off his indestructability by resuming his murder spree despite being gunned down with six bullets in the original movie. Laurie Strode is once more his intended victim, with Dr. Sam Loomis again in hot pursuit.
Subgenre: | suspensecult film |
Themes: | blindnessparanoiabrutalityvoyeurismfeardeathmurder |
Mood: | darknessslashernightgore |
Characters: | teenage girlkillerpolice officerteenager |
Period: | 1970s |
Story: | grindhouse filmpsychopathic killergood versus evilcollege studentknife murdertelephone calldrive in classicfragments of glassfienddemonicbloody violencegraphic violencezippo lightersinistersilhouette …slashingdead woman with eyes openlightdisfigurementshadowcigarette lighterbroken glassstabbed in the throatmutemercilessnessdead womanvictimgrindhouseelectronic music scorehypodermic needlemurdererinjectionscreamcharacter's point of view camera shotattempted murderscreamingprologuestabbed to deaththroat slittingstabbingstrangulationsubjective cameravoyeursecretblood splatterfirechaseknifeexplosioncigarette smokingbloodviolence (See All) |
One summer at Camp Crystal Lake, a group of young counselors begin to get ready to lead campers. Unfortunately for the former, someone isn't happy about what's going on in the camp and enjoys playing kill the counselor. As bodies fall to the ground in the camp, no one is safe.
Subgenre: | suspensecult filmindependent film |
Themes: | mysterious deathcrueltyevilsadismbrutalityvoyeurismfearmurderdeath |
Mood: | darknessslashernightgore |
Locations: | woods |
Characters: | killerpolice officerfriendteenager |
Period: | 1970s |
Story: | grindhouse filmunknown killerpsychopathic killerheavy rainblond boyknife murderdrive in classicremadebloody violencegraphic violenceslashingroomatticstabbed in the throatpsychotronic …power outagemutemercilessnessfull moondead womanvictimgrindhousenipples visible through clothingelectronic music scoregothickillingfirst partmurdererinjectionscreamingprologuedangerstabbed to deaththroat slittingstabbingsubjective cameravoyeurhallucinationslow motion sceneblood splattercorpsesurprise endingviolence (See All) |
A psychic who can read minds picks up the thoughts of a murderer in the audience and soon becomes a victim. An English pianist gets involved in solving the murders, but finds many of his avenues of inquiry cut off by new murders, and he begins to wonder how the murderer can track his movements so cl …osely. (Read More)
Subgenre: | italian horrorsuspensecult film |
Themes: | panicsadismillnessparanoiabrutalitydrunkennesssurrealismmurderdeath |
Mood: | darknessslashernightgore |
Locations: | school |
Characters: | germanprofessorpsychiatristkillergirlboydoctor |
Period: | 1970s |
Story: | grindhouse filmitalian cinemaunknown killerpsychopathic killerhouse on firetelephone callprogressive rockdrive in classicfragments of glassgraphic violencesilhouettehallwayslashingdead woman with eyes openlight …disfigurementshadowstabbed in the neckbroken glassmutemercilessnessdead womanvictimgrindhousegothickillingcult directoreuropemurderersuspicionhangingattempted murderscreamingprologuedangerstabbed to deathimpalementstabbingstrangulationsubjective cameratelephonehallucinationpianobathroomsecretblood splattercorpsefiresurprise endingchaseknifecigarette smokingflashbackbloodviolence (See All) |
Among normal humans live the "Others" possessing various supernatural powers. They are divided up into the forces of light and the forces of the dark, who signed a truce several centuries ago to end a devastating battle. Ever since, the forces of light govern the day while the night belongs to their … dark opponents. In modern day Moscow the dark Others actually roam the night as vampires while a "Night Watch" of light forces, among them Anton, the movie's protagonist, try to control them and limit their outrage. (Read More)
Subgenre: | supernaturalcult filmindependent film |
Themes: | supernatural powerpanicparanoiabrutalitydeceptionescapefearsurrealismdeathmurder |
Mood: | darknessnightgore |
Locations: | swimming poolapartment |
Characters: | self mutilationwitchpolice officerdoctor |
Story: | good versus evilthreatened with a knifefoot chasedrinking bloodglowing eyeshearing voicesinvisibilitylightaerial shotpower outagereverse footageexploding buildingnosebleedwitchcraftlooking at oneself in a mirror …europefirst partcharacter's point of view camera shotlightningcharacter repeating someone else's dialogueattempted murderscreamingprologuedangerlegendstabbed in the cheststabbed to deathimpalementambushsubjective camerashowdownslow motion sceneblood splattercorpsevoice over narrationsurprise endingchaseknifeexplosiondogflashbackbloodviolence (See All) |
Subgenre: | psychological thrillerfish out of watersuspensecult filmindependent film |
Themes: | panicparanoiabrutalityescapefearfriendshipdeathmurder |
Mood: | slashergore |
Locations: | woodsforest |
Characters: | self mutilationteenage girlpolice officerteenager |
Story: | barbed wireoffscreen killingcollege studentthreatened with a knifefoot chaseextreme close upsinisterblood on shirtdisfigurementaerial shotmercilessnessdeath of friendfirst partscreamingprologue …dangerstabbed in the cheststabbed to deathtoiletambushshowdownfalling from heightslow motion sceneblood splattercorpsefiresurprise endingchaseknifeexplosioncigarette smokingbloodviolence (See All) |
On Elm Street, Nancy Thompson and a group of her friends (comprising Tina Gray, Rod Lane and Glen Lantz) are being tormented by a clawed killer in their dreams named Fred Krueger. Nancy must think quickly, as Fred tries to pick them off one by one. When he has you in your sleep, who is there to save … you? (Read More)
Subgenre: | cult filmindependent film |
Themes: | supernatural powerevilsurrealismmurder |
Mood: | slasheravant gardegore |
Characters: | self mutilationteenage girlkiller |
Story: | grindhouse filmpsychopathic killergood versus evilfoot chasedrive in classicsatanicremadedemonicgraphic violencemaggotclimbing through a windowsleepdisfigurementdeath of friendvictim …grindhouseelectronic music scoregothicburned alivecult directorfirst parthangingcharacter's point of view camera shotstabbed in the cheststrangulationsubjective cameratelephonedemonfalling from heightslow motion sceneblood splattercorpsesurprise endingcigarette smokingbloodviolence (See All) |
When three girls are kidnapped by a man with 23 different personalities, they have to work out which of those personalities will help them escape and which of those personalities will try to stop them.
Subgenre: | psychological thrillersuspense |
Themes: | panicparanoiabrutalityvoyeurismdeceptionescapefeardeathmurdersurrealismfriendship |
Mood: | slashergore |
Locations: | taxi driverapartmentwoodstaxiforest |
Characters: | teenage girlpsychiatristkillerpolice officerdoctorteenager |
Story: | locked in a roompsychopathic killerescape attemptheavy rainbloody violencefade to blacksinisterspiral staircasepower outagemercilessnessdeath of friendschizophreniavictimlooking at oneself in a mirrorhypodermic needle …killingmurderersuspicioninjectionmissing personcharacter's point of view camera shotattempted murderdangersubjective cameravoyeurcorpsesurprise endingchaseknifedancingone word titleviolencedogbloodflashback (See All) |
Subgenre: | conspiracysuspenseindependent film |
Themes: | panicparanoiabrutalitydeceptionescapefeardeathmurder |
Locations: | woodsforest |
Characters: | psychiatristdoctor |
Story: | locked in a roomthreatened with a knifefoot chasethroat rippingbitten in the throatclimbing through a windowaerial shotblood on facestabbed in the neckfull moondeath of friendcooklooking at oneself in a mirrorelectronic music scorehypodermic needle …suspicioninjectioncover upcharacter repeating someone else's dialogueattempted murderdangerstabbed in the cheststabbed to deathimpalementstrangulationambushshowdownblood splattercorpsesurprise endingchaseknifeone word titleviolencebloodflashback (See All) |
In the millenium version of this classic Gothic horror we find Abraham Van Helsing (Plummer), who has tangled with Count Dracula (Butler) in the past, working as an English antiques dealer. Simon (Miller) is a vampire hunter in training under his apprenticeship. Van Helsing and Simon travel from Lon …don to New Orleans to rescue Van Helsing's daughter Mary (Waddell) from the family's life long nemesis - Dracula. (Read More)
Subgenre: | supernaturalsuspensecoming of agecult film |
Themes: | supernatural powerpanicevilparanoiadeceptionescapefearmurderdeathsurrealismfriendship |
Mood: | gore |
Locations: | airporttaxischool |
Characters: | professordoctor |
Story: | stabbed in the heartoffscreen killinggood versus evilcollege studentthreatened with a knifefoot chaseglowing eyesbitten in the neckbatstabbed in the throatmercilessnessreverse footagedeath of friendhypodermic needlegothic …burned aliveinjectionhanginglightningattempted murdercoffinstabbed in the cheststabbed to deaththroat slittingimpalementstrangulationambushhallucinationshowdownfalling from heightslow motion sceneblood splattercorpsesurprise endingchaseknifeexplosionbloodflashbackviolence (See All) |
The five highly trained Bennett sisters in Georgian England must try to protect themselves from the growing zombie threat, find suitable husbands for themselves, battle marriage proposals and unlikely suitors, and save the country before it's too late.
Subgenre: | independent film |
Themes: | unrequited loveillnessparanoiabrutalitydeceptiondanceescapedrunkennessfearfriendshipmurderdeath |
Mood: | raingore |
Locations: | woodsforest |
Characters: | aunt nephew relationshipsister sister relationshipfemale protagonistfriend |
Story: | grindhouse filmgood versus evilheavy rainthreatened with a knifefade to blackdisfigurementaerial shotrainstormstabbed in the neckstabbed in the throatmercilessnessservantlooking at oneself in a mirrorburned aliveeavesdropping …character's point of view camera shotlightningprologuedangerstabbed in the cheststabbed to deaththroat slittingimpalementambushsubjective camerahallucinationshowdownfalling from heightslow motion sceneblood splattercorpsevoice over narrationfiresurprise endingchaseknifeexplosiondancingdogviolencebloodflashback (See All) |
Two American college students are on a walking tour of Britain and are attacked by a werewolf. One is killed, the other is mauled. The werewolf is killed but reverts to its human form, and the local townspeople are unwilling to acknowledge its existence. The surviving student begins to have nightmar …es of hunting on four feet at first but then finds that his friend and other recent victims appear to him, demanding that he commit suicide to release them from their curse, being trapped between worlds because of their unnatural deaths. (Read More)
Subgenre: | fish out of watersupernaturalsuspensecult film |
Themes: | supernatural powerpanicparanoiabrutalityvoyeurismescapefearsurrealismfriendshipdeathmurder |
Mood: | gore |
Locations: | taxi driverapartmentwoodstaxiforest |
Characters: | american abroadamericanstudentpolice officerdoctorfriend |
Story: | animal killingoffscreen killingreanimated corpsecollege studentheavy rainthreatened with a knifeglowing eyesbitten in the neckrainstormpsychotronicmercilessnesscovered in bloodfull moonanimal attackdeath of friend …looking at oneself in a mirrorgothicpubfirst partsuspicioncharacter's point of view camera shotlightningcover updangerlegendthroat slittingsubjective cameratelephonevoyeurslow motion sceneblood splattercorpsesurprise endingchaseknifecigarette smokingbloodviolencedog (See All) |
It's nearing the 10th Anniversary of the film 'A Nightmare on Elm Street' and one of the stars, Heather Langenkamp is being scared by a voice on a phone, sounding very similar to the film's villain, Freddy Krueger. When Heather's husband is killed in a car accident and is discovered with slash marks … on him, Heather starts to wonder something. Especially when she discovers that Wes Craven is writing another 'Nightmare' film. Soon, she realizes that Freddy has now entered the real world, and the only way to defeat him is to become Nancy Thompson once again. (Read More)
Subgenre: | psychological thrillersuspensecult filmindependent film |
Themes: | supernatural powerparanoiabrutalitydeceptionescapefearsurrealismmurderdeath |
Mood: | slashergore |
Locations: | swimming pool |
Characters: | police officerboy |
Story: | offscreen killinggood versus evilknife woundfoot chasefade to blackhearing voicessleeptitle at the enddisfigurementstabbed in the throatreverse footagedeath of friendnosebleedelectronic music scorehypodermic needle …burned aliveinjectioncharacter's point of view camera shotcharacter repeating someone else's dialogueattempted murderscreamingstabbed in the cheststabbed to deathstabbingstrangulationambushtelephonehallucinationdemonshowdownfalling from heightslow motion sceneblood splattercorpsefiresurprise endingchaseknifeexplosionviolenceblood (See All) |
Alexia travels with her friend Marie to spend a couple of days with her family in their farm in the country. They arrive late and they are welcomed by Alexia's father. Late in the night, a sadistic and sick killer breaks into the farmhouse, slaughters Alexia's family--including their dog--and kidnap …s Alexia. Marie hides from the criminal and tries to help the hysterical and frightened Alexia, chase the maniac, and disclose his identity in the end. (Read More)
Subgenre: | suspenseindependent film |
Themes: | unrequited loveevilsadismbrutalityfearfriendshipsurrealismmurderdeath |
Mood: | darknessslashernightgore |
Locations: | woodsforest |
Characters: | mysterious killerteenage girlkillerstudentfemale protagonistboyfriend |
Story: | barbed wirerazor bladegrindhouse filmkilling an animalpsychopathic killertelephone callgory violencestabbed with glassbloody violencegraphic violenceslashingbroken glassgrindhousekillingeurope …murdererstabbed in the chestthroat slittingimpalementstabbingsubjective cameratelephonevoyeurbathroomslow motion sceneblood splattercorpsesurprise endingchaseknifecigarette smokingdogviolenceflashbackblood (See All) |
Chucky hooks up with another murderous doll, the bridal gown-clad Tiffany, for a Route 66 murder spree with their unwitting hosts, two eloping high-school graduates.
Subgenre: | supernaturalconspiracycult film |
Themes: | supernatural powerpanicunrequited lovesadismparanoiabrutalitydeceptionescapefearsurrealismmurderdeath |
Mood: | slashergore |
Locations: | school |
Characters: | teenage girlpolice officerteenager |
Story: | stabbed in the heartlocker roomescape attemptheavy rainknife woundknife murderfragments of glassmacguffindead woman with eyes opentitle at the enddisfigurementblood on facerainstormcigarette lightergothic …suspicionlightningcharacter repeating someone else's dialogueattempted murderscreamingdangerritualcoffinstabbed in the chestthroat slittingimpalementstrangulationambushtelephoneshowdownslow motion sceneblood splattercorpsefiresurprise endingchaseknifecigarette smokingviolenceblood (See All) |
The college friends Paul, Karen, Bert, Marcy and Jeff rent an isolated cabin in the woods to spend a week together. When they arrive, a man contaminated with a weird disease asks for help to them, but they get in panic and burn the man, who falls in the water reservoir and dies. The whole group, exc …ept Karen, makes a pact of drinking only beer along the week without knowing where the dead body is. When Karen drinks tap water and gets the disease, the group begins their journey to hell. (Read More)
Subgenre: | psychological thrillersuspensecult filmindependent film |
Themes: | panicunrequited loveillnessparanoiabrutalityescapedrunkennessfeardeathmurderfriendship |
Mood: | raingore |
Locations: | woodsforest |
Characters: | self mutilationpolice officerdoctor |
Story: | animal killingoffscreen killingcollege studentescape attemptblond boythreatened with a knifefoot chasedog attackdisfigurementstabbed in the neckstabbed in the throatreverse footagecovered in bloodanimal attackdeath of friend …grindhouseburned aliveeavesdroppingcult directorscreamingstabbed in the cheststabbed to deathimpalementambushswimminghallucinationslow motion sceneblood splattercorpsefiresurprise endingchaseknifecigarette smokingflashbackdogbloodviolence (See All) |
Near Burkittsville, in the Black Hills Forest, on the root of a lightning-struck tree, the couple of Lane and Talia find a DV tape sticking out of the ground. The content of the found tape is mostly footage of static, however, near the end, there is also an intriguing small part where someone is try …ing to escape from something that is after him, screaming and running in an abandoned house. After accidentally stumbling across the uploaded footage, James, believing that this is his final chance to put an end once and for all in the unresolved mystery of his sister's Heather disappearance, some twenty years ago in the same woods, he assembles a team of friends in search of answers. Sooner or later, the team will go astray in the heart of a green maze that is riddled with the chilling legend of Elly Kedward, the Blair Witch who relentlessly keeps messing with their sanity, gradually taking them down, one by one. Eventually, James will find himself in the epicentre of the evil activity, trapped inside the very house where his sister disappeared, unaware of the fact that, once more, the witch will demand her sacrifice. (Read More)
Subgenre: | psychological thrillersupernaturalsuspense |
Themes: | supernatural powerpanicevilparanoiadeceptionescapefearfriendshipmurderdeath |
Mood: | raingore |
Locations: | woodsforest |
Characters: | self mutilationwitch |
Story: | grindhouse filmcollege studentescape attemptheavy rainaerial shotrainstormatticheartmercilessnessdeath of friendsuspiciondisappearancemissing personcharacter's point of view camera shotlightning …screamingdangerlegendstabbed in the cheststabbed to deathimpalementsubjective camerafalling from heightblood splattercorpsesurprise endingchaseviolenceblood (See All) |
When the Chase family moves to an isolated house in the middle of nowhere in Detroit, Arkin is hired to fix the windows and the doors. Later he meets his daughter and his wife that has a debt with dangerous sharks and needs money, but his week payment is not enough to pay her debts. Arkin plots to h …eist the safe of Michael Chase during the night to raise the necessary money. However, when he arrives in the house, he finds that a sadistic criminal has imprisoned the family and planted traps everywhere. Arkin seeks a way out of the deadly house to save his life. (Read More)
Subgenre: | suspenseindependent film |
Themes: | crueltyevilsadismbrutalityescapemurderdeath |
Mood: | slashernightgore |
Characters: | mysterious killerself mutilationteenage girlkillerteenager |
Story: | barbed wiregrindhouse filmkilling an animalpsychopathic killergood versus evilescape attempthouse on firethreatened with a knifefoot chaseexterminatorthroat rippingclimbing through a windowslashingtitle at the endpsychotronic …mercilessnesscovered in bloodanimal attackvictimlooking at oneself in a mirrorfirst partscreamscreamingdangerstabbed in the cheststabbed to deathimpalementstabbingshowdownslow motion sceneblood splattercorpsesurprise endingknifecigarette smokingflashbackviolenceblood (See All) |
1 year after her mother's death, Sydney Prescott (Neve Campbell), and her friends started experiencing some strange phone calls. They later learned the calls were coming from a crazed serial killer, in a white faced mask and a large black robe, looking for revenge. His phone calls usually consist of … many questions, the main one being: Whats your favorite scary movie? Along with many scary movie trivia, ending with bloody pieces of innocent lives scattered around the small town of Woodsboro. (Read More)
Subgenre: | psychological thrillerconspiracysuspensecoming of agecult film |
Themes: | paranoiabrutalityescapedrunkennessfearmurderdeathfriendship |
Mood: | darknessslashergore |
Locations: | woodsforest |
Characters: | teenage girlkillerfemale protagonistteenager |
Story: | escape attemptthreatened with a knifefoot chaseclimbing through a windowblood on shirtpower outagecovered in blooddeath of friendgossipnipples visible through clothingeavesdroppingcult directorfirst partsuspicionhanging …screamcharacter's point of view camera shotdangerstabbed in the cheststabbed to deaththroat slittingsubjective cameratelephoneshowdownfalling from heightslow motion sceneblood splattercorpsefiresurprise endingchaseknifecigarette smokingone word titleviolenceblood (See All) |
A sinister secret has been kept in the basement of an abandoned Los Angeles church for many years. With the death of a priest belonging to a mysterious sect, another priest opens the door to the basement and discovers a vat containing a green liquid. The priest contacts a group of physics graduate s …tudents to investigate it. Unfortunately, they discover that the liquid contains the essence of Satan himself, and they also discover that he will release HIS father - an all-powerful Anti-God! The liquid later comes to life itself, turning some of the students into zombies as the Devil comes forward to release his father. Will these students be able to stop him? (Read More)
Subgenre: | supernatural horrorsupernaturalsuspensecult film |
Themes: | supernatural powerself sacrificeunrequited loveparanoiadeceptionescapefeardeathsurrealismmurder |
Mood: | darkness |
Characters: | self mutilationprofessorstudentdoctor |
Story: | good versus evilreanimated corpsecollege studentescape attemptsinistermaggotwormdisfigurementblood on facestabbed in the throatpower outagefull moonlooking at oneself in a mirrorelectronic music scoreoccult …cult directordisappearancelightningcover upstabbed in the cheststabbed to deaththroat slittingimpalementdemonfalling from heightsecretblood splattercorpsesurprise endingchaseknifecigarette smokingblood (See All) |
The year is 1963, the night: Halloween. Police are called to 43 Lampkin Ln. only to discover that 15 year old Judith Myers has been stabbed to death, by her 6 year-old brother, Michael. After being institutionalized for 15 years, Myers breaks out on the night before Halloween. No one knows, nor want …s to find out, what will happen on October 31st 1978 besides Myers' psychiatrist, Dr. Loomis. He knows Michael is coming back to Haddonfield, but by the time the town realizes it, it'll be too late for many people. (Read More)
Subgenre: | cult filmindependent film |
Themes: | evilparanoiafeardeathmurder |
Mood: | slashernight |
Characters: | teenage girlpsychiatristkillergirlfemale protagonistboyteenager |
Period: | 1970s |
Story: | grindhouse filmpsychopathic killergood versus evilknife murderdrive in classicdemonicdead woman with eyes opentitle at the endmercilessnessdead womangrindhouseelectronic music scorekillingfirst partmurderer …character's point of view camera shotattempted murderprologuestabbed to deaththroat slittingstabbingstrangulationsubjective cameratelephonefalling from heightblood splattersurprise endingknifecigarette smokingone word titleviolencedog (See All) |
Phoenix officeworker Marion Crane is fed up with the way life has treated her. She has to meet her lover Sam in lunch breaks and they cannot get married because Sam has to give most of his money away in alimony. One Friday Marion is trusted to bank $40,000 by her employer. Seeing the opportunity to …take the money and start a new life, Marion leaves town and heads towards Sam's California store. Tired after the long drive and caught in a storm, she gets off the main highway and pulls into The Bates Motel. The motel is managed by a quiet young man called Norman who seems to be dominated by his mother. (Read More)
Subgenre: | suspensecult filmindependent film |
Themes: | unrequited lovevoyeurismdeceptionfeardeathmurder |
Mood: | darknessslasherrain |
Characters: | psychiatristkillersister sister relationshipfriend |
Story: | grindhouse filmpsychopathic killergood versus evilrotting corpseknife murderthreatened with a knifetelephone calldrive in classicremadebloody violencefade to blacksilhouettehearing voicesslashingdead woman with eyes open …rainstormvictimgrindhouselooking at oneself in a mirrorfaintingkillingfirst partmurderermissing personscreamcharacter's point of view camera shotstabbed in the cheststabbed to deathtoiletstabbingsubjective cameravoyeurhallucinationbathroomsecretcorpsevoice over narrationsurprise endingone word titleviolenceflashbackblood (See All) |
Two years after the events of Scream, Sidney Prescott and Randy are attending Windsor college. They are trying to get on with their lives...Until a new Ghostface killing spree begins. With the help of Dewey and Gale, Sidney must find out who's behind the murders. As the body count goes up, the list …of suspects goes down. (Read More)
Subgenre: | conspiracysuspensecult film |
Themes: | sadismparanoiavoyeurismdeceptionescapedrunkennessfearmurderdeath |
Mood: | slashergore |
Characters: | killerpolice officerfemale protagonistteenager |
Story: | offscreen killinggood versus evilcollege studentescape attemptthreatened with a knifefoot chasestabbed in the throatmercilessnessdeath of friendeavesdroppingkillingcult directorsuspicionscreamlightning …cover upcharacter repeating someone else's dialogueattempted murderscreamingstabbed in the cheststabbed to deaththroat slittingimpalementstabbingambushtelephonevoyeurhallucinationshowdownslow motion sceneblood splattercorpsesurprise endingchaseknifecigarette smokingbloodviolence (See All) |
Serial Killer Michael Myers is not finished with Laurie Strode, and their rivalry finally comes to an end. But is this the last we see of Myers? Freddie Harris and Nora Winston are reality programmers at DangerTainment, and are planning to send a group of 6 thrill-seeking teenagers into the childhoo …d home of Myers. Cameras are placed all over the house and no one can get out of the house... and then Michael arrives home! (Read More)
Subgenre: | cult filmindependent film |
Themes: | evildeceptionfearmurderdeath |
Mood: | slashergore |
Locations: | woodsforest |
Characters: | teenage girlpsychiatristkiller |
Story: | locked in a roompsychopathic killergood versus evilcollege studentheavy rainthreatened with a knifefoot chasebreaking a windowclimbing through a windowrainstormstabbed in the throatkillingmurdererdisappearancecharacter's point of view camera shot …lightningstabbed in the cheststabbed to deaththroat slittingimpalementstrangulationsubjective camerashowdownfalling from heightblood splattercorpsefiresurprise endingchaseknifeflashbackbloodviolence (See All) |
When a strange signal pulsates through all cell phone networks worldwide, it starts a murderous epidemic of epic proportions when users become bloodthirsty creatures, and a group of people in New England are among the survivors to deal with the ensuing chaos after.
Subgenre: | supernaturalsuspenseindependent film |
Themes: | supernatural powerpanicparanoiabrutalitydeceptionescapedrunkennessfearmurderdeath |
Mood: | gore |
Locations: | apartmentwoodsairportforest |
Characters: | teenage girlstudentpolice officerteacherteenager |
Story: | grindhouse filmfoot chaseblood on shirtdisfigurementaerial shotatticcovered in bloodcookburned aliveattempted murderscreamingdangerstabbed in the cheststabbed to deathtoilet …impalementambushshowdownfalling from heightslow motion sceneblood splattercorpsefiresurprise endingchaseknifeexplosiondancingcigarette smokingone word titledogviolenceblood (See All) |
Three backpackers travel into the Australian Outback, only to find themselves stranded at Wolf Creek crater. Once there they are encountered by a bushman, Mick Taylor, who offers them a ride back to his place. Little do the three know that their adventure into the Outback, would be a complete nightm …are after the backpackers find a way to escape. (Read More)
Subgenre: | suspensecult filmindependent film |
Themes: | crueltyevilsadismbrutalityescapedrunkennessfearmurderdeath |
Mood: | darknessslashernightgore |
Locations: | swimming pool |
Characters: | mysterious killerself mutilationkillerdoctor |
Story: | grindhouse filmpsychopathic killerrotting corpseknife murdergory violencebloody violencegraphic violenceslashingblood on shirtopening a doorrainstormbroken glassmercilessnessvictimkilling …first partmurdererattempted murderprologuedangerstabbed to deathimpalementstabbingswimmingvoyeurbathroomslow motion sceneblood splattercorpsechaseknifeexplosioncigarette smokingdogviolenceblood (See All) |
40 years ago, five youths on a weekend getaway in the Texas countryside fell prey to a butcher in a mask made of human skin and his cannibalistic family, and horror cinema would never be the same. Violent, confrontational, and shockingly realistic, director Tobe Hooper's THE TEXAS CHAIN SAW MASSACRE … terrified audiences in a way never thought possible when it was unleashed on a politically and socially tumultuous America in 1974. Facing a storm of controversy, censorship, and outcry throughout its troubled release, this masterpiece of horror has stood the test of time to become a landmark motion picture and cultural milestone. To celebrate the film's 40th anniversary and its enduring ability to scare audiences both new and old, Dark Sky Films proudly presents THE TEXAS CHAIN SAW MASSACRE in an all-new 4k digital transfer and with a newly created 7.1 surround sound mix supervised by Tobe Hooper. Get ready to experience fear in a whole new way. (Read More)
Subgenre: | suspensecult filmindependent film |
Themes: | panicevilsadismparanoiabrutalityescapefearmurderfriendshipdeath |
Mood: | darknessslasheravant garde |
Characters: | self mutilationteenage girlkillerteenager |
Period: | 1970s |
Story: | grindhouse filmoffscreen killingpsychopathic killerrotting corpseescape attemptthreatened with a knifefoot chasehell on earthdrive in classicremadebloody violenceextreme close upsinisterslashingcigarette lighter …psychotronicmutemercilessnesscovered in bloodfull moondeath of friendvictimgrindhousecookgothickillingcult directorfirst partmurdererscreamingdangerstabbed in the chestimpalementambushfalling from heightblood splattercorpsevoice over narrationsurprise endingchaseknifeviolenceblood (See All) |
With the disappearance of hack horror writer Sutter Cane, all Hell is breaking loose...literally! Author Cane, it seems, has a knack for description that really brings his evil creepy-crawlies to life. Insurance investigator John Trent is sent to investigate Cane's mysterious vanishing act and ends …up in the sleepy little East Coast town of Hobb's End. The fact that this town exists as a figment of Cane's twisted imagination is only the beginning of Trent's problems. (Read More)
Subgenre: | supernaturalsuspensecult filmindependent film |
Themes: | self sacrificeevilparanoiadeceptionescapefeardeathmurdersurrealism |
Characters: | psychiatristpolice officerdoctor |
Story: | good versus evilescape attemptheavy rainfoot chasedisfigurementrainstormcigarette lighteranimal attackschizophrenianosebleedlooking at oneself in a mirrorelectronic music scoregothickillingcult director …murderersuspiciondisappearancemissing personcharacter's point of view camera shotlightningcharacter repeating someone else's dialogueattempted murdersubjective camerahallucinationdemonbathroomblood splattercorpsesurprise endingchasecigarette smokingdogviolencebloodflashback (See All) |
Dr. Miranda Grey is a psychiatrist who works in a penitentiary, in the mental institution sector. She is married with Dr. Douglas Grey, the chief of department where Dr. Pete Graham also works. Chloe Sava, a patient of Dr. Miranda formerly abused by her stepfather, claims that she is frequently rape …d by the devil in her cell. After leaving the asylum in a stormy night, Dr. Miranda has a car accident, and when she wakes up, she is an inmate of the institution, being accused of an horrible crime and having no memory of the incident. (Read More)
Subgenre: | supernaturalsuspense |
Themes: | supernatural powerpanicunrequited loveevilparanoiaescapefeardeathmurder |
Mood: | darknessslashernightraingore |
Locations: | swimming pooltaxi |
Characters: | self mutilationpsychiatristkillerfemale protagonistdoctor |
Story: | flickering lightpsychopathic killerheavy raintelephone callfoot chasedemonicbloody violencegraphic violencehearing voicesslashingrainstormhypodermic needlegothickillingmurderer …injectionlightningattempted murderscreamingthroat slittingsubjective cameraswimminghallucinationblood splattercorpsefiresurprise endingchaseknifeexplosionviolenceflashbackblood (See All) |
At the turn of the century, the young lord Vlad and his family live a peaceful life ruling over their small kingdom, but when a Turk warlord demands from Vlad a thousand boys and his son to create an army Vlad seeks a terrible power that will allow him to protect his kingdom and family from the Turk …s at a terrible cost. (Read More)
Themes: | supernatural powerself sacrificebrutalitydeceptionfeardeathsurrealismmurder |
Locations: | woodsforest |
Characters: | self mutilation |
Story: | good versus evilheavy rainthreatened with a knifedrinking bloodglowing eyesbitten in the neckhearing voicesbatrainstormstabbed in the throatanimal attackgothicburned alivecharacter's point of view camera shotlightning …attempted murderscreaminglegendstabbed in the cheststabbed to deaththroat slittingimpalementambushsubjective camerademonshowdownfalling from heightslow motion sceneblood splattercorpsevoice over narrationfiresurprise endingchaseknifeexplosionflashbackbloodviolence (See All) |
In part six of the Nightmare on Elm Street series, dream monster Freddy Krueger has finally killed all the children of his hometown, and seeks to escape its confines to hunt fresh prey. To this end, he recruits the aid of his (previously unmentioned) daughter. However, she discovers the demonic orig …in of her father's powers and meets Dad head-on in a final showdown (originally presented in 3-D). (Read More)
Subgenre: | supernaturalcult filmindependent film |
Themes: | supernatural powerevilsadismescapedeathmurdersurrealism |
Mood: | darknessslasherraingore |
Characters: | self mutilationkillerteacherteenager |
Period: | 1970s |
Story: | animal killingkilling an animalevil spiritpsychopathic killergood versus evilgory violencedrive in classicdemonicbloody violenceghouldisfigurementvictimgothicburned alivekilling …murderercharacter repeating someone else's dialoguestabbed in the chestimpalementstrangulationsubjective camerademonshowdownfalling from heightslow motion sceneblood splatterfireknifeflashbackviolenceblood (See All) |
Johnny Smith wakes from a coma due to a car accident, only to find he has lost five years of his life, and yet gained psychic powers. Foreseeing the future appears to be a 'gift' at first, but ends up causing problems...
Subgenre: | supernaturalsuspensecult filmindependent film |
Themes: | supernatural powerpanicparanoiadeceptionfearmurdersurrealismdeath |
Mood: | slasher |
Locations: | school |
Characters: | self mutilationgermanpsychiatristpolice officerteacherdoctor |
Period: | 1970s |
Story: | grindhouse filmpsychopathic killergood versus evilheavy rainhouse on firedrive in classicslashingrainstormpsychotronicmercilessnessgrindhouseexploding buildingelectronic music scoregothiccult director …murdererlightningattempted murderdangerstabbed in the chesttelephonefalling from heightslow motion sceneblood splattercorpsefiresurprise endingchaseexplosionbloodflashback (See All) |
A band straying into a secluded part of the Pacific Northwest stumbles onto a horrific act of violence. Because they are the only witnesses, they become the targets of a terrifying gang of skinheads who want to make sure all the evidence is eliminated.
Subgenre: | suspenseindependent film |
Themes: | panicparanoiabrutalitydeceptionescapefeardeathfriendshipmurder |
Mood: | gore |
Locations: | woodsforest |
Characters: | german |
Story: | dressing roomanimal killingescape attemptthreatened with a knifethroat rippingroomaerial shotcigarette lighterstabbed in the neckstabbed in the throatpower outagemercilessnessanimal attackdeath of friendhypodermic needle …injectioncover upattempted murderdangerstabbed in the cheststabbed to deaththroat slittingstrangulationambushshowdownslow motion sceneblood splattercorpsesurprise endingknifecigarette smokingviolenceblooddog (See All) |
Picking up immediately after the events in Resident Evil: Retribution, Alice (Milla Jovovich) is the only survivor of what was meant to be humanity's final stand against the undead. Now, she must return to where the nightmare began - The Hive in Raccoon City, where the Umbrella Corporation is gather …ing its forces for a final strike against the only remaining survivors of the apocalypse. (Read More)
Subgenre: | conspiracy |
Themes: | self sacrificepanicillnessparanoiabrutalitydeceptionescapefearmurderdeath |
Mood: | gore |
Characters: | professorfemale protagonistdoctor |
Story: | barbed wireanimal killinglocker roomgood versus evilthreatened with a knifebitten in the neckaerial shotcigarette lighterbroken glassstabbed in the throatpower outagemercilessnessanimal attackelectronic music scorehypodermic needle …burned alivecharacter's point of view camera shotcover upprologuedangerstabbed in the cheststabbed to deaththroat slittingimpalementstrangulationambushsubjective camerashowdownfalling from heightslow motion sceneblood splattercorpsevoice over narrationfiresurprise endingchaseknifeexplosionbloodviolenceflashbackdog (See All) |
After the death of her ill mother in a fire, the young teenager Anna tries to commit suicide and is sent to a mental institution for treatment. Ten months later, Anna still cannot remember what had happened on the night her mother died. Her psychiatric Dr. Silberling, however, discharges her telling … that she has resolved her issues. Her father and successful writer, Steven, brings her back home in an isolated mansion nearby the coast. Anna finds that her mother's former nurse, Rachel Summers, is her stepmother now. Anna meets her beloved sister, Alex, swimming in the sea. She discovers that Steven has not delivered the letters and CDs that Alex had sent to her. As time moves on, Anna is haunted by ghosts and she believes that Rachel killed her mother. Alex and Anna decide to look for evidence to prove that Rachel is the murderer and Anna discovers the truth about the fire in the boat house. (Read More)
Subgenre: | psychological thrillersuspense |
Themes: | panicparanoiaescapedrunkennessfeardeathsurrealismmurder |
Mood: | night |
Locations: | woodsforest |
Characters: | psychiatristsister sister relationshipfemale protagonistteenager |
Story: | offscreen killingheavy rainhouse on fireblood on shirtaerial shotshadowatticcovered in bloodschizophrenialooking at oneself in a mirrorhypodermic needlegothicburned aliveeavesdroppingmurderer …suspicioninjectioncharacter's point of view camera shotattempted murderscreamingdangerstabbed to deathstabbingstrangulationsubjective cameraswimminghallucinationfalling from heightslow motion scenecorpsefiresurprise endingchaseknifeexplosionbloodflashback (See All) |
Julie's back in college with her new friend, and they win a weekend trip to an island. On the way there, someone dies, and then the girls are tormented on the island.
Themes: | paranoiadeceptionescapefeardeathmurder |
Mood: | slashergore |
Locations: | swimming poolairport |
Characters: | doctorfriendteenager |
Story: | offscreen killingcollege studentheavy rainthreatened with a knifeblood on facerainstormatticbroken glassstabbed in the throatpower outagedeath of friendlooking at oneself in a mirrorlightningcharacter repeating someone else's dialogueattempted murder …screamingstabbed in the cheststabbed to deathimpalementambushhallucinationshowdownblood splattercorpsesurprise endingchaseknifedancingflashbackbloodviolence (See All) |
It's been nearly ten years since Freddy Krueger terrorized people in the dreams, and the towns folk want to keep him erased from their memory. Freddy still has one more plan on getting back to Elm Street. He resurrects Jason Voorhees and sends him off to kill. The more bodies which fall to the groun …d, the stronger in which Freddy becomes. This is until, Freddy realizes that Jason isn't going to step aside easily, and must be taken down himself. (Read More)
Subgenre: | supernaturalsuspensecult filmindependent film |
Themes: | supernatural powerevilbrutalitydrunkennessfeardeathmurder |
Mood: | slasherraingore |
Locations: | forest |
Characters: | teenage girlkiller |
Story: | evil spiritpsychopathic killerreanimated corpsefoot chasegory violencehell on earthsatanicdemonicbloody violencegraphic violenceghoulslashingpsychotronicvictimburned alive …killingmurderercharacter's point of view camera shotcover upcharacter repeating someone else's dialogueprologueimpalementstabbingdemonfalling from heightslow motion sceneblood splattercorpsevoice over narrationfiresurprise endingexplosionbloodflashbackviolence (See All) |
The residents of Haddonfield don't know it yet... but death is coming to their small sleepy town. Sixteen years ago, a ten year old boy called Michael Myers brutally kills his step father, his elder sister and her boyfriend. Sixteen years later, he escapes from the mental institution and makes his w …ay back to his hometown intent on a murderous rampage pursued by Dr Sam Loomis who is Michael's doctor and the only one who knows Michael's true evil. Elsewhere a shy teenager by the name of Laurie Strode is babysitting on the night Michael comes home... is it pure coincidence that she and her friends are being stalked by him? (Read More)
Themes: | mysterious deathevilsadismbrutalitydeathmurder |
Mood: | darknessslashernightgore |
Characters: | psychiatristkillerboydoctorteenager |
Period: | 1970s |
Story: | animal killingkilling an animalpsychopathic killerschool principalknife murdergory violencesatanicbloody violencethroat rippinggraphic violenceslashingvictimelectronic music scorekillingmurderer …hangingcharacter's point of view camera shotstabbed in the cheststabbed to deaththroat slittingimpalementstabbingstrangulationsubjective camerafalling from heightblood splattercorpsechaseknifebloodviolence (See All) |
The story centers on a corporate climber who gets stuck working late on Christmas Eve and finds herself the target of an unhinged security guard. With no help in sight, the woman must overcome physical and psychological challenges to survive.
Subgenre: | psychological thrillersuspenseindependent film |
Themes: | paniccrueltyparanoiadeceptionescapedrunkennessfearmurderdeath |
Mood: | darknessslashergore |
Locations: | taxi |
Characters: | police officerfemale protagonist |
Story: | locked in a roomanimal killingkilling an animalescape attempttelephone callfoot chaseblood on shirtaerial shotpower outagebloody nosecovered in bloodanimal attackburned aliveeavesdroppingcharacter's point of view camera shot …attempted murderscreamingstabbingstrangulationwinesubjective cameravoyeurblood splattercorpsefiresurprise endingchaseknifeexplosionone word titlebloodviolencedog (See All) |
Following the events of _Night of the Living Dead (1968)_ (qv), we follow the exploits of four survivors of the expanding zombie apocalypse as they take refuge in an abandoned shopping mall following a horrific SWAT evacuation of an apartment complex. Taking stock of their surroundings, they arm the …mselves, lock down the mall, and destroy the zombies inside so they can eke out a living--at least for a while. Tensions begin to build as months go on, and they come to realize that they've fallen prey to consumerism. Soon afterward, they have even heavier problems to worry about, as a large gang of bikers discovers the mall and invades it, ruining the survivors' best-laid plans and forcing them to fight off both lethal bandits and flesh-eating zombies. (Read More)
Subgenre: | italian horrorcult filmindependent film |
Themes: | panicsadismparanoiabrutalityescapefearmurderdeath |
Mood: | gore |
Locations: | apartment |
Characters: | professorpolice officerdoctor |
Period: | 1970s |
Story: | grindhouse filmoffscreen killinggood versus evilescape attemptthreatened with a knifegory violencehell on earthdrive in classicremadebloody violencebitten in the throatgraphic violencebitten in the neckclimbing through a windowspiral staircase …blood on shirtdisfigurementaerial shotcigarette lighterstabbed in the neckpsychotronicpower outagemercilessnesscovered in blooddeath of friendgrindhouselooking at oneself in a mirrorelectronic music scoreburned alivecult directorcharacter's point of view camera shotcharacter repeating someone else's dialoguescreamingdangerstabbed in the cheststabbed to deathtoiletambushsubjective camerafalling from heightblood splattercorpsefiresurprise endingchaseknifeexplosioncigarette smokingbloodviolencedog (See All) |
In Ruggsville, Texas, the police under the command of Sheriff John Quincy Wydell attack the house of the sadistic serial killers Firefly family (a.k.a. The Devil's Reject) and they arrest mother Firefly, but Otis B. Driftwood and Baby Firefly escape from the siege. Tiny is wandering nearby the house … and also escapes. Otis and Baby call their patriarch, the mad clown Captain Spaulding and they schedule to reunite at an isolated motel in the desert. When Otis and Baby arrive, they kidnap two families of singers, using sadism and violence against the harmless persons. Meanwhile, Sheriff Wydell promises to capture and kill the runaways, seeking revenge for the death of his brother, the Deputy George Wydell. (Read More)
Subgenre: | cult filmindependent film |
Themes: | self sacrificecrueltyevilsadismparanoiabrutalitydeceptionescapefeardeathmurderfriendship |
Mood: | gore |
Characters: | police officer |
Period: | 1970s |
Story: | grindhouse filmpsychopathic killerescape attempthouse on fireknife murderthreatened with a knifefoot chasesatanicgraphic violenceblood on shirtdisfigurementcigarette lighterstabbed in the neckstabbed in the throatmercilessness …covered in blooddeath of friendgrindhouselooking at oneself in a mirrorcult directormurdererscreamingstabbed in the cheststabbed to deaththroat slittingimpalementstrangulationambushshowdownslow motion sceneblood splattercorpsefirechaseknifeexplosioncigarette smokingflashbackdogviolenceblood (See All) |
Medical students begin to explore the realm of near death experiences, hoping for insights. Each has their heart stopped and is revived. They begin having flashes of walking nightmares from their childhood, reflecting sins they committed or had committed against them. The experiences continue to int …ensify, and they begin to be physically beaten by their visions as they try and go deeper into the death experience to find a cure. (Read More)
Subgenre: | psychological thrillersuspensecult film |
Themes: | supernatural powerpaniccrueltyparanoiaescapefeardeathsurrealism |
Locations: | apartmentwoodsforestschool |
Characters: | girlboydoctor |
Story: | animal killingcollege studentheavy raintelephone callfoot chaseremadeclimbing through a windowaerial shotheartpower outagereverse footagelooking at oneself in a mirrorelectronic music scorehypodermic needlegothic …injectioncharacter's point of view camera shotscreamingdangerimpalementsubjective cameratelephonehallucinationbathroomfalling from heightslow motion scenecorpsesurprise endingchaseknifecigarette smokingone word titledogbloodflashback (See All) |
Alice, having survived the previous installment of the Nightmare series, finds the deadly dreams of Freddy Krueger starting once again. This time, the taunting murderer is striking through the sleeping mind of Alice's unborn child. His intention is to be "born again" into the real world. The only on …e who can stop Freddy is his dead mother, but can Alice free her spirit in time to save her own son? (Read More)
Subgenre: | supernaturalcult filmindependent film |
Themes: | supernatural powerevilsadismbrutalityfeardeathmurderfriendship |
Mood: | slashergore |
Locations: | swimming pool |
Characters: | killergirlfemale protagonistboydoctorfriendteenager |
Story: | grindhouse filmlocker roomevil spiritindoor swimming poolpsychopathic killergood versus eviltelephone callfoot chasedrive in classicdemonicbloody violenceghoulbreaking a windowslashingdisfigurement …blood on facedeath of friendvictimfaintingkillingmurdererscreamscreamingdangerimpalementstabbinghallucinationdemonfalling from heightslow motion sceneblood splattersurprise endingchaseknifeflashbackbloodviolence (See All) |
For nineteen-year-old Jay, Autumn should be about school, boys and week-ends out at the lake. But after a seemingly innocent sexual encounter, she finds herself plagued by strange visions and the inescapable sense that someone, something, is following her. Faced with this burden, Jay and her friends … must find a way to escape the horrors, that seem to be only a few steps behind. (Read More)
Subgenre: | supernatural horrorsupernaturalcult film |
Themes: | supernatural powerpanicevilparanoiavoyeurismescapefeardeathfriendshipmurder |
Mood: | rain |
Locations: | swimming poolforestschool |
Characters: | teenage girlsister sister relationshipfemale protagonistfriendteenager |
Story: | grindhouse filmindoor swimming poolcollege studentfoot chasefootstepsbreaking a windowhallwayinvisibilitydeath of friendvictimlooking at oneself in a mirrorelectronic music scorelightningdangersubjective camera …voyeurdemonbathroomblood splattercorpsechaseviolenceblood (See All) |
When an eccentric millionaire offer a group of opposites $1,000,000 to spend the night in a so called "Haunted House" with a murderous past, they figure it is a quick way to get quick money and leave. All of them are sure it is some made up story just to mess with their heads a little and test their … courage. But, once they stay in the house they start to think about the mistake they made in coming there when mysterious things start to happen. (Read More)
Subgenre: | supernaturalconspiracy |
Themes: | supernatural powerself sacrificeparanoiadeceptionescapedrunkennessfearmurdersurrealismdeath |
Mood: | nightgore |
Characters: | doctor |
Story: | offscreen killingevil spiritrotting corpseescape attemptfragments of glassblood on shirtatticstabbed in the neckbroken glasscovered in bloodgothicsuspicioncharacter's point of view camera shotattempted murderscreaming …prologuestabbed in the cheststabbed to deathimpalementambushsubjective camerahallucinationdemonblood splattercorpsefiresurprise endingchaseknifeblood (See All) |
A new film is currently in production, and a killer is on the loose. The murders draw a reporter, ex-cop, and young woman to the set of the movie inspired by their life. They soon find out that they are dealing with a trilogy, and in a trilogy...anything can happen.
Subgenre: | independent film |
Themes: | paranoiabrutalityvoyeurismdeceptionescapedrunkennessfearmurderdeath |
Mood: | slashergore |
Locations: | swimming poolapartment |
Characters: | killerpolice officerfemale protagonist |
Story: | threatened with a knifefoot chasehidden doorhearing voicesblood on shirtaerial shotstabbed in the throatmercilessnesseavesdroppingcult directorsuspicionscreamcover upcharacter repeating someone else's dialoguescreaming …coffinstabbed in the cheststabbed to deathtoiletthroat slittingstrangulationambushvoyeurhallucinationshowdownfalling from heightsecretblood splattercorpsesurprise endingchaseknifecigarette smokingbloodviolencedog (See All) |
Darryl Revok is the most powerful of all the scanners, and is the head of the underground scanner movement for world domination. Scanners have great psychic power, strong enough to control minds; they can inflict enormous pain/damage on their victims. Doctor Paul Ruth finds a scanner that Revok hasn …'t, and converts him to their cause - to destroy the underground movement. (Read More)
Subgenre: | conspiracysuspensecult filmindependent film |
Themes: | supernatural powerbrutalitydeceptionescapesurrealismdeathmurder |
Mood: | nightgore |
Locations: | taxi |
Characters: | self mutilationprofessordoctor |
Story: | telephone callfoot chasefade to blackhearing voicesopening a doorblood on facereverse footagegrindhousevisitnosebleedelectronic music scorehypodermic needleburned alivecult directorinjection …character's point of view camera shotcover upscreamingsubjective cameratelephonehallucinationshowdownfalling from heightblood splattercorpsefiresurprise endingchaseexplosioncigarette smokingone word titleflashbackviolenceblood (See All) |
Picking up where the original Nightmare left off, Nancy has grown up and become a psychiatrist specializing in dream therapy. She meets a group of children at a local hospital facing Freddy Krueger, the same demon she once encountered in her sleep. One of them is Kristen, who has the power to draw o …ther people into her dreams. Working with a male doctor assigned to the case, Nancy helps the kids realize their special abilities within the nightmare world. When Freddy captures one of her charges, she leads a rescue attempt into Krueger's domain, in hopes of putting his spirit to rest once and for all. (Read More)
Subgenre: | supernaturalcult filmindependent film |
Themes: | supernatural powerevilsadismdeathmurder |
Mood: | slashergore |
Characters: | self mutilationpsychiatristkillerdoctorteenager |
Story: | razor bladeevil spiritpsychopathic killerhanged girlfoot chasestabbed with glassfootstepsdrive in classicdemonicbloody violenceghoulsleepslashingdisfigurementmute …death of friendvictimelectronic music scorekillingmurderercharacter repeating someone else's dialoguescreamingstabbed in the cheststabbed to deathimpalementstabbingdemonbathroomfalling from heightslow motion sceneblood splattercorpsefiresurprise endingcigarette smokingviolence (See All) |
When Max (Taissa Farmiga) and her friends reluctantly attend a tribute screening of an infamous '80s slasher film that starred Max's late mother (Malin Akerman), they are accidentally sucked into the silver screen. They soon realize they are trapped inside the cult classic movie and must team up wit …h the fictional and ill-fated "Camp Bloodbath" counselors, including Max's mom as the shy scream queen, to battle the film's machete-wielding, masked killer. With the body count rising in scene after iconic scene, who will be THE FINAL GIRLS left standing and live to escape this film? (Read More)
Subgenre: | independent film |
Themes: | self sacrificepanicbrutalityvoyeurismescapefearfriendshipdeathsurrealismmurder |
Mood: | slasher |
Locations: | woodsforest |
Characters: | teenage girlkillergirlfemale protagonistdoctorteenager |
Story: | grindhouse filmgood versus evilescape attemptfoot chasezippo lighterdisfigurementcigarette lightermercilessnesselectronic music scorescreamlightningattempted murderscreamingprologuedanger …stabbed in the cheststabbed to deathimpalementambushvoyeurshowdownslow motion scenefiresurprise endingchaseknifeexplosiondancingcigarette smokingflashbackviolence (See All) |